BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS125B05

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    283   8e-87   Solanum tuberosum [potatoes]
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    283   9e-87   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    279   4e-85   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    278   6e-85   Solanum lycopersicum
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    278   1e-84   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    278   1e-84   
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    278   1e-84   Nicotiana tomentosiformis
ref|XP_002510674.1|  protein binding protein, putative                  273   3e-83   Ricinus communis
dbj|BAD95193.1|  hypothetical protein                                   259   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    271   3e-82   Fragaria vesca subsp. vesca
gb|KJB57964.1|  hypothetical protein B456_009G187700                    270   1e-81   Gossypium raimondii
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    269   1e-81   Eucalyptus grandis [rose gum]
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    268   3e-81   Cucumis melo [Oriental melon]
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    269   4e-81   Eucalyptus grandis [rose gum]
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    267   1e-80   Sesamum indicum [beniseed]
gb|KHG01113.1|  hypothetical protein F383_22949                         266   2e-80   Gossypium arboreum [tree cotton]
emb|CDP07293.1|  unnamed protein product                                266   2e-80   Coffea canephora [robusta coffee]
emb|CBI40712.3|  unnamed protein product                                265   3e-80   Vitis vinifera
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             266   3e-80   Prunus persica
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    265   4e-80   Vitis vinifera
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    265   4e-80   Prunus mume [ume]
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                265   4e-80   Erythranthe guttata [common monkey flower]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    265   6e-80   Malus domestica [apple tree]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    265   7e-80   
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  265   8e-80   
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    263   2e-79   Cucumis sativus [cucumbers]
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             263   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             263   3e-79   Capsella rubella
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    262   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    262   1e-78   Camelina sativa [gold-of-pleasure]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               261   1e-78   Arabis alpina [alpine rockcress]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    261   1e-78   
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    261   1e-78   Camelina sativa [gold-of-pleasure]
emb|CDY29657.1|  BnaA04g17700D                                          262   1e-78   Brassica napus [oilseed rape]
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    261   1e-78   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        261   2e-78   
emb|CDX97805.1|  BnaC04g41340D                                          261   2e-78   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        261   2e-78   
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    261   2e-78   Populus euphratica
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    261   2e-78   Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           260   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    260   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    260   5e-78   Oryza brachyantha
ref|NP_180618.2|  BTB/POZ domain-containing protein                     259   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           259   7e-78   
dbj|BAD93995.1|  hypothetical protein                                   259   8e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  259   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    258   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    256   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    256   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    255   3e-76   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    255   3e-76   
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  254   4e-76   Morus notabilis
gb|AES98295.2|  BTB/POZ domain plant protein                            254   8e-76   Medicago truncatula
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    254   9e-76   Populus euphratica
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    253   1e-75   Populus euphratica
gb|EEE63337.1|  hypothetical protein OsJ_18148                          251   2e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003615337.1|  Kelch-like protein                                 253   3e-75   
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    251   5e-75   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    251   6e-75   
gb|AAV43802.1|  unknown protein                                         251   7e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    250   2e-74   Brachypodium distachyon [annual false brome]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    250   2e-74   Citrus sinensis [apfelsine]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    250   2e-74   Citrus sinensis [apfelsine]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             250   2e-74   
gb|EEC79014.1|  hypothetical protein OsI_19541                          249   4e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    248   9e-74   Brassica rapa
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    248   1e-73   Brassica rapa
emb|CDM85346.1|  unnamed protein product                                248   1e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             247   2e-73   Phaseolus vulgaris [French bean]
ref|NP_001174372.1|  Os05g0345500                                       229   4e-73   
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    246   9e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    241   5e-71   
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    241   5e-71   Cicer arietinum [garbanzo]
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    240   7e-71   Cicer arietinum [garbanzo]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    241   1e-70   
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          239   2e-70   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    238   4e-70   Nicotiana sylvestris
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          237   2e-69   Sorghum bicolor [broomcorn]
gb|EPS65824.1|  hypothetical protein M569_08953                         221   5e-64   Genlisea aurea
ref|XP_001751401.1|  predicted protein                                  218   1e-62   
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             209   1e-59   
gb|AAB63076.1|  unknown protein                                         193   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              208   4e-59   
gb|KIY99757.1|  hypothetical protein MNEG_8204                          188   3e-52   Monoraphidium neglectum
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              184   6e-51   Chlorella variabilis
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062              158   2e-42   Coccomyxa subellipsoidea C-169
ref|XP_011399599.1|  BTB/POZ domain-containing protein                  142   2e-36   Auxenochlorella protothecoides
ref|XP_001697437.1|  predicted protein                                  118   2e-30   Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365              116   1e-29   Volvox carteri f. nagariensis
ref|XP_004339299.1|  BTB/POZ domain containing protein                  112   6e-25   Acanthamoeba castellanii str. Neff
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    1e-19   
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     87.0    3e-18   Helicosporidium sp. ATCC 50920
ref|XP_005708947.1|  ubiquitin-protein ligase                         88.6    1e-16   Galdieria sulphuraria
ref|XP_004333299.1|  BTB/POZ domain containing protein                83.2    6e-15   Acanthamoeba castellanii str. Neff
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               81.3    3e-14   Galdieria sulphuraria
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               81.3    3e-14   Galdieria sulphuraria
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  81.3    4e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  81.3    4e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  81.3    4e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  81.3    4e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_003288046.1|  hypothetical protein DICPUDRAFT_16127            80.5    4e-14   Dictyostelium purpureum
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    1e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    1e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    1e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    1e-13   
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Ceratitis capitata [medfly]
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Ceratitis capitata [medfly]
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Ceratitis capitata [medfly]
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.0    2e-13   
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    5e-13   Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    5e-13   Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    5e-13   Musca domestica
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    5e-13   Musca domestica
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    6e-13   
gb|AAB47544.1|  MigA                                                  77.0    7e-13   Dictyostelium discoideum
ref|XP_639138.1|  BTB/POZ domain-containing protein                   77.0    7e-13   Dictyostelium discoideum AX4
ref|XP_005842130.1|  hypothetical protein GUITHDRAFT_41514            71.2    2e-12   Guillardia theta CCMP2712
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  76.3    2e-12   Crassostrea gigas
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  76.3    2e-12   Crassostrea gigas
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    75.9    2e-12   Crassostrea gigas
ref|XP_004341500.1|  BTB/POZ domain containing protein                71.6    1e-11   Acanthamoeba castellanii str. Neff
dbj|GAM18790.1|  hypothetical protein SAMD00019534_019650             72.4    1e-11   Acytostelium subglobosum LB1
ref|XP_001969437.1|  GG23957                                          73.6    1e-11   
ref|XP_002089068.1|  GE26196                                          73.6    1e-11   Drosophila yakuba
ref|WP_029637034.1|  hypothetical protein [                           69.7    2e-11   [Scytonema hofmanni] UTEX B 1581
ref|XP_002078905.1|  GD22285                                          72.8    2e-11   
ref|XP_002036468.1|  GM11846                                          72.4    3e-11   Drosophila sechellia
ref|XP_001749884.1|  hypothetical protein                             72.4    3e-11   Monosiga brevicollis MX1
ref|XP_002004091.1|  GI19489                                          72.4    3e-11   
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_001963078.1|  GF14121                                          71.6    6e-11   Drosophila ananassae
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               71.2    8e-11   Pediculus humanus corporis [human body lice]
gb|KFB39857.1|  AGAP009511-PA-like protein                            70.9    1e-10   Anopheles sinensis
emb|CDK13345.1|  HECD-1, isoform g                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
ref|NP_501120.1|  Protein HECD-1                                      70.5    1e-10   
emb|CDK13340.1|  HECD-1, isoform b                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
emb|CDK13346.1|  HECD-1, isoform h                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
emb|CDK13341.1|  HECD-1, isoform c                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  70.5    1e-10   Salpingoeca rosetta
ref|XP_001844071.1|  E3 ubiquitin-protein ligase HECTD1               70.5    1e-10   Culex quinquefasciatus
gb|ETO36723.1|  hypothetical protein RFI_00341                        70.1    1e-10   Reticulomyxa filosa
emb|CDK13342.1|  HECD-1, isoform d                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
emb|CDK13343.1|  HECD-1, isoform e                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
emb|CDK13339.1|  HECD-1, isoform a                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
gb|ERL91993.1|  hypothetical protein D910_09315                       70.5    1e-10   Dendroctonus ponderosae
emb|CDK13344.1|  HECD-1, isoform f                                    70.5    1e-10   Caenorhabditis elegans [roundworm]
gb|ENN80588.1|  hypothetical protein YQE_02993                        70.5    2e-10   Dendroctonus ponderosae
ref|XP_645290.1|  hypothetical protein DDB_G0272218                   69.3    2e-10   Dictyostelium discoideum AX4
ref|NP_609369.1|  CG5604                                              69.7    2e-10   Drosophila melanogaster
gb|AAQ23602.1|  LP05936p                                              69.7    2e-10   Drosophila melanogaster
ref|XP_005322716.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    69.7    2e-10   
ref|XP_310184.4|  AGAP009511-PA                                       69.7    2e-10   Anopheles gambiae str. PEST
gb|ETN62256.1|  hect E3 ubiquitin ligase                              69.7    2e-10   Anopheles darlingi [American malaria mosquito]
gb|ETN82977.1|  HECT-domain protein                                   69.3    3e-10   Necator americanus
ref|XP_004361480.1|  BTB/POZ domain-containing protein                68.6    3e-10   Cavenderia fasciculata
ref|XP_003294753.1|  hypothetical protein DICPUDRAFT_51693            68.6    3e-10   Dictyostelium purpureum
ref|XP_001652833.1|  AAEL007705-PA                                    68.9    4e-10   
ref|XP_635359.1|  hypothetical protein DDB_G0291147                   68.6    4e-10   Dictyostelium discoideum AX4
gb|EYB85246.1|  hypothetical protein Y032_0302g1869                   68.9    4e-10   Ancylostoma ceylanicum
ref|XP_001992956.1|  GH13561                                          68.9    5e-10   Drosophila grimshawi
gb|ETO35939.1|  hypothetical protein RFI_01125                        68.2    5e-10   Reticulomyxa filosa
gb|ERG82482.1|  e3 ubiquitin-protein ligase hectd1                    68.6    6e-10   
ref|XP_011267641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    6e-10   Camponotus floridanus
ref|XP_011267642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    6e-10   Camponotus floridanus
ref|XP_011267639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    6e-10   Camponotus floridanus
ref|XP_011267637.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    6e-10   Camponotus floridanus
gb|EFN60527.1|  E3 ubiquitin-protein ligase HECTD1                    68.6    6e-10   Camponotus floridanus
ref|XP_011267640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    6e-10   
ref|XP_006975329.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Peromyscus maniculatus bairdii
ref|XP_011242353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Mus musculus [mouse]
ref|XP_006240150.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Rattus norvegicus [brown rat]
ref|XP_007637045.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_004682014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    68.2    7e-10   Condylura cristata
ref|XP_004864088.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Heterocephalus glaber [naked mole rat]
ref|XP_005343806.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    68.2    7e-10   
ref|XP_004909448.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   
ref|XP_006975330.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    7e-10   Peromyscus maniculatus bairdii
ref|XP_006975328.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Peromyscus maniculatus bairdii
ref|XP_006975327.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Peromyscus maniculatus bairdii
ref|XP_004909450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   
ref|XP_004864090.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Heterocephalus glaber [naked mole rat]
ref|XP_004909451.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   
ref|XP_004864091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Heterocephalus glaber [naked mole rat]
ref|XP_007637041.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_011242352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Mus musculus [mouse]
ref|XP_011242351.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Mus musculus [mouse]
ref|XP_003499219.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Cricetulus griseus [Chinese hamsters]
ref|XP_006240148.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Rattus norvegicus [brown rat]
ref|NP_659037.2|  E3 ubiquitin-protein ligase HECTD1                  68.2    8e-10   Mus musculus [mouse]
ref|XP_006240151.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   
ref|XP_007618568.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   
ref|XP_006240149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Rattus norvegicus [brown rat]
ref|XP_004661912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    68.2    8e-10   Jaculus jaculus
sp|Q69ZR2.2|HECD1_MOUSE  RecName: Full=E3 ubiquitin-protein ligas...  68.2    8e-10   Mus musculus [mouse]
ref|XP_007891590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_007891591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.2    8e-10   Callorhinchus milii [Australian ghost shark]
gb|EFA01492.1|  hypothetical protein TcasGA2_TC007046                 68.2    8e-10   
ref|XP_008192900.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    68.2    8e-10   
ref|XP_007891592.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_007891589.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_007891587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_007429073.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   
ref|XP_002052386.1|  GJ21961                                          67.8    9e-10   Drosophila virilis
ref|XP_007429075.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   
ref|XP_007429074.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    9e-10   
ref|XP_002633092.1|  Hypothetical protein CBG05779                    67.8    1e-09   Caenorhabditis briggsae
ref|XP_011314687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.8    1e-09   Fopius arisanus
ref|XP_002676026.1|  predicted protein                                67.0    1e-09   Naegleria gruberi strain NEG-M
ref|XP_007063755.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  67.4    1e-09   
ref|XP_010198466.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    67.4    1e-09   Colius striatus
gb|KHJ84376.1|  hypothetical protein OESDEN_15912                     66.2    1e-09   Oesophagostomum dentatum [nodule worm]
gb|KDR14371.1|  E3 ubiquitin-protein ligase HECTD1                    67.4    1e-09   Zootermopsis nevadensis
ref|XP_002014386.1|  GL19165                                          67.4    1e-09   Drosophila persimilis
ref|XP_008565371.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Galeopterus variegatus [Malayan flying lemur]
emb|CAP26541.2|  Protein CBR-HECD-1                                   67.4    1e-09   Caenorhabditis briggsae
gb|EMP32200.1|  E3 ubiquitin-protein ligase HECTD1                    67.4    1e-09   Chelonia mydas [green seaturtle]
ref|XP_011314688.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_011314684.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_008565370.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011314686.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_011314680.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_011314682.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_011314681.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_011314679.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.4    1e-09   Fopius arisanus
ref|XP_009860152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    67.4    1e-09   
ref|XP_011314685.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    1e-09   Fopius arisanus
ref|XP_003924275.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    1e-09   Saimiri boliviensis boliviensis
ref|XP_010333267.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Saimiri boliviensis boliviensis
ref|XP_005951436.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_010333269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Saimiri boliviensis boliviensis
ref|XP_010333268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Saimiri boliviensis boliviensis
ref|XP_008312929.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_004209170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_008565372.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008312922.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009909049.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    67.0    2e-09   Picoides pubescens
ref|XP_005728612.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  67.0    2e-09   
ref|XP_005456014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_005561082.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_008312937.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_002075680.1|  GK23521                                          67.0    2e-09   
gb|EHH27804.1|  hypothetical protein EGK_18090                        67.0    2e-09   Macaca mulatta [rhesus macaque]
ref|XP_005456015.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_010631867.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005456013.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_003451257.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
dbj|BAA86445.2|  KIAA1131 protein                                     67.0    2e-09   Homo sapiens [man]
ref|XP_005561083.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_010631864.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005285366.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Chrysemys picta bellii
ref|XP_009209620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   
ref|XP_004554704.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  67.0    2e-09   
ref|XP_010631865.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
gb|EPQ16917.1|  E3 ubiquitin-protein ligase HECTD1                    67.0    2e-09   Myotis brandtii
ref|XP_010631866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_004612165.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    67.0    2e-09   Sorex araneus [Eurasian shrew]
ref|XP_009209621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_009209622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010961313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  67.0    2e-09   Camelus bactrianus [camel]
ref|XP_005285367.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005196337.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007936773.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   Orycteropus afer afer
ref|XP_007098139.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Panthera tigris altaica
ref|XP_007098138.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Panthera tigris altaica
ref|XP_005196335.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005196334.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005196336.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004637178.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_006056670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010845303.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Bison bison bison
ref|XP_003821255.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Pan paniscus [bonobo]
gb|AAP13073.1|  E3 ligase for inhibin receptor                        66.6    2e-09   Homo sapiens [man]
ref|XP_010372961.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Rhinopithecus roxellana
ref|XP_007984591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Chlorocebus sabaeus
ref|XP_004755203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Mustela putorius furo [black ferret]
ref|XP_003792055.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_011374705.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   Pteropus vampyrus
ref|XP_008708622.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   Ursus maritimus [white bear]
ref|XP_005890166.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_004467981.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004017927.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_002753836.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|NP_001248188.1|  E3 ubiquitin-protein ligase HECTD1               66.6    2e-09   
ref|XP_010372956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006056666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004421198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_005881051.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010845302.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010984469.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   
ref|XP_008972941.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005881052.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005377018.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_850301.2|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-pr...  66.6    2e-09   
ref|XP_005222132.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010071203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_008162333.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010372958.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007984588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004467982.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_002696742.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006085911.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_003408766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_003260766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_004055105.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_005222131.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_011222353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010845300.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004755200.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_011374703.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007516893.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_006906925.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   
ref|XP_001924707.4|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   
ref|XP_005377022.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005377021.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004801249.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_008267699.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
gb|ELR60436.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    2e-09   
ref|XP_002718172.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004755198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
sp|Q9ULT8.3|HECD1_HUMAN  RecName: Full=E3 ubiquitin-protein ligas...  66.6    2e-09   
ref|XP_010961316.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_011281667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_009004155.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|NP_001131085.1|  HECT domain containing E3 ubiquitin protein ...  66.6    2e-09   
ref|XP_004467984.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006152455.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_004755199.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006191324.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_010586873.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005222129.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008071204.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_004584798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_004376588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_011222356.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008267702.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
gb|ELW63202.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    2e-09   
ref|XP_009004152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004755202.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004467983.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010586872.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_002918561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006835428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_006890036.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_007098141.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010586874.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_009004153.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008267700.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005377019.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004324112.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
gb|ELK17058.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    2e-09   
ref|XP_008972943.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005377020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005881054.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
gb|KFO93631.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    2e-09   
ref|XP_010372960.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007984590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006766087.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_010140687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_011222355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005881050.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008972942.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005222130.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006085913.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007180745.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   
ref|XP_009004154.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008267701.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_011222354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006085912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101611.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101609.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101614.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101612.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007098140.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010214809.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006116430.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101608.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
gb|KFV06434.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    2e-09   
ref|XP_003464797.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  66.6    2e-09   
ref|XP_010372959.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005267560.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006116428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101615.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
gb|ETO19266.1|  E3 ubiquitin-protein ligase HECTD1                    65.9    2e-09   
ref|XP_010961314.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_009915163.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_006056668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005695269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004755201.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_004400006.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_010845301.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_006056667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005695268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_003756170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_008101607.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_001364091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_010214811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_008101613.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_011374706.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_007472585.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_009986276.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    2e-09   
ref|XP_006056669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_005695270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    2e-09   
ref|XP_001512305.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    3e-09   
ref|XP_007113427.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    3e-09   
ref|XP_004282185.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.6    3e-09   
ref|XP_009968713.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_007472587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.6    3e-09   
ref|XP_006116433.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007660814.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007660811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007113426.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006116432.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007660823.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007660828.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006116431.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009489109.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_007472586.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288636.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007451326.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
gb|KFV19064.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
ref|XP_010169085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
gb|KFP99363.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
ref|XP_009288631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010572565.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006729616.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
gb|KFP65021.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
ref|XP_010572557.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288635.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010572556.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317623.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005832107.1|  hypothetical protein GUITHDRAFT_46879            62.0    3e-09   
ref|XP_007660818.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005020665.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005792638.1|  hypothetical protein EMIHUDRAFT_108691           62.8    3e-09   
ref|XP_010572564.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006263085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010015718.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010151091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009668205.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010709949.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007113428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010709951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009462362.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010572558.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288633.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_007472588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010572559.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009951548.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009942450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009698490.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009574994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009317626.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_008923247.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_005417553.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_005479915.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_005149352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
gb|KFV93612.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
ref|XP_010709948.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_421227.3|  PREDICTED: E3 ubiquitin-protein ligase HECTD1 i...  66.2    3e-09   
ref|XP_002200542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010709950.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010390270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288634.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005020672.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010390306.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005020670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317625.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_004941799.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317624.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006022320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317628.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006263084.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010390263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_008275346.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009317621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_006263086.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010709955.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_004941800.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010572561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010125887.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_006022318.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005520368.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009317620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
gb|EMC83831.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
gb|EOB00564.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
gb|KFP49559.1|  E3 ubiquitin-protein ligase HECTD1                    66.2    3e-09   
ref|XP_009644998.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010390277.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009288632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_010286320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010307144.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009992149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_009317622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_005020666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009806354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   
ref|XP_010572562.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    3e-09   
ref|XP_009507570.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    66.2    3e-09   



