BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS124G06

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    1e-12   Phoenix dactylifera
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    2e-12   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    2e-12   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    2e-12   Phoenix dactylifera
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...  75.5    3e-12   Solanum tuberosum [potatoes]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...  75.5    3e-12   Solanum tuberosum [potatoes]
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...  75.5    3e-12   Solanum tuberosum [potatoes]
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...  75.5    3e-12   Solanum lycopersicum
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...  75.5    3e-12   Solanum lycopersicum
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...  75.5    3e-12   Solanum lycopersicum
emb|CBI31785.3|  unnamed protein product                              72.8    1e-11   Vitis vinifera
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...  72.8    1e-11   Vitis vinifera
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...  72.8    2e-11   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...  72.8    2e-11   Phoenix dactylifera
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  72.4    2e-11   Phoenix dactylifera
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...  72.8    2e-11   Phoenix dactylifera
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...  70.5    1e-10   Nicotiana tomentosiformis
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...  70.5    1e-10   Nicotiana tomentosiformis
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g           70.1    1e-10   Phaseolus vulgaris [French bean]
ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g           70.1    1e-10   Phaseolus vulgaris [French bean]
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g           70.1    2e-10   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g           70.1    2e-10   Phaseolus vulgaris [French bean]
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg           66.2    2e-10   
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.8    8e-10   Glycine max [soybeans]
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       67.8    8e-10   Glycine soja [wild soybean]
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  67.8    8e-10   Glycine max [soybeans]
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       67.8    8e-10   Glycine soja [wild soybean]
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528  67.4    8e-10   
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...  67.4    8e-10   Sesamum indicum [beniseed]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...  67.4    9e-10   Sesamum indicum [beniseed]
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.0    9e-10   Vitis vinifera
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.0    1e-09   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.0    1e-09   Vitis vinifera
emb|CBI34715.3|  unnamed protein product                              67.4    1e-09   Vitis vinifera
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...  67.0    1e-09   Nicotiana sylvestris
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...  67.0    2e-09   Nicotiana sylvestris
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...  67.0    2e-09   Nicotiana sylvestris
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...  66.2    2e-09   
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...  66.2    2e-09   
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  65.9    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  65.5    4e-09   
emb|CAN74037.1|  hypothetical protein VITISV_023406                   65.5    4e-09   Vitis vinifera
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  65.5    4e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP25474.1|  hypothetical protein JCGZ_20630                       65.5    5e-09   Jatropha curcas
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                65.1    5e-09   
ref|XP_007040167.1|  Uncharacterized protein TCM_016211               64.3    1e-08   
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           63.2    3e-08   Phaseolus vulgaris [French bean]
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg           62.8    3e-08   
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg           62.8    3e-08   Citrus clementina [clementine]
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg           62.8    3e-08   Citrus clementina [clementine]
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                60.5    5e-08   Citrus sinensis [apfelsine]
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                60.5    5e-08   Citrus sinensis [apfelsine]
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188  62.0    6e-08   Cucumis sativus [cucumbers]
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  61.6    6e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  61.6    6e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104  61.6    7e-08   
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                60.5    7e-08   Citrus sinensis [apfelsine]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...  61.2    8e-08   Cucumis melo [Oriental melon]
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...  61.2    9e-08   Cucumis melo [Oriental melon]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...  61.2    9e-08   Cucumis melo [Oriental melon]
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266  61.2    9e-08   
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798  61.2    9e-08   
emb|CDP05220.1|  unnamed protein product                              60.8    1e-07   Coffea canephora [robusta coffee]
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357  60.8    1e-07   Cicer arietinum [garbanzo]
emb|CDP09782.1|  unnamed protein product                              60.1    2e-07   Coffea canephora [robusta coffee]
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  58.5    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB39637.1|  hypothetical protein B456_007G022700                  59.7    3e-07   Gossypium raimondii
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...  59.7    3e-07   Fragaria vesca subsp. vesca
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...  59.7    3e-07   Fragaria vesca subsp. vesca
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   56.2    6e-07   
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        58.5    8e-07   Amborella trichopoda
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...  58.2    8e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...  58.2    8e-07   
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...  58.2    8e-07   
gb|KEH21030.1|  methyl-CpG-binding domain protein                     58.2    1e-06   Medicago truncatula
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...  57.8    1e-06   Elaeis guineensis
ref|XP_010934848.1|  PREDICTED: uncharacterized protein LOC105054...  57.4    1e-06   Elaeis guineensis
emb|CBI16127.3|  unnamed protein product                              54.7    1e-06   Vitis vinifera
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...  57.4    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_002532846.1|  DNA binding protein, putative                    55.8    2e-06   
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...  57.4    2e-06   
gb|KDP34493.1|  hypothetical protein JCGZ_11043                       55.8    2e-06   Jatropha curcas
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  55.1    2e-06   Fragaria vesca subsp. vesca
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513  57.0    2e-06   
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...  55.8    4e-06   
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...  55.8    5e-06   
ref|XP_002314180.1|  methyl-CpG-binding domain-containing family ...  54.3    5e-06   
ref|XP_010934849.1|  PREDICTED: uncharacterized protein LOC105054...  55.5    5e-06   
ref|XP_009364396.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  55.5    5e-06   
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_008357235.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    6e-06   Malus domestica [apple tree]