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   283 bits (724),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV +TASSP SR TDPKVLVSRNFQG
Sbjct  624  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQG  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNL
Sbjct  684  TSVAGPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNL  743

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYF
Sbjct  744  RVHENDQTICKPGQFASWPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYF  803

Query  549  R  551
            R
Sbjct  804  R  804


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  632  GDSNGVLYFAGTSYGKHQWVNPVL  655



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV +TASSP SR TDPKVLVSRNFQG
Sbjct  644  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQG  703

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNL
Sbjct  704  TSVAGPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNL  763

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYF
Sbjct  764  RVHENDQTICKPGQFASWPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYF  823

Query  549  R  551
            R
Sbjct  824  R  824


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  652  GDSNGVLYFAGTSYGKHQWVNPVL  675



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV +TASSP SR TDPKVLVSRNFQG
Sbjct  624  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQG  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNL
Sbjct  684  TSVAGPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNL  743

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYF
Sbjct  744  RVHENDQTICKPGQFASWPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYF  803

Query  549  R  551
            R
Sbjct  804  R  804


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  632  GDSNGVLYFAGTSYGKHQWVNPVL  655



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV +TASSP SR TDPKVLVSRNFQG
Sbjct  644  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQG  703

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNL
Sbjct  704  TSVAGPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNL  763

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYF
Sbjct  764  RVHENDQTICKPGQFASWPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYF  823

Query  549  R  551
            R
Sbjct  824  R  824


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  652  GDSNGVLYFAGTSYGKHQWVNPVL  675



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV++TASSP SR TDPKVLVSRNFQG
Sbjct  624  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQG  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNL
Sbjct  684  TSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNL  743

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYF
Sbjct  744  RVHENDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYF  803

Query  549  R  551
            R
Sbjct  804  R  804


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL*RLLS*T  4
            G  NGVLYFAGTSYG HQWVNPVL + +S T
Sbjct  632  GDSNGVLYFAGTSYGKHQWVNPVLSKRVSIT  662



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV++TASSP SR TDPKVLVSRNFQG
Sbjct  644  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQG  703

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNL
Sbjct  704  TSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNL  763

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYF
Sbjct  764  RVHENDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYF  823

Query  549  R  551
            R
Sbjct  824  R  824


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL*RLLS*T  4
            G  NGVLYFAGTSYG HQWVNPVL + +S T
Sbjct  652  GDSNGVLYFAGTSYGKHQWVNPVLSKRVSIT  682



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV++TASSP SR TDPKVLVSRNFQG
Sbjct  646  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQG  705

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNL
Sbjct  706  TSLAGPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNL  765

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYF
Sbjct  766  RVHENDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYF  825

Query  549  R  551
            R
Sbjct  826  R  826


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL*RLLS*T  4
            G  NGVLYFAGTSYG HQWVNPVL + +S T
Sbjct  654  GDSNGVLYFAGTSYGKHQWVNPVLSKRVSIT  684



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP  R TDPK LVSR +QG
Sbjct  626  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPTLRHTDPKALVSRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDGN  +WWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG +WTNL
Sbjct  686  TSFAGPRMEDGNKCAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKSWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVHKDDQT+CKPGQFASWPITGPN LLPFRFFR+++TGP TD  +PWN CIC LELYGYF
Sbjct  746  RVHKDDQTVCKPGQFASWPITGPNSLLPFRFFRVILTGPTTDVSDPWNLCICFLELYGYF  805

Query  549  R  551
            R
Sbjct  806  R  806


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  634  GDSNGVLYFAGTSYGEHQWVNPVL  657



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  151  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAG  210

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+L
Sbjct  211  TSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDL  270

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  271  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  330

Query  549  R  551
            R
Sbjct  331  R  331



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  W NPVL+KR+ +TASSP SRFTDPKVLVSR +QG
Sbjct  623  KELQYICDGDSNGVLYFAGTSYGEHQWFNPVLAKRITITASSPPSRFTDPKVLVSRTYQG  682

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP +EDG  ++WWM+D+G DHQL+CNYYT+R DGSRA+MR WNFQGS DG  WTNL
Sbjct  683  TSFAGPHIEDGRNNTWWMVDIGADHQLICNYYTLRHDGSRAYMRYWNFQGSLDGKTWTNL  742

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+TGPN LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF
Sbjct  743  RVHENDQTICKPGQFASWPVTGPNALLPFRFFRVVLTGPTMDASNPWNFCICFLELYGYF  802

Query  549  R  551
             
Sbjct  803  H  803



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVLSKR+ +TASSP SR TDPKVLVSR +QG
Sbjct  622  KELQYICDGDSNGVLYFSGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQG  681

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++E+GNI +WWM+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +L
Sbjct  682  TCFAGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDL  741

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQFASWP+TGPN LLPFRFFR+++TGP TD  NPWN CIC LELYGYF
Sbjct  742  RVHENDQTMCKPGQFASWPVTGPNALLPFRFFRVLLTGPTTDASNPWNLCICFLELYGYF  801

Query  549  R  551
            R
Sbjct  802  R  802



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  WVNPV++KR+ +TASSP SR+TDPKVLVSR FQG
Sbjct  622  KELQHISDGDSNGVMYFAGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQG  681

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+  SWWM+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+L
Sbjct  682  TSFAGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDL  741

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R H +DQTICKPGQFASWPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYF
Sbjct  742  RAHDNDQTICKPGQFASWPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYF  801

Query  549  R  551
            R
Sbjct  802  R  802



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  78   ELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  257
            E  WVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSFAG +VEDG   SWWM+D+G 
Sbjct  649  EHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFAGLRVEDGKTCSWWMVDIGE  708

Query  258  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
            DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASWP+TGP
Sbjct  709  DHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTVCKPGQFASWPVTGP  768

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            N LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  769  NALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  WVNPV++KR+ +TASSP SR+TDPKVLVSR FQG
Sbjct  673  KELQHISDGDSNGVMYFAGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQG  732

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+  SWWM+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+L
Sbjct  733  TSFAGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDL  792

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R H +DQTICKPGQFASWPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYF
Sbjct  793  RAHDNDQTICKPGQFASWPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYF  852

Query  549  R  551
            R
Sbjct  853  R  853



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVLSK+V +T SSP SRFTDPKVLVSR++QG
Sbjct  624  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLSKKVTITPSSPLSRFTDPKVLVSRSYQG  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP+ EDG  +SWWM+D+G+ HQLMCNYYT+RQDGSRAF+R+W+FQGS DG NWTNL
Sbjct  684  TSFAGPRKEDGRTTSWWMVDIGHGHQLMCNYYTLRQDGSRAFIRNWSFQGSMDGNNWTNL  743

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++D T+CKPGQ+ASWP+ GPN LLPFRFFR V+T P TD  NPW+ CIC LELYGYF
Sbjct  744  RVHENDVTMCKPGQYASWPVVGPNALLPFRFFRAVLTAPTTDITNPWSFCICFLELYGYF  803

Query  549  R  551
            R
Sbjct  804  R  804


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  632  GDSNGVLYFAGTSYGEHQWVNPVL  655



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVLSKR+ +TASSP SR TDPKVLVSR +QG
Sbjct  622  KELQYICDGDSNGVLYFSGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQG  681

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++E+GNI +WWM+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +L
Sbjct  682  TCFAGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDL  741

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQFASWP+TGPN LLPFRFFR+++TG  TD  NPWN CIC LELYGYF
Sbjct  742  RVHENDQTMCKPGQFASWPVTGPNALLPFRFFRVLLTGLTTDASNPWNLCICFLELYGYF  801

Query  549  R  551
            R
Sbjct  802  R  802



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSK+V VTASSP SRFTDPKVL SR +QG
Sbjct  622  KELQYICDGDSNGVLYFAGTSYGKHQWVNPVLSKKVTVTASSPTSRFTDPKVLASRTYQG  681

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAG ++ DG  +SWWM+D+G  HQLMCNYYT+RQDGS+AFMR WNFQGS+DG NWTNL
Sbjct  682  TSFAGSRMGDGRNTSWWMVDIGPGHQLMCNYYTLRQDGSKAFMRCWNFQGSSDGRNWTNL  741

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R+H+ D+T+CKPGQFASWPI  PN LLPFRFFR+ MT P TD+ NPWNCCIC LELYGYF
Sbjct  742  RIHEKDETLCKPGQFASWPINDPNALLPFRFFRVTMTAPTTDDTNPWNCCICFLELYGYF  801


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  630  GDSNGVLYFAGTSYGKHQWVNPVL  653



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H       E  WVNP+L+KR+ +TASSP SR TDPKVLVSR +QG
Sbjct  609  KELQYICDGDSNGVLHFAGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQG  668

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSF GP+VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNL
Sbjct  669  TSFTGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNL  728

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQ+ASWPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF
Sbjct  729  RVHENDQTMCKPGQYASWPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYF  788

Query  549  R  551
             
Sbjct  789  H  789



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             WVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  DH
Sbjct  650  QWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADH  709

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            QL+CNYYT+RQDGSR +MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN 
Sbjct  710  QLICNYYTLRQDGSRTYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNA  769

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
            LLP+RFFR+V+TGP TD  NPWN CIC+LELYGYF 
Sbjct  770  LLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYFH  805


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  633  GDSNGVLYFAGTSYGKHQWVNPVL  656



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H       E  WVNP+L+KR+ +TASSP SR TDPKVLVSR +QG
Sbjct  626  KELQYICDGDSNGVLHFAGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSF GP+VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNL
Sbjct  686  TSFTGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQ+ASWPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF
Sbjct  746  RVHENDQTMCKPGQYASWPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYF  805

Query  549  R  551
             
Sbjct  806  H  806



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             WVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  DH
Sbjct  650  QWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADH  709

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            QL+CNYYT+RQDGSRA+MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN 
Sbjct  710  QLICNYYTLRQDGSRAYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNA  769

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
            LLP+RFFR+V+TGP TD  NPWN CIC+LELYGY  
Sbjct  770  LLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYLH  805


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  633  GDSNGVLYFAGTSYGKHQWVNPVL  656



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVLSK+V +TASSPFSRFTDPKVLVSR++ G
Sbjct  622  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLSKKVIITASSPFSRFTDPKVLVSRSYLG  681

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E+G  ++WWM+D+G+ HQLMCN+YT+RQDGSRAFMR+WNFQGS DG NWTNL
Sbjct  682  TSFAGPRMENGRNTAWWMVDIGHSHQLMCNHYTLRQDGSRAFMRNWNFQGSMDGNNWTNL  741

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++D+T+ KPGQFASWP+ GP  LLPFRFFR+V+  P TD  NPW+ CIC LELYGYF
Sbjct  742  RVHENDETMSKPGQFASWPVVGPTALLPFRFFRVVLVAPTTDATNPWSLCICFLELYGYF  801

Query  549  R  551
            R
Sbjct  802  R  802


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  630  GDSNGVLYFAGTSYGEHQWVNPVL  653



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SRFTDPK LVSR ++G
Sbjct  625  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGPQ+EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNL
Sbjct  685  TSFAGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF
Sbjct  745  RVHENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYF  804


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  633  GDSNGVLYFAGTSYGEHQWVNPVL  656



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SRFTDPK LVSR ++G
Sbjct  623  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRG  682

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGPQ+EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNL
Sbjct  683  TSFAGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNL  742

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF
Sbjct  743  RVHENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYF  802


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  631  GDSNGVLYFAGTSYGEHQWVNPVL  654



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  629  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  689  TSFAGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY+
Sbjct  749  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYY  808

Query  549  R  551
            R
Sbjct  809  R  809



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  78   ELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  257
            E  WVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSF G +VEDG   SWWM+D+G 
Sbjct  649  EHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFTGLRVEDGKTCSWWMVDIGE  708

Query  258  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
            DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASW +TGP
Sbjct  709  DHQLMCNYYTLRQDGSRAFIRYWNLQGSFDGKTWTNLRVHENDQTVCKPGQFASWAVTGP  768

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            N LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  769  NALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  626  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKTYVG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP+ EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  686  TSFAGPRKEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+ +TGP TD   PWN CIC LELYGYF
Sbjct  746  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLFLTGPTTDTSTPWNFCICYLELYGYF  805

Query  549  R  551
            R
Sbjct  806  R  806



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  629  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  689  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R+H+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGYF
Sbjct  749  RIHEDDQTMCKVGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYF  808

Query  549  R  551
            R
Sbjct  809  R  809



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   262 bits (669),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  629  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  689  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+
Sbjct  749  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYY  808

Query  549  R  551
            R
Sbjct  809  R  809



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  643  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVG  702

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  703  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDL  762

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+
Sbjct  763  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYY  822

Query  549  R  551
            R
Sbjct  823  R  823



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  627  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVG  686

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  687  TSFAGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDL  746

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY 
Sbjct  747  RVHENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTVDTSTPWNFCICYLELYGYL  806

Query  549  R  551
            R
Sbjct  807  R  807



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  644  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVG  703

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  704  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGRTWTDL  763

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+++TGP TD   PWN CIC LELYGY+
Sbjct  764  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLLLTGPTTDTSTPWNFCICYLELYGYY  823

Query  549  R  551
            R
Sbjct  824  R  824



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  638  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVG  697

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  698  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDL  757

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+
Sbjct  758  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYY  817

Query  549  R  551
            R
Sbjct  818  R  818



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  664  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVG  723

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+L
Sbjct  724  TSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDL  783

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  784  RVHENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  843

Query  549  R  551
            R
Sbjct  844  R  844



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  WVNPVLSK++ VTASSP SR+TDPK LVSR +QG
Sbjct  625  KELQYISDGDNNGVIYFSGTSYGEHQWVNPVLSKKITVTASSPASRYTDPKTLVSRAYQG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW FQGS DG NWTNL
Sbjct  685  TSFAGPRIEDGMNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWAFQGSMDGENWTNL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTIC+PGQFASWPI G   LLPFRFFR+++TGP T   N WN CIC +ELYGYF
Sbjct  745  RVHENDQTICRPGQFASWPIIGSTSLLPFRFFRVILTGPATGYSNVWNLCICFIELYGYF  804

Query  549  R  551
            R
Sbjct  805  R  805



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   G+ +       E  WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QG
Sbjct  609  KELQYICDGDSNGILYFAGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQG  668

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++E G I +WWMID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +L
Sbjct  669  TCFAGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDL  728

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQFASWP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+
Sbjct  729  RVHENDQTMCKPGQFASWPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYY  788

Query  549  R  551
            R
Sbjct  789  R  789



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  616  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVG  675

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+L
Sbjct  676  TSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDL  735

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  736  RVHENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  795

Query  549  R  551
            R
Sbjct  796  R  796



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   G+ +       E  WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QG
Sbjct  625  KELQYICDGDSNGILYFAGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++E G I +WWMID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +L
Sbjct  685  TCFAGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CKPGQFASWP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+
Sbjct  745  RVHENDQTMCKPGQFASWPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYY  804

Query  549  R  551
            R
Sbjct  805  R  805



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  W+NP+L+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  628  KELQYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQG  687

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP+VE G I +WWMID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  688  TCFAGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNL  747

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF
Sbjct  748  RVHENDQTMCKAGQFASWPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYF  807



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  W+NP+L+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  621  KELQYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQG  680

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP+VE G I +WWMID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  681  TCFAGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNL  740

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF
Sbjct  741  RVHENDQTMCKAGQFASWPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYF  800



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       E  W+NP+L+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  621  KELQYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQG  680

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP+VE G I +WWMID+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  681  TCFAGPRVEGGQIHAWWMIDIGQDHQLMCNHYTLRQDGSRAFIRCWNLQGSLDGKTWTNL  740

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPITGP  LLPFRFFR+V+TGP TD  NP N CIC LELYGYF
Sbjct  741  RVHENDQTMCKAGQFASWPITGPQALLPFRFFRVVLTGPTTDGSNPHNLCICFLELYGYF  800



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  629  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+L
Sbjct  689  TSFAGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN  IC LELYGYF
Sbjct  749  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFYICYLELYGYF  808

Query  549  R  551
            R
Sbjct  809  R  809



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + V ASSP SR+TDPK LVS+N+QG
Sbjct  625  KELQYISDGDNNGVIYYAGTSFGKHQWINPVLAKNIKVIASSPNSRYTDPKALVSKNYQG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++EDG + SWWM+D+G+DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+L
Sbjct  685  TCFAGPRLEDGKMCSWWMVDIGHDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGQNWTSL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R+HKDDQTIC+PGQFASWPITGP+ LLPFRFFR+++TG  T   N WN CIC LELYGYF
Sbjct  745  RIHKDDQTICQPGQFASWPITGPSALLPFRFFRVMLTGHATGVSNTWNLCICFLELYGYF  804

Query  549  R  551
            R
Sbjct  805  R  805



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  629  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+L
Sbjct  689  TSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  749  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  808

Query  549  R  551
            R
Sbjct  809  R  809



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  W+NPVL+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  626  KELQYICDGDSNGVLYFAGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP +EDG+I +WWM+D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  686  TSFAGPCMEDGHIRAWWMVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK  QFASWPITGP+ LLPFRFFR+V+TGP TD  NP N CIC LELYGYF
Sbjct  746  RVHENDQTMCKADQFASWPITGPHALLPFRFFRVVLTGPTTDASNPHNLCICFLELYGYF  805


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQW+NPVL
Sbjct  634  GDSNGVLYFAGTSYGEHQWINPVL  657



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  632  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAG  691

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+L
Sbjct  692  TSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDL  751

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  752  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  811

Query  549  R  551
            R
Sbjct  812  R  812



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++ +T+SSP SRFTDPK L S+ + G
Sbjct  675  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAG  734

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+L
Sbjct  735  TSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDL  794

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  795  RVHEDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  854

Query  549  R  551
            R
Sbjct  855  R  855



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H       +  WVNPVL+K++ +  SSP SRFTDPK L SR + G
Sbjct  624  KELQYICDGDSNGVLHYAGTSYGDHQWVNPVLAKKITIIVSSPTSRFTDPKTLASRTYMG  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG ISSWWM+DLG DHQLMCNYYT+RQDGSR + RSW  QGS DG +W ++
Sbjct  684  TSFAGPRMEDGQISSWWMVDLGKDHQLMCNYYTLRQDGSRTYPRSWKLQGSMDGNSWADV  743

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH+DDQT+CK GQFASWPI G N LLPFR+FR+VMTGP  D  NPW+ CIC LELYGYF
Sbjct  744  RVHEDDQTMCKLGQFASWPIVGANSLLPFRYFRVVMTGPTADASNPWSFCICFLELYGYF  803

Query  549  R  551
            R
Sbjct  804  R  804



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 133/181 (73%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNP+LS R+ +T SSP SRFTDPKVL SR +QG
Sbjct  625  KDLQYICDGDSNGVLYYAGTSYGEHRWVNPMLSNRITITTSSPISRFTDPKVLASRTYQG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSF+GP+ EDG   SWWMID+G DHQLMCNYYT+RQDGSR F+R WN QGS DG +WTNL
Sbjct  685  TSFSGPRFEDGRTCSWWMIDVGEDHQLMCNYYTLRQDGSRTFIRHWNLQGSLDGKHWTNL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R HK+DQ ICKPGQFASWP+TGP  LL FRFFR+++TGP TD    W  CIC LELYGYF
Sbjct  745  REHKNDQKICKPGQFASWPVTGPQALLSFRFFRVILTGPTTDPTETWKFCICFLELYGYF  804

Query  549  R  551
            R
Sbjct  805  R  805



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVLSK++ +TASSP SR+TD K LVSR +Q 
Sbjct  623  KELQYICDGDKNGVIYFAGTSYGEHAWVNPVLSKKITLTASSPASRYTDSKALVSRTYQA  682

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ S+WWM+D+G+DHQLMCNYYT+RQDGS  ++RSW FQGS DG NWTNL
Sbjct  683  TSFAGPRIEDGHSSAWWMVDIGHDHQLMCNYYTLRQDGSSTYIRSWAFQGSVDGKNWTNL  742

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH DDQTIC+ GQFASWP+ GP  LLPFR FR+++TGP + + N WN CIC +ELYGYF
Sbjct  743  RVHNDDQTICRSGQFASWPVIGPMALLPFRIFRVILTGPASGDANVWNLCICFIELYGYF  802



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+K++ VTASSP SR+TDPK LVSR +QG
Sbjct  623  KELQYICDGDNNGVIYFSGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQG  682

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNL
Sbjct  683  TSFAGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNL  742

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTIC+PGQFASW +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYF
Sbjct  743  RVHENDQTICRPGQFASWTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYF  802

Query  549  R  551
            R
Sbjct  803  R  803



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+K++ VTASSP SR+TDPK LVSR +QG
Sbjct  625  KELQYICDGDNNGVIYFSGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQG  684

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNL
Sbjct  685  TSFAGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNL  744

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTIC+PGQFASW +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYF
Sbjct  745  RVHENDQTICRPGQFASWTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYF  804

Query  549  R  551
            R
Sbjct  805  R  805



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+K + +TASSP SRFTDPKVL SR +QG
Sbjct  630  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLAKTITITASSPPSRFTDPKVLASRTYQG  689

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG+ S+WWM+D+G +HQLMCNYYT+RQDGSRA++RSW+ QGS DG  WTNL
Sbjct  690  TSFAGPRIEDGHSSTWWMVDIGSNHQLMCNYYTLRQDGSRAYIRSWSLQGSLDGKTWTNL  749

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             VH++DQT+CK GQFASWPI GPN L PFRFFR ++TGP TD  NP N CIC LELYGYF
Sbjct  750  SVHENDQTVCKLGQFASWPIVGPNALRPFRFFRALLTGPTTDISNPCNLCICFLELYGYF  809


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL*RLLS*T  4
            G  NGVLYFAGTSYG HQWVNPVL + ++ T
Sbjct  638  GDSNGVLYFAGTSYGEHQWVNPVLAKTITIT  668



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   254 bits (648),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  78   ELHWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
            E  WVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDL
Sbjct  640  EHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDL  699

Query  252  GYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPIT  431
            G DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ 
Sbjct  700  GQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVV  759

Query  432  GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  760  GPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  798



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   254 bits (648),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  W+NPVL+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  626  KELQYICDGDSNGVLYFAGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP +E+G+I +WW +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  686  TSFAGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK  QFASWP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF
Sbjct  746  RVHENDQTMCKADQFASWPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYF  805


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQW+NPVL
Sbjct  634  GDSNGVLYFAGTSYGEHQWINPVL  657



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  W+NP+L+KR+ +TASSP SR+TDPK LVSR +QG
Sbjct  626  KELQYICDGDSNGVLYFAGTSYGEHQWINPILAKRITITASSPPSRYTDPKTLVSRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP +E+G+I +WW +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNL
Sbjct  686  TSFAGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK  QFASWP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF
Sbjct  746  RVHENDQTMCKADQFASWPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYF  805



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + VTASSP SR+TDPK LVS+N+Q 
Sbjct  554  KELQYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQA  613

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L
Sbjct  614  TCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSL  673

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   N WN CIC LELYGYF
Sbjct  674  HVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYF  733

Query  549  R  551
            R
Sbjct  734  R  734



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  78   ELHWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
            E  WVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDL
Sbjct  725  EHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDL  784

Query  252  GYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPIT  431
            G DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ 
Sbjct  785  GQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVV  844

Query  432  GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  845  GPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  883



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  87   WVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  260
            WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG D
Sbjct  646  WVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQD  705

Query  261  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
            HQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI GPN
Sbjct  706  HQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIGPN  765

Query  441  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  766  ALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  801



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  87   WVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  260
            WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG D
Sbjct  650  WVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQD  709

Query  261  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
            HQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI GPN
Sbjct  710  HQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIGPN  769

Query  441  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  770  ALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  805



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + VTASSP SR+TDPK LVS+N+Q 
Sbjct  626  KELQYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQA  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L
Sbjct  686  TCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   N WN CIC LELYGYF
Sbjct  746  HVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYF  805

Query  549  R  551
            R
Sbjct  806  R  806



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             W+NPVL+K + V ASSP SR+T+PK LVS+N+QGT FAGP+ E+G   SWWM+D+G DH
Sbjct  657  QWINPVLAKNITVMASSPNSRYTNPKALVSKNYQGTCFAGPRDENGKKCSWWMVDIGEDH  716

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            QLMCNYYT+RQDGS  FMRSW FQGS DG NWT+L VH+++QTIC+PGQFASWPITGP+ 
Sbjct  717  QLMCNYYTVRQDGSTTFMRSWVFQGSMDGENWTSLGVHEEEQTICQPGQFASWPITGPSA  776

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
            LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  777  LLPFRFFRLALTGPATGMSNTWNLCICFLELYGYFR  812



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SR+TDPK L SR +QG
Sbjct  626  KELQYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
             SFAGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNL
Sbjct  686  LSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF
Sbjct  746  RVHENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYF  805



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SR+TDPK L SR +QG
Sbjct  637  KELQYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQG  696

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
             SFAGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNL
Sbjct  697  LSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNL  756

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF
Sbjct  757  RVHENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYF  816



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SR+TDPK L SR +QG
Sbjct  638  KELQYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQG  697

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
             SFAGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNL
Sbjct  698  LSFAGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNL  757

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF
Sbjct  758  RVHENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYF  817



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + VTASSP SR+TDPK LVS+N+Q 
Sbjct  626  KELQYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQA  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L
Sbjct  686  TCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   + WN CIC LELYGYF
Sbjct  746  HVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSHTWNLCICFLELYGYF  805

Query  549  R  551
            R
Sbjct  806  R  806



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++++T+SSP SRFTDPK L S+ + G
Sbjct  621  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVG  680

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+L
Sbjct  681  TSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDL  740

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  741  RVHENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  800

Query  549  R  551
            R
Sbjct  801  R  801



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV H +        WVNPVL+K++++T+SSP SRFTDPK L S+ + G
Sbjct  626  KELQYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVG  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+L
Sbjct  686  TSFAGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYF
Sbjct  746  RVHENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYF  805

Query  549  R  551
            R
Sbjct  806  R  806



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             W+NPVL+K + VTASSP SR+TDPK LVS+N+QGT FAGP+ EDG   SWWM+D+G DH
Sbjct  652  QWINPVLAKNITVTASSPNSRYTDPKALVSKNYQGTCFAGPRDEDGKKCSWWMVDIGQDH  711

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            QLMCNYYT+RQDGS AFMRSW  QGS DG NWT+L V++D++ IC+PGQFASWPITGP+ 
Sbjct  712  QLMCNYYTVRQDGSTAFMRSWVLQGSMDGENWTSLVVNEDERAICQPGQFASWPITGPSA  771

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
            LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  772  LLPFRFFRLALTGPTTS--NTWNLCICFLELYGYFR  805



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNF  182
            K +     G   GV +       E  WVNP+L+  +++ +TASSP SR+TDPKVLVSR +
Sbjct  620  KELQYICDGDDHGVLYFAGTSYGEHPWVNPLLAEQRKITITASSPHSRYTDPKVLVSRTY  679

Query  183  QGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWT  362
            QGT FAGP++E+G   +WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS +G +WT
Sbjct  680  QGTCFAGPRLENGQNCTWWMVDLGQDHQLMCNYYTLRQDGSKAFPRFWNIQGSQEGKSWT  739

Query  363  NLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            NL VH++D+++CKPGQFASWPI GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYG
Sbjct  740  NLWVHENDRSVCKPGQFASWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYG  799

Query  543  YF  548
            YF
Sbjct  800  YF  801



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   229 bits (584),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  120  VTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD  299
            VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQD
Sbjct  9    VTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQD  68

Query  300  GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMT  479
            GS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T
Sbjct  69   GSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLT  128

Query  480  GPGTDEMNPWNCCICVLELYGYFR  551
             P T   N WN CIC LELYGYFR
Sbjct  129  APATGVSNTWNLCICFLELYGYFR  152



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 134/181 (74%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL++++ VTASSP SR+TDPKVLVSR +Q 
Sbjct  626  KELQYICDGDNNGVIYFAGTSYGEHQWVNPVLAQKITVTASSPASRYTDPKVLVSRTYQA  685

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++EDG   +WWM+DLG DHQLMCN YT+RQDGS  +MR W  QGS DG NWT+L
Sbjct  686  TSFAGPRMEDGKNCAWWMVDLGQDHQLMCNCYTLRQDGSNVYMRCWALQGSLDGRNWTDL  745

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            +VH +DQTICKPGQFASWP+ GP  +LPFRFFR+++TGP T   +PWN  IC LELYGYF
Sbjct  746  KVHGNDQTICKPGQFASWPVQGPAAVLPFRFFRVILTGPTTSNSSPWNLSICFLELYGYF  805

Query  549  R  551
             
Sbjct  806  H  806



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 132/180 (73%), Gaps = 8/180 (4%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNPVL+KR+ +TASSP SRFTDPK LVSR ++ 
Sbjct  625  KELQYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYR-  683

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
                   +EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNL
Sbjct  684  -------IEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNL  736

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF
Sbjct  737  RVHENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYF  796


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  633  GDSNGVLYFAGTSYGEHQWVNPVL  656



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  78   ELHWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
            E  WVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DL
Sbjct  656  EHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDL  715

Query  252  GYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPIT  431
            G DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI 
Sbjct  716  GQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIV  775

Query  432  GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  776  APNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  814



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  78   ELHWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
            E  WVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DL
Sbjct  636  EHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDL  695

Query  252  GYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPIT  431
            G DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI 
Sbjct  696  GQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIV  755

Query  432  GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  756  APNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  794



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + V ASSP SR TDPK LVS+N+QG
Sbjct  680  KELQYISDGDSNGVIYYAGTSFGKHQWMNPVLAKNITVVASSPNSRHTDPKALVSKNYQG  739

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP +EDG   SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+L
Sbjct  740  TCFAGPCIEDGKKISWWMVDIGQDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGRNWTSL  799

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGP--GTDEMNPWNCCICVLELYG  542
            RVH++D TIC PGQFASWP+ GP  LLPFRFFR+ +TGP  G    N WN CIC LELYG
Sbjct  800  RVHEEDATICHPGQFASWPVVGPPALLPFRFFRVALTGPAAGGSVSNAWNLCICFLELYG  859

Query  543  YFR  551
            Y R
Sbjct  860  YLR  862



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       E  WVNP L+KRV VTASSP SR+TDPK LVSR +Q 
Sbjct  647  KELQYICDGDQNGVLYYSGTSYGEHDWVNPFLAKRVIVTASSPASRYTDPKSLVSRTYQA  706

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++  G   +WW ID+G DH+LMCNYYTIRQDGS  F R W+ QGS D  NWT+L
Sbjct  707  TSFAGPRIVGGKNCAWWKIDIGQDHELMCNYYTIRQDGSTGFTRHWSLQGSRDAENWTDL  766

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH++D+TICKP QFASWPI  PN LLPFRFFR+++TG  T + NPWN C+C LELYGYF
Sbjct  767  RVHENDRTICKPAQFASWPIHPPNALLPFRFFRVLLTGLTTSDSNPWNLCMCFLELYGYF  826

Query  549  R  551
            R
Sbjct  827  R  827



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 130/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSKRV +TASSP SR TDPKVLVSRNFQG
Sbjct  644  KELLYICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVTITASSPISRCTDPKVLVSRNFQG  703

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TS AGPQ+EDG  +SWWM+D+G DHQLMCNYYT+RQDGS AFMR WNFQGS DG +WTNL
Sbjct  704  TSLAGPQMEDGRNASWWMVDVGQDHQLMCNYYTLRQDGSGAFMRRWNFQGSLDGKSWTNL  763

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R+       C P        TGPN LLPFRFFR++MT P TD+ NPWNCCIC LELYGYF
Sbjct  764  RI------XCSP--------TGPNALLPFRFFRLLMTAPTTDDTNPWNCCICFLELYGYF  809

Query  549  R  551
            R
Sbjct  810  R  810


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  96   GLPNGVLYFAGTSYGAHQWVNPVL  25
            G  NGVLYFAGTSYG HQWVNPVL
Sbjct  652  GDSNGVLYFAGTSYGKHQWVNPVL  675



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV +       +  W+NPVL+K + V ASSP SR TDPK LVS+N+QG
Sbjct  629  KELQYISDGDNNGVIYYAGTSFGKHQWMNPVLTKNITVVASSPNSRHTDPKALVSKNYQG  688

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            T FAGP +E+G   SWWM+D+G D+QLMCNYYT+RQDGS  FMRSW  QGS DG NWT+L
Sbjct  689  TCFAGPCIENGKKLSWWMVDIGQDYQLMCNYYTVRQDGSTTFMRSWALQGSMDGRNWTSL  748

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            RVH DD TIC PGQFASWPI GP  LLPFRFFR+ +TGP       WN CIC LELYGYF
Sbjct  749  RVHDDDPTICHPGQFASWPIVGPAALLPFRFFRVALTGPAAG--CAWNLCICFLELYGYF  806

Query  549  R  551
            R
Sbjct  807  R  807



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +     G   GV +       +  WVNPVLSK+V +T SSP SRFTDPKVLVSR++QG
Sbjct  623  KELQFICDGDNNGVLYFAGTSYGQHQWVNPVLSKKVFITGSSPVSRFTDPKVLVSRSYQG  682

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP++E+G  ++WWM+D+G DHQL+CNYYTIRQDGSRAF+R W+ QGSTDG NW +L
Sbjct  683  TSFAGPRMENGKNTAWWMVDIGDDHQLICNYYTIRQDGSRAFLRHWSLQGSTDGANWASL  742

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTG  482
            RVH++D T+CK GQ+ASWP+ G N LLPFRFFRI +TG
Sbjct  743  RVHENDATMCKSGQYASWPVVGSNALLPFRFFRIALTG  780


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  87   NGVLYFAGTSYGAHQWVNPVL  25
            NGVLYFAGTSYG HQWVNPVL
Sbjct  634  NGVLYFAGTSYGQHQWVNPVL  654



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   GV + +        W+NP L+K++ V+ASSP SRFTD K LVSRN+QG
Sbjct  604  KELLYISDGDCNGVFYYLGTSYGSHPWMNPALTKKLVVSASSPPSRFTDAKALVSRNYQG  663

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNL  368
            TSFAGP    G +S+WW +DLG D QL+CNYYT+RQD S +FMR+W+ QGS DG  WT L
Sbjct  664  TSFAGPCNVGGQMSAWWKVDLGADQQLLCNYYTVRQDSSSSFMRNWSLQGSVDGQRWTQL  723

Query  369  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            R H +DQTI   GQ+ASWP+ G N LLPFRFFR+++ GP T    PWN  +C LELYGY 
Sbjct  724  RTHHNDQTIGHGGQYASWPVFGANALLPFRFFRVILLGPTTSVSTPWNLSLCYLELYGYL  783

Query  549  R  551
            R
Sbjct  784  R  784



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG DH
Sbjct  637  EWMNPMVTKQITLSASSPHSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGPDH  696

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            +LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G   
Sbjct  697  KLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKS  756

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  757  LIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  791



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   193 bits (490),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  210  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQ  389
            +EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQ
Sbjct  1    MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ  60

Query  390  TICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
            T+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  61   TMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  114



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG DH
Sbjct  617  EWMNPMVTKQITLSASSPPSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGPDH  676

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            +LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G   
Sbjct  677  KLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKS  736

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  737  LIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  771



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   188 bits (477),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 85/155 (55%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
             WVNPVL+KR+ V ASSP SRFTDPK LVS  F  TSFA P+ E G  SSWW++DLG  H
Sbjct  530  QWVNPVLAKRIEVRASSPASRFTDPKALVSGAFLRTSFACPRYEGGQPSSWWLVDLGPSH  589

Query  264  QLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  443
            +L+CNYYT+R D S  F R W  Q S D  +W +LR H  D  I  PGQ+ASWP++GP  
Sbjct  590  RLLCNYYTMRHDSSSDFPRHWVLQASNDLQHWVDLRRHIADAAIRLPGQYASWPVSGPAS  649

Query  444  LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
             +PFR FR+++ GP      PWN C+  +E YGYF
Sbjct  650  HMPFRAFRLLLAGPTLSAATPWNFCLSHVEFYGYF  684



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
            WVNPVL+ R+ V ASSP  R TDPK L   NF   +FAGP++E+G +SSWW++DLG +H+
Sbjct  500  WVNPVLAGRLQVRASSPACRSTDPKALAGNNFARCNFAGPRMENGQLSSWWVLDLGPEHR  559

Query  267  LMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  446
            L+CN+YT+R DGS  F+RSW  QGS DG +W +LR H  D+T+  PGQ+ASWP++     
Sbjct  560  LICNHYTLRHDGSTDFLRSWVLQGSNDGASWADLRRHISDRTVRMPGQYASWPVSSHAAA  619

Query  447  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            +P+R FR+++ GP  +  NP + C+   ELYGY 
Sbjct  620  VPYRMFRLLLVGPNPEAANPHHVCLSFWELYGYL  653



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 105/170 (62%), Gaps = 5/170 (3%)
 Frame = +3

Query  45   GVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGN  224
            GV H +     +  +VNP LS R+ VTASSP  RFTDPK +VS +F   + AG Q  DG 
Sbjct  273  GVCHYIGTAYGQQKFVNPALSGRLQVTASSPSCRFTDPKAVVSGHFLRNNAAG-QRRDGG  331

Query  225  ISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  404
              +WW +DLG  H+LMCNYYT+R D S  + RSW  Q STDG  W +LR H DD TI   
Sbjct  332  --TWWRVDLGEQHRLMCNYYTMRHDASPDYARSWALQASTDGTVWVDLRQHADDCTINMA  389

Query  405  GQFASWPITGPNPLLPFRFFRIVMT--GPGTDEMNPWNCCICVLELYGYF  548
            GQ+ASWP+TG     PFRFF++++T   P + + N     +  LE YGYF
Sbjct  390  GQYASWPVTGHAARRPFRFFQLLLTPAAPASGKANGRVFSLSYLEFYGYF  439



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 98/172 (57%), Gaps = 2/172 (1%)
 Frame = +3

Query  33   GLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQV  212
            G   GV + +  Q  +  WVNP+LS RV V ASSP  R T+P   V+      +FA P+ 
Sbjct  269  GDKNGVTYWLATQGGQQQWVNPMLSGRVKVQASSPACRSTNPASCVALGPPRLNFAAPRS  328

Query  213  EDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDG--VNWTNLRVHKDD  386
            E G + SWW +DLG  HQL C+ YT+R D S   +RSW  Q S DG    W +LR H++D
Sbjct  329  EAGRLVSWWSLDLGPRHQLACSAYTLRHDKSHDPLRSWTLQASRDGPQCGWEDLRRHEND  388

Query  387  QTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             T+  PGQ+ SW +TG    +P+R FRI +        NPW+  +  +ELYG
Sbjct  389  LTLRLPGQYGSWAVTGHAATVPYRCFRICVMQMQKGNENPWHASLAQIELYG  440



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +3

Query  216  DGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  395
            +G  SSWW +DLG  HQL   YYT+R DGS+ F RSW  QGS D  NW +L+ H +D T+
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  396  CKPGQFASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  548
              PGQ+ASWP+ GP    P+R FR+++T P    +  + +N C+  +E YG+ 
Sbjct  61   KVPGQYASWPVIGPAAATPYRAFRLLLTAPNASPNPASRYNFCLSNVEFYGFM  113



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = +3

Query  231  SWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  410
            SWW +DLG  HQL   YYT+R DGS+ F+RSW  QGS D   W +L+ H +D TI  PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  411  FASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  548
            +ASWP+ GP   +P+R FR+++T P    +  +  N C+  LELYG+ 
Sbjct  61   YASWPVIGPAAAVPYRAFRLLLTAPNASPNPASRHNFCLSNLELYGFL  108



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 87/158 (55%), Gaps = 8/158 (5%)
 Frame = +3

Query  75   KELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
            KE  WVNP  +  V V  S+P SR+++P+ +V R F  T +       G    W ++ L 
Sbjct  625  KERGWVNPCRAGLVKVVCSAPPSRYSNPEAVVDRAFHTTWYTS-----GRPHPWLIVQLL  679

Query  255  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  434
             +   +   Y IRQDGS  F+RSW+ QGS DG +W +L  H +D  +  P ++  WP++ 
Sbjct  680  KEKAFVMKGYAIRQDGSTVFLRSWSMQGSNDGQSWVDLSTHVNDCGLASPSRWVFWPVSS  739

Query  435  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
               ++P+  FR++MTGP    ++P    +  +E YG+F
Sbjct  740  ---VVPYAQFRLIMTGPSASPVSPNTLALSNIEFYGFF  774



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 2/62 (3%)
 Frame = +3

Query  87   WVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  260
            WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG D
Sbjct  650  WVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQD  709

Query  261  HQ  266
            HQ
Sbjct  710  HQ  711



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +3

Query  243  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  422
            +DLG   +L   +Y +R D SR F+R W  Q S DG  W ++R H  D ++    Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  423  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            P+ G     P+R  R+++  P     NPW+  +   E YG+ 
Sbjct  61   PLVGHAAARPWRALRVLLDRPNAGADNPWHLALSAWEFYGHL  102



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/133 (35%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  90   VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  269
            VNP     V++T+SS  SRF   + L   +   + FA   + + +   W+ +DLG +  L
Sbjct  821  VNPHKYNIVSITSSSG-SRFAKLESLAESSVNRSCFA---LSNSSSLVWFALDLGAERVL  876

Query  270  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  446
             C++YT+  DGS + F+R+W  +GS DG +WT L+ H++D+T+  P Q A+W +  P   
Sbjct  877  ACSFYTLAHDGSESNFLRNWCLEGSKDGKSWTVLKEHQNDETLQSPLQRATWRLEEPTSQ  936

Query  447  LPFRFFRIVMTGP  485
            + +R+FR++   P
Sbjct  937  VFYRYFRVIARPP  949



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 14/142 (10%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNI-SSWWMIDLGYDH  263
            W NP  + R+ VTASS      DP  LVS+          ++  G++ +SW+ IDLG   
Sbjct  618  WTNPHSAGRLRVTASS--IEKGDPVKLVSKK-------PSELWSGDVPASWFAIDLGPSR  668

Query  264  QLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
             L+ NYYT+R  G+     +R+W+ QGS+DG  W  L+ H +D ++  P    SWPI  P
Sbjct  669  TLVPNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLKRHTNDTSLSGPFATHSWPI--P  726

Query  438  NPLLPFRFFRIVMTGPGTDEMN  503
            +    +R FRI+ TG  +   N
Sbjct  727  SVTEAYRHFRILQTGHNSSNHN  748



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = +3

Query  90   VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  269
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  793  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  848

Query  270  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  446
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  849  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  908

Query  447  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  909  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  937



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = +3

Query  90   VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  269
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  809  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  864

Query  270  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  446
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  865  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  924

Query  447  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  925  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  953



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1184  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1236

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1237  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1294

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1295  VCAPDEMHGFRHIRVQQNG  1313



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1172  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1224

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1225  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1282

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1283  VCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1172  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1224

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1225  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1282

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1283  VCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1184  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1236

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1237  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1294

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1295  VCAPDEMHGFRHIRVQQNG  1313



>ref|XP_003288046.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
 gb|EGC35433.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
Length=602

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 85/159 (53%), Gaps = 15/159 (9%)
 Frame = +3

Query  72   NKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
            NKE  W NP L+ ++ +T+SS         V ++ N    +F    V     +SW MID+
Sbjct  447  NKE-KWSNPHLTSKIKITSSSVDKGNLHDIVEITPN----AFWTKDVP----ASWVMIDV  497

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G +  ++ +YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWP
Sbjct  498  GPNRSVVPHYYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLKRHTNDLSLNFKYATHSWP  557

Query  426  ITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            ITG      +R+FRI+ TG  ++  N     I  +E+YG
Sbjct  558  ITGCET--AYRYFRILQTGKNSNNRN--FLVIGGIEIYG  592



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1167  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1219

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1220  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1277

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1278  VCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1167  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1219

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1220  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1277

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1278  VCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1179  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1231

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1232  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1289

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1290  VCAPDEMHGFRHIRVQQNG  1308



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1179  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1231

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1232  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1289

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  R+   G
Sbjct  1290  VCAPDEMHGFRHIRVQQNG  1308



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1169  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1221

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WPI
Sbjct  1222  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWPI  1279

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  RI   G
Sbjct  1280  VCSPDEMQGFRHIRIQQNG  1298



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1181  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1233

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WPI
Sbjct  1234  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWPI  1291

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  RI   G
Sbjct  1292  VCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1181  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1233

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WPI
Sbjct  1234  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWPI  1291

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  RI   G
Sbjct  1292  VCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1181  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1233

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WPI
Sbjct  1234  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWPI  1291

Query  429   T-GPNPLLPFRFFRIVMTG  482
                P+ +  FR  RI   G
Sbjct  1292  VCSPDEMQGFRHIRIQQNG  1310



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+    S +    
Sbjct  1189  GLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCH  1241

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
                N  +W+ IDLG    ++ N YT+R      R+ +R+W  Q S DGVNWT L  H DD
Sbjct  1242  TKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADD  1299

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1300  KSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1332



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+    S +    
Sbjct  1188  GLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCH  1240

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
                N  +W+ IDLG    ++ N YT+R      R+ +R+W  Q S DGVNWT L  H DD
Sbjct  1241  TKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADD  1298

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1299  KSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1331



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+    S +    
Sbjct  1177  GLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCH  1229

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
                N  +W+ IDLG    ++ N YT+R      R+ +R+W  Q S DGVNWT L  H DD
Sbjct  1230  TKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADD  1287

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1288  KSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1320



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+    S +    
Sbjct  1145  GLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCH  1197

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
                N  +W+ IDLG    ++ N YT+R      R+ +R+W  Q S DGVNWT L  H DD
Sbjct  1198  TKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADD  1255

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1256  KSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1288



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+    S +    
Sbjct  1133  GLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCH  1185

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
                N  +W+ IDLG    ++ N YT+R      R+ +R+W  Q S DGVNWT L  H DD
Sbjct  1186  TKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADD  1243

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1244  KSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1276



>gb|AAB47544.1| MigA [Dictyostelium discoideum]
Length=813

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 76/155 (49%), Gaps = 16/155 (10%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASS-PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
            W NP  + ++ +T+SS       D   L    F               +SW MIDLG + 
Sbjct  662  WSNPHSTSKIKITSSSIDKGNLYDIVELTPNAFWTKDVP---------ASWVMIDLGPNR  712

Query  264  QLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
             ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWP+TG 
Sbjct  713  TVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATHSWPVTGC  772

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  773  ET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  803



>ref|XP_639138.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL65772.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
Length=863

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 76/155 (49%), Gaps = 16/155 (10%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASS-PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
            W NP  + ++ +T+SS       D   L    F               +SW MIDLG + 
Sbjct  712  WSNPHSTSKIKITSSSIDKGNLYDIVELTPNAFWTKDVP---------ASWVMIDLGPNR  762

Query  264  QLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
             ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWP+TG 
Sbjct  763  TVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATHSWPVTGC  822

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  823  ET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  853



>ref|XP_005842130.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
 gb|EKX55150.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
Length=111

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = +3

Query  228  SSWWMIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  401
            S W  +DLG    L+   Y+I      S   MRSW F+GS +  +W  LR H +D  +  
Sbjct  1    SPWLAVDLGEGRGLIATAYSIMHGSGSSSNAMRSWRFEGSNNKNSWITLREHLNDPRMQT  60

Query  402  PGQFASWPITGPNP----LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  548
            PGQ  ++ +   +     L  FR+FRI++TGP +   N +  C C LELYG +
Sbjct  61   PGQVETFFLHNLDKEVTRLQAFRYFRILLTGPNSS--NFFRLCACRLELYGRY  111



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 83/161 (52%), Gaps = 17/161 (11%)
 Frame = +3

Query  81    LHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMID  248
             + WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ ID
Sbjct  1098  VEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAID  1150

Query  249   LGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  422
             LG    ++  +YT+R      R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+W
Sbjct  1151  LGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTATW  1208

Query  423   PITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             P+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1209  PLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 83/161 (52%), Gaps = 17/161 (11%)
 Frame = +3

Query  81    LHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMID  248
             + WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ ID
Sbjct  1101  VEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAID  1153

Query  249   LGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  422
             LG    ++  +YT+R      R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+W
Sbjct  1154  LGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTATW  1211

Query  423   PITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             P+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1212  PLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1251



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 83/161 (52%), Gaps = 17/161 (11%)
 Frame = +3

Query  81    LHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMID  248
             + WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ ID
Sbjct  1098  VEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAID  1150

Query  249   LGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  422
             LG    ++  +YT+R      R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+W
Sbjct  1151  LGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTATW  1208

Query  423   PITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             P+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1209  PLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_004341500.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19414.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=326

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 81/168 (48%), Gaps = 14/168 (8%)
 Frame = +3

Query  66   PQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVL---VSRNFQGTSFAGPQVEDGNI---  227
            P  K LH  NP L +RV+      +    +   +   +  N    S+  P +  G I   
Sbjct  142  PDLKPLHEDNPRLQERVSYGIEFEYQSGVENNDIFWWIGTNSGTDSWQNPGL-CGRIKDV  200

Query  228  -SSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTIC  398
             +SW  +DLG +  ++  +YT+R  G+     +R+W+FQGS DG  W+ LR H +D+++ 
Sbjct  201  PASWVQLDLGPNRAVVPTFYTVRHGGTFKADSLRTWDFQGSVDGTGWSLLRRHVNDESLN  260

Query  399  KPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                  +WPI G      +R FRI+ TG  +   N     +  LELYG
Sbjct  261  DLFATHTWPIEGQTK--AYRLFRILQTGHNSSNHNF--LVLSGLELYG  304



>dbj|GAM18790.1| hypothetical protein SAMD00019534_019650, partial [Acytostelium 
subglobosum LB1]
Length=448

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 80/175 (46%), Gaps = 18/175 (10%)
 Frame = +3

Query  33   GLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQV  212
            G   GV H          + +P L K V VT+S     +  P  L++R            
Sbjct  279  GDSKGVFHYFGTMEDTESYESPALRKIVRVTSSEMSIGY--PHTLINRT------PTNMY  330

Query  213  EDGNISSWWMIDLGYDHQLMCNYYTIRQDGSR-----AFMRSWNFQGSTDGVNWTNLRVH  377
             D ++++ + +DLG  + L  N+Y++R  G       A  ++W  +GS DGV W  L  H
Sbjct  331  TDKSVNAHFTVDLGRKYVLCPNFYSMRYGGDSQGSIYAAPKNWQMKGSLDGVQWDVLVDH  390

Query  378  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            KDD  +        WP+   + +  +R+ RI MTGP  ++ +    C+C  E+YG
Sbjct  391  KDDLELKHGYSIGGWPV---HAIHSYRYLRIQMTGP--NQRDGSELCVCCFEVYG  440



>ref|XP_001969437.1| GG23957 [Drosophila erecta]
 gb|EDV58496.1| GG23957 [Drosophila erecta]
Length=2724

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1143  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1195

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A
Sbjct  1196  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSLVEPGSTA  1253

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPIT   +  + +R  RI   G
Sbjct  1254  TWPITCATDDSVRYRHIRIQQNG  1276



>ref|XP_002089068.1| GE26196 [Drosophila yakuba]
 gb|EDW88780.1| GE26196 [Drosophila yakuba]
Length=2725

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1144  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1196

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A
Sbjct  1197  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSLVEPGSTA  1254

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPIT   +  + +R  RI   G
Sbjct  1255  TWPITCATDDSVRYRHIRIQQNG  1277



>ref|WP_029637034.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=223

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 85/181 (47%), Gaps = 16/181 (9%)
 Frame = +3

Query  9    KRVAVTARGLPTGVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQG  188
            K +   + G   G+ + +  Q   + W NP  +  ++++AS   +   D   LV R  Q 
Sbjct  56   KELTYASNGDTNGLAYFIGTQEGTVAWQNPH-NNGLSMSASDIAAGTIDS--LVDR--QP  110

Query  189  TSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR-QDGSRAFMRSWNFQGSTDGVNWTN  365
            + F    +++      W+  +     L CNYY+IR +     ++R+W FQGS DG  W +
Sbjct  111  SEFYTSSIDNS-----WVELIISSGSLKCNYYSIRNRSNVDHYLRNWKFQGSNDGSVWAD  165

Query  366  LRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGY  545
            L V  ++ T+  P Q+ S+PIT  N    FR  +  +   G   +     C+  +ELYG 
Sbjct  166  LDVRTNNITLSSPSQWLSFPITTTNFYTQFRLLQNGLNSAGYAYL-----CLGEIELYGT  220

Query  546  F  548
            +
Sbjct  221  Y  221



>ref|XP_002078905.1| GD22285 [Drosophila simulans]
 gb|EDX04490.1| GD22285 [Drosophila simulans]
Length=2404

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  978   KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1030

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A
Sbjct  1031  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSLVEPGSTA  1088

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPIT   +  + +R  RI   G
Sbjct  1089  TWPITCATDDSVRYRHIRIQQNG  1111



>ref|XP_002036468.1| GM11846 [Drosophila sechellia]
 gb|EDW52391.1| GM11846 [Drosophila sechellia]
Length=2725

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1144  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1196

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A
Sbjct  1197  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSLVEPGSTA  1254

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPIT   +  + +R  RI   G
Sbjct  1255  TWPITCATDDSVRYRHIRIQQNG  1277



>ref|XP_001749884.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85263.1| predicted protein [Monosiga brevicollis MX1]
Length=2345

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 5/110 (5%)
 Frame = +3

Query  219   GNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQT  392
             G   SW+ IDLG   +  C  YT+R      R+ +R W+FQ S DG  WT +R H+ D  
Sbjct  1119  GRKDSWFSIDLGIYVKPTC--YTLRHARGYHRSALRDWDFQVSEDGDTWTTIREHRGDTA  1176

Query  393   ICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             + +PG  A++ ++ P     +R FRI M GP  +    +  C    ELYG
Sbjct  1177  LDEPGSTATFEVSAPEHATGWRHFRIFMRGPTANSNTHYLSC-SGFELYG  1225



>ref|XP_002004091.1| GI19489 [Drosophila mojavensis]
 gb|EDW13533.1| GI19489 [Drosophila mojavensis]
Length=2647

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 72/134 (54%), Gaps = 15/134 (11%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+  G S      
Sbjct  1065  GLIYYIGSNGKTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD--GVSL-NCHT  1118

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  +W+ IDLG    ++   YT+R  +   R+ +R+W+ Q S DG+NWT L  H DD
Sbjct  1119  KD-NKKAWFSIDLGV--YILPTAYTLRHARGYGRSALRNWHLQASKDGINWTTLINHVDD  1175

Query  387   QTICKPGQFASWPI  428
             +++ +PG  A+WPI
Sbjct  1176  KSLSEPGSTATWPI  1189



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 81/162 (50%), Gaps = 17/162 (10%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V V++S     P+    D   ++ R+    + A    +D   +SW+ +D G
Sbjct  1026  WVNPAAHHIVVVSSSDGRILPYGNLDD---ILCRD---DTPANCHTKDDR-NSWFAVDTG  1078

Query  255   YDHQLMCNYYTIRQD---GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
                     +Y++R     G+R+ +RSW+FQ S DGV WT +  H +D ++ +PG  ASW 
Sbjct  1079  V--WFFPTHYSLRHSRGYGNRSALRSWDFQVSKDGVTWTTVYSHVNDNSLNEPGSTASWS  1136

Query  426   ITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  551
             ++ P     +R  R+++TGP       +   +  LE+YG  R
Sbjct  1137  LSPPTDPEGWRHLRLILTGPNASGHTHY-LSLSGLEVYGEVR  1177



>ref|XP_001963078.1| GF14121 [Drosophila ananassae]
 gb|EDV32299.1| GF14121 [Drosophila ananassae]
Length=2704

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 73/143 (51%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1129  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1181

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   Y++R  +  +R+ +R+W  QGS DG+ WT L  H DD+++  PG  A
Sbjct  1182  IDLGV--YIIPTAYSLRHARGYARSALRNWLLQGSKDGIVWTTLSTHVDDKSLVDPGSTA  1239

Query  417   SWPITGP-NPLLPFRFFRIVMTG  482
             +WPI+ P +    +R  RI   G
Sbjct  1240  TWPISCPQDDSQRYRHIRIQQNG  1262



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   +S       D +  +W+ IDL
Sbjct  1103  EWVNPAQYGLVMVTSSDGRNLPYGRLED---ILSRD---SSALNCHTND-DRKAWFAIDL  1155

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    L+ + YTIR      R+ +R+W FQ S DGVNWT L  H DD ++ +PG  ASWP
Sbjct  1156  GL--WLIPSCYTIRHARGYGRSALRNWLFQVSKDGVNWTTLYTHTDDTSLNEPGSTASWP  1213

Query  426   ITGP-NPLLPFRFFRIVMTG  482
             +  P +    +R  R+  TG
Sbjct  1214  LDPPLDETQGWRHVRLQQTG  1233



>gb|KFB39857.1| AGAP009511-PA-like protein [Anopheles sinensis]
Length=3042

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+   +       
Sbjct  1163  GIIYFIGTNGKTSEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVSVNCHT  1216

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW     H DD
Sbjct  1217  KD-NKKSWFAIDLGM--YIIPTAYTLRHARGYGRSALRNWMFQLSKDGVNWVTALTHTDD  1273

Query  387   QTICKPGQFASWPITGPN  440
             +++ +PG   +WPI  P+
Sbjct  1274  KSLAEPGSTCTWPIDCPS  1291



>emb|CDK13345.1| HECD-1, isoform g [Caenorhabditis elegans]
Length=2613

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1183  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1236

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1237  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1295

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1296  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1328



>ref|NP_501120.1| Protein HECD-1 [Caenorhabditis elegans]
Length=2761

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1256  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1309

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1310  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1368

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1369  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1401



>emb|CDK13340.1| HECD-1, isoform b [Caenorhabditis elegans]
Length=2611

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1181  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1234

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1235  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1293

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1294  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1326



>emb|CDK13346.1| HECD-1, isoform h [Caenorhabditis elegans]
Length=2609

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1179  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1232

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1233  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1291

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1292  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1324



>emb|CDK13341.1| HECD-1, isoform c [Caenorhabditis elegans]
Length=2607

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1177  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1230

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1231  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1289

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1290  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1322



>ref|XP_004989701.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
 gb|EGD78378.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
Length=2036

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 81/171 (47%), Gaps = 21/171 (12%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTA----SSPFSRFTDPKVLVSRNFQGTSFAGPQ--VEDGNISSW  236
             +E  WVNP  +  + +T       PF R  D   +VSR+      + P+    + N S W
Sbjct  923   RESSWVNPSETHLIYITTHIGRELPFGRVRD---IVSRD------SSPRNCHTNNNKSGW  973

Query  237   WMIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  410
               IDLG    +  ++YT+R     S + +R+W+ +GS +G  W  LR H+ D+ +  PG 
Sbjct  974   VSIDLGL--LIKPSHYTLRHATGYSSSALRTWSLEGSDNGKEWFTLREHEKDEHLRSPGD  1031

Query  411   FASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR*CSK  563
               +W IT   P  P   FRI   GP +D  N +   I   E+YG     SK
Sbjct  1032  THTWEITTAPP-RPVCMFRIKQKGPDSDGKNHY-ISISGFEVYGEIVGVSK  1080



>ref|XP_001844071.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
 gb|EDS35740.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
Length=2813

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 75/153 (49%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+   +       
Sbjct  1271  GIIYFIGTNGKSTEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVSVNCHT  1324

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW  +  H DD
Sbjct  1325  KD-NKKSWFAIDLGM--FIVPTAYTLRHARGYGRSALRNWMFQMSKDGVNWVTMLTHSDD  1381

Query  387   QTICKPGQFASWPI-TGPNPLLPFRFFRIVMTG  482
             +++ +PG   +WP+    +    FR  RI   G
Sbjct  1382  KSLAEPGSTCTWPLECSADEQQGFRHVRIHQNG  1414



>gb|ETO36723.1| hypothetical protein RFI_00341, partial [Reticulomyxa filosa]
Length=779

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 78/155 (50%), Gaps = 16/155 (10%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDP-KVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
            W NP LS  VA+ ASS   + +DP   LV R+   T     + ED   ++W  +D   D 
Sbjct  613  WENPALSDEVALAASS-LVKDSDPLHFLVGRD---TVRLVTKAED---NAWMQVDFK-DK  664

Query  264  QLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
             +  +YYT+R   S     +R+W  Q S DGV+W  ++ H+DDQ + + G   +WP+ G 
Sbjct  665  LIQPSYYTLRHYSSWDTECLRNWILQASNDGVHWVTVKKHEDDQGLNEKGASHTWPVQGR  724

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 +R +RI  TG  +++     C    +E YG
Sbjct  725  G---AYRIWRIKQTGLNSNKHKYLAC--SGIEFYG  754


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 7/107 (7%)
 Frame = +3

Query  228  SSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  401
            S W+ +D   D  +  ++YT+R   S     +R+W  +GS DG  W  LR H +DQ +  
Sbjct  441  SCWFSVDF-VDKYIKPSHYTLRHYVSWDTECLRNWVIEGSLDGEKWLVLRQHNNDQGLNA  499

Query  402  PGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             GQ  +W +        FR FRI  TGP  +  N +       E+YG
Sbjct  500  RGQAFTWALHDYG--CAFRRFRIKQTGPNNN--NHYFLACSGFEVYG  542



>emb|CDK13342.1| HECD-1, isoform d [Caenorhabditis elegans]
Length=2644

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1214  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1267

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1268  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1326

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1327  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1359



>emb|CDK13343.1| HECD-1, isoform e [Caenorhabditis elegans]
Length=2646

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1216  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1269

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1270  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1328

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1329  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1361



>emb|CDK13339.1| HECD-1, isoform a [Caenorhabditis elegans]
Length=2648

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1218  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1271

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1272  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1330

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1331  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1363



>gb|ERL91993.1| hypothetical protein D910_09315 [Dendroctonus ponderosae]
Length=2651

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 48/138 (35%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+    S A     D +  +W+ IDLG
Sbjct  1138  WVNPAQYGLVTVTSSDGRNLPYGRLED---ILSRD----SSALNCHTDDDKRAWFSIDLG  1190

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++   YT+R  +   R+ +R+W FQ S DGV WT L  H  D ++ +PG  A+WP+
Sbjct  1191  L--FIIPTAYTLRHARGYGRSALRNWLFQMSKDGVVWTTLSTHTHDISLNEPGSTATWPV  1248

Query  429   TGPNPLLPFRFFRIVMTG  482
               P     +R  RI   G
Sbjct  1249  ESPPDEQGWRHVRIQQAG  1266



>emb|CDK13344.1| HECD-1, isoform f [Caenorhabditis elegans]
Length=2650

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V +T S     F  P+ L+SR+    +      +D N  + + IDLG    
Sbjct  1220  WTNPATVKAVKITCSDTRQPFGKPEDLLSRDQNPINCHTS--DDKN--AHFTIDLGL--F  1273

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             ++   Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G  
Sbjct  1274  VVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEK  1332

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 FRFFRI   G  +     +  C    E+YG
Sbjct  1333  GTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1365



>gb|ENN80588.1| hypothetical protein YQE_02993, partial [Dendroctonus ponderosae]
Length=2689

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/138 (35%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+    S A     D +  +W+ IDLG
Sbjct  1119  WVNPAQYGLVTVTSSDGRNLPYGRLED---ILSRD----SSALNCHTDDDKRAWFSIDLG  1171

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++   YT+R  +   R+ +R+W FQ S DGV WT L  H  D ++ +PG  A+WP+
Sbjct  1172  L--FIIPTAYTLRHARGYGRSALRNWLFQMSKDGVVWTTLSTHTHDISLNEPGSTATWPV  1229

Query  429   TGPNPLLPFRFFRIVMTG  482
               P     +R  RI   G
Sbjct  1230  ESPPDEQGWRHVRIQQAG  1247



>ref|XP_645290.1| hypothetical protein DDB_G0272218 [Dictyostelium discoideum AX4]
 gb|EAL71261.1| hypothetical protein DDB_G0272218 [Dictyostelium discoideum AX4]
Length=602

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/155 (31%), Positives = 74/155 (48%), Gaps = 18/155 (12%)
 Frame = +3

Query  93   NPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLM  272
            +PV  K V VT+S+    +  P   V R  Q T+    + E+    S++ +DLG  H L 
Sbjct  394  SPVTRKVVTVTSSTMSIGYPHP--FVGR--QSTNMYTDKEEN----SFFCVDLGVKHVLC  445

Query  273  CNYYTIRQDGSR-----AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
              YY++R  G       A  ++W   GS DG  WT LR H +D ++      A W +   
Sbjct  446  PTYYSLRYGGDSQGSIYAAPKNWQLLGSLDGQEWTLLRDHSNDLSLKDGYGIAGWDVKS-  504

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              +  +R+ +I+ TGP   + N    C+C  E+YG
Sbjct  505  --IHSYRYLKILQTGPNQRDGN--ELCLCCFEVYG  535



>ref|NP_609369.1| CG5604 [Drosophila melanogaster]
 gb|AAF52899.1| CG5604 [Drosophila melanogaster]
Length=2727

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1144  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1196

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A
Sbjct  1197  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSLVEPGSTA  1254

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPI    +  + +R  RI   G
Sbjct  1255  TWPINCATDDSVWYRHIRIQQNG  1277



>gb|AAQ23602.1| LP05936p [Drosophila melanogaster]
Length=2727

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1144  KTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKKAWFA  1196

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A
Sbjct  1197  IDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSLVEPGSTA  1254

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPI    +  + +R  RI   G
Sbjct  1255  TWPINCATDDSVWYRHIRIQQNG  1277



>ref|XP_005322716.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ictidomys tridecemlineatus]
Length=2610

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 15/123 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200

Query  429   TGP  437
               P
Sbjct  1201  DPP  1203



>ref|XP_310184.4| AGAP009511-PA [Anopheles gambiae str. PEST]
 gb|EAA05937.5| AGAP009511-PA [Anopheles gambiae str. PEST]
Length=2929

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 17/173 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    + L WVNP     V VT+S     P+ +  D   ++SR+   +       
Sbjct  1185  GLIYYIGTNGRTLEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVSVNCHT  1238

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGV+W  L  H DD
Sbjct  1239  KD-NKKSWFAIDLGI--FILPTAYTLRHARGYGRSALRNWLFQMSKDGVSWVTLLTHTDD  1295

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +++ +PG   +WPI  P +    +R  RI   G        +   +   E+YG
Sbjct  1296  KSLAEPGSTCTWPIDCPADEQQGYRHVRIHQNGRNASGQTHY-LSLSGFEIYG  1347



>gb|ETN62256.1| hect E3 ubiquitin ligase [Anopheles darlingi]
Length=2410

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 15/134 (11%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+   +       
Sbjct  1225  GIIYFIGTNGKTSEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVSVNCHT  1278

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW  +  H DD
Sbjct  1279  KD-NKKSWFAIDLGM--FIIPTAYTLRHARGYGRSALRNWLFQMSKDGVNWVTMLTHSDD  1335

Query  387   QTICKPGQFASWPI  428
             +++ +PG   +WPI
Sbjct  1336  KSLAEPGSTCTWPI  1349



>gb|ETN82977.1| HECT-domain protein [Necator americanus]
Length=2630

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 47/154 (31%), Positives = 69/154 (45%), Gaps = 9/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP     V VT S     F  P+ ++SR+    +      ++ N +    IDLG    
Sbjct  1221  WTNPASVGIVQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--L  1274

Query  267   LMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             +  + YT+R  +   R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI    
Sbjct  1275  IYPSAYTLRHARGYGRSALRNWLLQGSKDKQVWEVLVAHTDDTSLGDPGSTATWPIEDDR  1334

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                PFR+ RI   G  +     +   I   E+YG
Sbjct  1335  SKGPFRYLRIAQNGKNSSGQT-YYLSISGFEVYG  1367



>ref|XP_004361480.1| BTB/POZ domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG23629.1| BTB/POZ domain-containing protein [Dictyostelium fasciculatum]
Length=644

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 14/154 (9%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
            W NP  S R+ +T+SS   +     V+    F+  +   P       +SW  IDLG +  
Sbjct  477  WANPHTSLRIKITSSS-IDKGNLQDVVELAPFEFWTKDVP-------ASWVTIDLGPNRS  528

Query  267  LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
            ++   YTIR   S     +R+W+FQGST+G  WT L+ H +D ++       +W I  PN
Sbjct  529  VIPMCYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLKRHTNDSSLNLKYATHTWNI--PN  586

Query  441  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                +R+FRI+ TG  ++  N     I  +ELYG
Sbjct  587  VTAAYRYFRILQTGKNSNNRN--FLVIGGIELYG  618



>ref|XP_003294753.1| hypothetical protein DICPUDRAFT_51693 [Dictyostelium purpureum]
 gb|EGC28716.1| hypothetical protein DICPUDRAFT_51693 [Dictyostelium purpureum]
Length=576

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 74/155 (48%), Gaps = 18/155 (12%)
 Frame = +3

Query  93   NPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLM  272
            +P   K V VT+SS    +  P   VSR       +     D   +S++ +DLG  H L 
Sbjct  370  SPATRKIVTVTSSSMSIGYPHP--FVSRT------STNMYTDKEENSFFCVDLGAKHVLC  421

Query  273  CNYYTIRQDGSR-----AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
              YY++R  G       A  ++W   GS DG+ W+ L  HK+D ++ +    A W +   
Sbjct  422  PTYYSMRYGGDSQGSIYAAPKNWQLLGSLDGIEWSILCDHKNDMSLKEGYSIAGWEVKS-  480

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              +  +R+ +I+ TGP  ++ +    C+C  E+YG
Sbjct  481  --IHSYRYLKILQTGP--NQRDGHELCVCCFEVYG  511



>ref|XP_001652833.1| AAEL007705-PA [Aedes aegypti]
 gb|EAT40581.1| AAEL007705-PA [Aedes aegypti]
Length=2844

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 15/134 (11%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    K   WVNP     V VT+S     P+ +  D   ++SR+   +       
Sbjct  1173  GLVYYIGTNGKTTEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVSVNCHT  1226

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DG+NW  +  H DD
Sbjct  1227  KD-NKKSWFAIDLGM--FIIPTAYTLRHARGYGRSALRNWMFQMSKDGINWATMLTHSDD  1283

Query  387   QTICKPGQFASWPI  428
             +++ +PG   +WP+
Sbjct  1284  KSLAEPGSTCTWPL  1297



>ref|XP_635359.1| hypothetical protein DDB_G0291147 [Dictyostelium discoideum AX4]
 gb|EAL61857.1| hypothetical protein DDB_G0291147 [Dictyostelium discoideum AX4]
Length=938

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 76/168 (45%), Gaps = 14/168 (8%)
 Frame = +3

Query  45   GVHHKMCPQNKELHWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGN  224
            GV + +     +  W NP L  RV V  SS         V+   N   + F    V    
Sbjct  773  GVFYYIGTNGGKEEWSNPALRGRVRVACSSQ----EKGSVIDCFNRTSSEFWSMDVP---  825

Query  225  ISSWWMIDLGYDHQLMCNYYTIRQDG-SRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTIC  398
             +SW  ++LG    ++   YT+R  G S+A  +R+W  QGS D  NWT L  H +D ++ 
Sbjct  826  -ASWISVNLGSSRTMVPTCYTLRHGGNSKADCLRNWTLQGSMDSKNWTVLVRHSNDASLN  884

Query  399  KPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                  SWPI  PN    +R FRI+ TG  +   N  +  I  +E YG
Sbjct  885  GNFSTCSWPI--PNCTQAYRHFRILQTGRNSSNHNFLS--ISGIEFYG  928



>gb|EYB85246.1| hypothetical protein Y032_0302g1869 [Ancylostoma ceylanicum]
Length=1818

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 46/154 (30%), Positives = 68/154 (44%), Gaps = 9/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP     V VT S     F  P+ ++SR+    +      ++ N +    IDLG    
Sbjct  1148  WTNPATIGVVQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--L  1201

Query  267   LMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             +    YT+R  +   R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI    
Sbjct  1202  IYPTAYTLRHARGYGRSALRNWLLQGSKDKQVWEVLVAHADDTSLGDPGSTATWPIEDDR  1261

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                PFR+ R+   G  +     +   I   E+YG
Sbjct  1262  TKGPFRYLRVAQNGKNSSGQT-YYLSISGFEVYG  1294



>ref|XP_001992956.1| GH13561 [Drosophila grimshawi]
 gb|EDV98881.1| GH13561 [Drosophila grimshawi]
Length=2746

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 49/153 (32%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G+ + +    +   WVNP     V VT+S     P+ +  D   ++SR+  G S      
Sbjct  1137  GLIYYIGSNGRTYEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD--GVSL-NCHT  1190

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
             +D N  +W+ IDLG    ++   YT+R  +   R+ +R+W  Q S D VNWT L  H DD
Sbjct  1191  KD-NKKAWFAIDLGV--YIVPTAYTLRHARGYGRSALRNWLLQASKDSVNWTTLISHVDD  1247

Query  387   QTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  482
             +++ +PG  A+WPI    +    +R  RI   G
Sbjct  1248  KSLVEPGSTATWPIICNADDTKGYRHIRIQQNG  1280



>gb|ETO35939.1| hypothetical protein RFI_01125, partial [Reticulomyxa filosa]
Length=766

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 77/155 (50%), Gaps = 16/155 (10%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDP-KVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  263
            W NP L+  VA+ ASS   + +DP   LV R    T     + ED   ++W  +D   D 
Sbjct  577  WTNPALADEVALAASS-LVKDSDPLHHLVGRE---TVRLVTKPED---NAWMQVDFK-DK  628

Query  264  QLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  437
             +  +YYT+R   S     +R+W  Q S DGV+W  ++ H+DDQ + + G   +WP+ G 
Sbjct  629  LIQPSYYTLRHYSSWDTECLRNWILQASNDGVHWVTVKKHEDDQGLNEKGATHTWPVQGR  688

Query  438  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                 +R +RI  TG  +++     C    +E YG
Sbjct  689  G---AYRIWRIKQTGLNSNKHKYLAC--SGIEFYG  718



>gb|ERG82482.1| e3 ubiquitin-protein ligase hectd1 [Ascaris suum]
Length=2913

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 75/156 (48%), Gaps = 10/156 (6%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASSPFSR-FTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  260
             HW NP     V VT+S    + +  P+ ++SR+   ++      +D N  + + IDLG  
Sbjct  1310  HWTNPASVNVVYVTSSDGARQPYGHPEDILSRDV--SALNCHTSDDKN--AHFTIDLGV-  1364

Query  261   HQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  434
               +    YT+R  +   R+ +R+W FQGS +G  W  L VH++D  +  PG  A+WP+  
Sbjct  1365  -YIYPTSYTLRHARGYGRSALRNWLFQGSRNGRTWDVLLVHENDAALSDPGSTATWPVVC  1423

Query  435   PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
                  P+R+ RI   G        +   +   E+YG
Sbjct  1424  AEGKGPYRYLRIAQNGKNASNQT-YYLSLSGFEVYG  1458



>ref|XP_011267641.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Camponotus 
floridanus]
Length=2548

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1086  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1134

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1135  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1191

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1192  CSLNEPGSTATWTLDPPS  1209



>ref|XP_011267642.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Camponotus 
floridanus]
Length=2530

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1136  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1185  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1241

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1242  CSLNEPGSTATWTLDPPS  1259



>ref|XP_011267639.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camponotus 
floridanus]
Length=2586

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1124  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1172

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1173  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1229

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1230  CSLNEPGSTATWTLDPPS  1247



>ref|XP_011267637.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Camponotus 
floridanus]
Length=2598

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1136  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1185  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1241

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1242  CSLNEPGSTATWTLDPPS  1259



>gb|EFN60527.1| E3 ubiquitin-protein ligase HECTD1 [Camponotus floridanus]
Length=2551

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1086  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1134

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1135  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1191

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1192  CSLNEPGSTATWTLDPPS  1209



>ref|XP_011267640.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camponotus 
floridanus]
Length=2560

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K CP+     WVNP     V +T+S     P+    D   ++SR+    S      
Sbjct  1098  GTNAKTCPE-----WVNPGQYGLVVITSSDGRNLPYGHLED---ILSRD---PSALNCHT  1146

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ N YT+R  +   R+ +R+W FQ S DGV WT L  H DD
Sbjct  1147  ND-DKRAWFSIDLGV--WIIPNAYTLRHARGYGRSALRNWMFQASKDGVTWTTLYAHVDD  1203

Query  387   QTICKPGQFASWPITGPN  440
              ++ +PG  A+W +  P+
Sbjct  1204  CSLNEPGSTATWTLDPPS  1221



>ref|XP_006975329.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Peromyscus 
maniculatus bairdii]
Length=2563

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_011242353.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Mus 
musculus]
Length=2563

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006240150.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Rattus 
norvegicus]
Length=2563

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_007637045.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Cricetulus 
griseus]
 gb|ERE72330.1| E3 ubiquitin-protein ligase [Cricetulus griseus]
Length=2563

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_004682014.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Condylura cristata]
Length=2610

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_004864088.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864089.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
Length=2610

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_005343806.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Microtus ochrogaster]
Length=2581

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_004909448.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004909449.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
 gb|EHB18581.1| E3 ubiquitin-protein ligase HECTD1 [Heterocephalus glaber]
Length=2609

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_006975330.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Peromyscus 
maniculatus bairdii]
Length=2549

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006975328.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006975327.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Peromyscus 
maniculatus bairdii]
Length=2610

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_004909450.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2607

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864090.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004909451.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2562

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864091.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2563

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +  LELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007637041.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Cricetulus 
griseus]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_011242352.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Mus 
musculus]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_011242351.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Mus 
musculus]
Length=2609

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1089  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1141

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1142  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1199



>ref|XP_003499219.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Cricetulus 
griseus]
 gb|EGV97528.1| E3 ubiquitin-protein ligase HECTD1 [Cricetulus griseus]
 gb|ERE72331.1| E3 ubiquitin-protein ligase [Cricetulus griseus]
Length=2610

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006240148.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Rattus 
norvegicus]
Length=2610

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|NP_659037.2| E3 ubiquitin-protein ligase HECTD1 [Mus musculus]
 ref|XP_006515701.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Mus 
musculus]
Length=2610

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006240151.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Rattus 
norvegicus]
Length=2549

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_007618568.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Cricetulus 
griseus]
Length=2603

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_006240149.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Rattus 
norvegicus]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>ref|XP_004661912.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Jaculus jaculus]
Length=2610

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1090  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1142

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1143  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1200



>sp|Q69ZR2.2|HECD1_MOUSE RecName: Full=E3 ubiquitin-protein ligase HECTD1; AltName: Full=HECT 
domain-containing protein 1; AltName: Full=Protein open 
mind [Mus musculus]
Length=2618

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1095  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLG  1147

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+
Sbjct  1148  V--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL  1205



>ref|XP_007891590.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Callorhinchus 
milii]
Length=2528

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1097  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLG  1149

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+
Sbjct  1150  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL  1207



>ref|XP_007891591.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Callorhinchus 
milii]
Length=2522

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1091  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLG  1143

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+
Sbjct  1144  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL  1201



>gb|EFA01492.1| hypothetical protein TcasGA2_TC007046 [Tribolium castaneum]
Length=2552

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 15/125 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   +S       D +  +W+ IDLG
Sbjct  1116  WVNPAQYGLVTVTSSDGRNLPYGRVED---ILSRD---SSALNCHTND-DKKAWFSIDLG  1168

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG+ WT L  H DD ++  PG   SWPI
Sbjct  1169  L--YVIPSGYTLRHARGYGRSALRNWYFQMSRDGITWTTLSTHTDDTSLNDPGSTNSWPI  1226

Query  429   TGPNP  443
                +P
Sbjct  1227  ELSSP  1231



>ref|XP_008192900.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Tribolium castaneum]
Length=2608

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 15/125 (12%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   +S       D +  +W+ IDLG
Sbjct  1104  WVNPAQYGLVTVTSSDGRNLPYGRVED---ILSRD---SSALNCHTND-DKKAWFSIDLG  1156

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG+ WT L  H DD ++  PG   SWPI
Sbjct  1157  L--YVIPSGYTLRHARGYGRSALRNWYFQMSRDGITWTTLSTHTDDTSLNDPGSTNSWPI  1214

Query  429   TGPNP  443
                +P
Sbjct  1215  ELSSP  1219



>ref|XP_007891592.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Callorhinchus 
milii]
Length=2508

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1091  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLG  1143

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+
Sbjct  1144  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL  1201



>ref|XP_007891589.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Callorhinchus 
milii]
Length=2566

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1088  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLG  1140

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+
Sbjct  1141  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL  1198



>ref|XP_007891587.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callorhinchus 
milii]
Length=2569

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG
Sbjct  1091  WVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLG  1143

Query  255   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                 ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+
Sbjct  1144  L--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPL  1201



>ref|XP_007429073.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Python 
bivittatus]
Length=2570

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_002052386.1| GJ21961 [Drosophila virilis]
 gb|EDW64541.1| GJ21961 [Drosophila virilis]
Length=2710

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 75/160 (47%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ +  D   ++SR+    +         N  +W+ IDL
Sbjct  1138  EWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRDAVSLNCHTKD----NKKAWFSIDL  1190

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++   YT+R      R+ +R+W  Q S DG+NWT L  H DD+++ +PG  A+WP
Sbjct  1191  GV--CIVPTAYTLRHARGYGRSALRNWLLQASKDGINWTTLISHVDDKSLAEPGSTATWP  1248

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             I    +    +R  RI   G        +   +  LE+YG
Sbjct  1249  IVCTSDDTKGYRHIRIQQNGRNASGQTHY-LSLSGLEIYG  1287



>ref|XP_007429075.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Python 
bivittatus]
Length=2509

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007429074.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Python 
bivittatus]
Length=2523

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_002633092.1| Hypothetical protein CBG05779 [Caenorhabditis briggsae]
Length=2752

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V VT S P   F  P+ L+SR+    +      +D N  S +  DLG    
Sbjct  1250  WTNPATVKAVKVTCSDPRQPFGKPEDLLSRDSNPINCHSS--DDKN--SHFTFDLGV--F  1303

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             L+   YT+R      R+ +R+W  QGS D   W ++  H DD+++ +PG  A+W +    
Sbjct  1304  LIPTSYTMRHSRGYGRSALRNWTLQGSIDSKKWDDIINHVDDKSLGEPGSTATWHVPEKG  1363

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
               + +R++RI   G  +     +  C    E+YG
Sbjct  1364  -TVAYRYYRIAQNGKNSSGQTHYLSC-SGFEIYG  1395



>ref|XP_011314687.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Fopius 
arisanus]
Length=2365

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1137  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1185  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1242

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1243  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_002676026.1| predicted protein [Naegleria gruberi]
 gb|EFC43282.1| predicted protein [Naegleria gruberi]
Length=601

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +3

Query  282  YTIRQDGSR--AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  455
            YTIR   +R    +R+W FQGS DG+ +T+L+VH +D T+    Q A++PIT  N    +
Sbjct  512  YTIRHTNARDTECLRTWRFQGSIDGLTFTDLKVHNNDSTLTTKSQSATFPITDCNEY--Y  569

Query  456  RFFRIVMTGPGTDEMN  503
            ++FRI+  GP +   N
Sbjct  570  KYFRILQDGPNSSSNN  585



>ref|XP_007063755.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Chelonia mydas]
Length=2577

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             I  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  IDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010198466.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1, partial [Colius 
striatus]
Length=1133

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V +T+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  212  EWVNPAAYGLVVITSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  264

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  265  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  322

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  323  LDSPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  361



>gb|KHJ84376.1| hypothetical protein OESDEN_15912, partial [Oesophagostomum dentatum]
Length=395

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 68/154 (44%), Gaps = 9/154 (6%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
            W NP     V VT S     F  P+ ++SR+    +      ++ N +    IDLG    
Sbjct  101  WTNPASIGIVQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--L  154

Query  267  LMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
            +    YT+R  +   R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI    
Sbjct  155  IYPTAYTLRHARGYGRSALRNWLLQGSKDKQVWEVLVAHTDDTSLGDPGSTATWPIEDDR  214

Query  441  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
               PFR+ RI   G  +     +   I   E+YG
Sbjct  215  TKGPFRYLRIAQNGKNSSGQT-YYLSISGFEVYG  247



>gb|KDR14371.1| E3 ubiquitin-protein ligase HECTD1 [Zootermopsis nevadensis]
Length=2759

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 84/173 (49%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+ R  D   ++SR+   +S      
Sbjct  1142  GTNGKTSPE-----WVNPGQYGLVMVTSSDGRNLPYGRLED---ILSRD---SSALNCHT  1190

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              D +  +W+ IDLG    ++ + YT+R      R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1191  ND-DKRAWFAIDLGL--WVLPSSYTLRHARGYGRSALRNWLFQVSKDGLNWTTLYTHMDD  1247

Query  387   QTICKPGQFASWPITGPNPLLP-FRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  +SWP+  P   +  +R  R+  TG        +   +   E+YG
Sbjct  1248  GSLNEPGSTSSWPLEPPTEEVQGWRHIRLQQTGKNASGQTHY-LSLSGFEIYG  1299



>ref|XP_002014386.1| GL19165 [Drosophila persimilis]
 gb|EDW28382.1| GL19165 [Drosophila persimilis]
Length=2719

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 15/142 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP L   V VT+S     P+ +  D   ++SR+    S +       N  +++ 
Sbjct  1143  KTCDWVNPALYGLVQVTSSEGKTLPYGKVED---ILSRD----SISLNCHTKDNKKAYFA  1195

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++   YT+R  +   R+ +R+W  Q S DGV WT L  H DD+++ +PG  A
Sbjct  1196  IDLGV--FIVPTAYTLRHARGYGRSALRNWLLQASKDGVCWTTLSTHIDDKSLLEPGSTA  1253

Query  417   SWPITGPNPLLPFRFFRIVMTG  482
             +W I   +  + +R  RI   G
Sbjct  1254  TWSINCASDSVGYRHIRIQQNG  1275



>ref|XP_008565371.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Galeopterus 
variegatus]
Length=2172

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  698  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  750

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  751  GL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  808

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  809  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  847



>emb|CAP26541.2| Protein CBR-HECD-1 [Caenorhabditis briggsae]
Length=2727

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = +3

Query  87    WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  266
             W NP   K V VT S P   F  P+ L+SR+    +      +D N  S +  DLG    
Sbjct  1236  WTNPATVKAVKVTCSDPRQPFGKPEDLLSRDSNPINCHSS--DDKN--SHFTFDLGV--F  1289

Query  267   LMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  440
             L+   YT+R      R+ +R+W  QGS D   W ++  H DD+++ +PG  A+W +    
Sbjct  1290  LIPTSYTMRHSRGYGRSALRNWTLQGSIDSKKWDDIINHVDDKSLGEPGSTATWHVPEKG  1349

Query  441   PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
               + +R++RI   G  +     +  C    E+YG
Sbjct  1350  -TVAYRYYRIAQNGKNSSGQTHYLSC-SGFEIYG  1381



>gb|EMP32200.1| E3 ubiquitin-protein ligase HECTD1 [Chelonia mydas]
Length=2610

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDL
Sbjct  1129  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDL  1181

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1182  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1239

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             I  P +    +R  RI   G        +   +   ELYG
Sbjct  1240  IDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1278



>ref|XP_011314688.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X9 [Fopius 
arisanus]
Length=2535

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1085  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1132

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1133  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1190

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1191  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1242



>ref|XP_011314684.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Fopius 
arisanus]
Length=2547

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1097  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1144

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1145  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1202

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1203  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1254



>ref|XP_008565370.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Galeopterus 
variegatus]
Length=2217

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  698  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  750

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  751  GL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  808

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  809  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  847



>ref|XP_011314686.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Fopius 
arisanus]
Length=2524

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1137  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1185  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1242

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1243  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_011314680.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fopius 
arisanus]
Length=2587

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1137  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1185  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1242

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1243  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_011314682.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fopius 
arisanus]
Length=2551

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1097  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1144

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1145  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1202

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1203  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1254



>ref|XP_011314681.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fopius 
arisanus]
Length=2579

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1125  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1172

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1173  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1230

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1231  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1282



>ref|XP_011314679.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fopius 
arisanus]
Length=2591

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1137  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1184

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1185  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1242

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1243  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_009860152.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ciona intestinalis]
Length=2647

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 15/123 (12%)
 Frame = +3

Query  78    ELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  245
             E  W NP     V VT+S     P+ +  D   ++SR+   T+       D N  +W  +
Sbjct  1115  EYDWTNPASYGLVHVTSSDEGGLPYGKLED---ILSRD---TTPCNCHTSD-NEKAWIAL  1167

Query  246   DLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  419
             D G   Q++   Y++R     SR+ +R+W FQ S DG NWT L  H +D+++ +PG  AS
Sbjct  1168  DFGL--QIIPTKYSLRHSRGYSRSALRNWLFQASNDGKNWTTLVTHTNDKSLNQPGSTAS  1225

Query  420   WPI  428
             W I
Sbjct  1226  WSI  1228



>ref|XP_011314685.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Fopius 
arisanus]
Length=2539

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 82/173 (47%), Gaps = 22/173 (13%)
 Frame = +3

Query  45    GVHHKMCPQNKELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQV  212
             G + K  P+     WVNP     V VT+S     P+    D   ++SR+    +      
Sbjct  1085  GTNAKSAPE-----WVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQNALNCH----  1132

Query  213   EDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDD  386
              + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD
Sbjct  1133  TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDD  1190

Query  387   QTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              ++ +PG  A+W +  P      +R  R+  TG        +   +  LE+YG
Sbjct  1191  CSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1242



>ref|XP_003924275.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010333266.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=2610

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDTPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010333267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=2608

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDTPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005951436.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like, partial [Haplochromis 
burtoni]
Length=2030

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1106  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1158

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1159  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1216

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1217  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1255



>ref|XP_010333269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Saimiri 
boliviensis boliviensis]
Length=2331

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDTPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010333268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Saimiri 
boliviensis boliviensis]
Length=2563

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDTPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008312929.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Cynoglossus 
semilaevis]
Length=2569

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1083  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1135

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1136  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1193

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1194  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1232



>ref|XP_004209170.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like, partial [Hydra 
vulgaris]
Length=1793

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 45/162 (28%), Positives = 80/162 (49%), Gaps = 20/162 (12%)
 Frame = +3

Query  87   WVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  254
            WVNP     V +++S     P+    D   ++ R+   ++       D + ++W+ IDLG
Sbjct  166  WVNPGSHNIVLISSSEGKDLPYGHLED---IIGRD---SAPVNCHTND-DKAAWFSIDLG  218

Query  255  YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  428
                ++   YT+R  +   R+ +R+W FQ S DGV+W  L+ H++D+++ +PG   +WP+
Sbjct  219  V--HVIPTAYTLRHARGYGRSALRNWLFQVSKDGVSWLTLKKHENDESLKEPGSTTTWPL  276

Query  429  TGPNPLLP----FRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
              P+  L     + F R+   GP       +   +   ELYG
Sbjct  277  DMPDSALNETEGWHFVRLQQNGPNASGQTHY-LSVSGFELYG  317



>ref|XP_008565372.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Galeopterus 
variegatus]
Length=2610

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008312922.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Cynoglossus 
semilaevis]
Length=2575

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_009909049.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Picoides pubescens]
Length=2570

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             I  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  IDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005728612.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1-like 
[Pundamilia nyererei]
Length=2587

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_005456014.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Oreochromis 
niloticus]
Length=2459

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_005561082.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Macaca 
fascicularis]
Length=2172

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  698  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  750

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  751  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  808

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  809  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  847



>ref|XP_008312937.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Cynoglossus 
semilaevis]
Length=2525

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_002075680.1| GK23521 [Drosophila willistoni]
 gb|EDW86666.1| GK23521 [Drosophila willistoni]
Length=2700

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 71/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  75    KELHWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  242
             K   WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ 
Sbjct  1144  KTYEWVNPAQYGLVQVTSSEGKVLPYGKLED---ILSRD----SVSLNCHTKDNKKAWFS  1196

Query  243   IDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  416
             IDLG    ++ N Y++R  +   R+ +R+W  Q S DG+ W  L  H DD+++ +PG  A
Sbjct  1197  IDLGV--YIIPNAYSLRHARGYGRSALRNWLLQSSRDGLTWITLINHVDDKSLVEPGSTA  1254

Query  417   SWPIT-GPNPLLPFRFFRIVMTG  482
             +WPI    +  + +R  RI   G
Sbjct  1255  TWPIICASDETVGYRHIRIQQNG  1277



>gb|EHH27804.1| hypothetical protein EGK_18090 [Macaca mulatta]
Length=2125

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  604  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  656

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  657  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  714

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  715  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  753



>ref|XP_005456015.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Oreochromis 
niloticus]
Length=2247

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_010631867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fukomys 
damarensis]
Length=2331

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005456013.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Oreochromis 
niloticus]
Length=2533

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_003451257.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Oreochromis 
niloticus]
Length=2570

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDSSLNEPGSTATWP  1199

Query  426   IT-GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +         +R  RI   G        +   +  LELYG
Sbjct  1200  LDPSKEEKQGWRHIRIKQMGKNASGQTHY-LSLSGLELYG  1238



>dbj|BAA86445.2| KIAA1131 protein [Homo sapiens]
Length=2168

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  647  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  699

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  700  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  757

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  758  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  796



>ref|XP_005561083.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Macaca 
fascicularis]
Length=2170

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84   HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
             WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  698  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  750

Query  252  GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
            G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  751  GL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  808

Query  426  ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
            +  P +    +R  RI   G        +   +   ELYG
Sbjct  809  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  847



>ref|XP_010631864.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fukomys 
damarensis]
 gb|KFO29273.1| E3 ubiquitin-protein ligase HECTD1 [Fukomys damarensis]
Length=2610

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +3

Query  84    HWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  251
              WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDL
Sbjct  1089  EWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDL  1141

Query  252   GYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  425
             G    ++ + YT+R      R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP
Sbjct  1142  GL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWP  1199

Query  426   ITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  542
             +  P +    +R  RI   G        +   +   ELYG
Sbjct  1200  LDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750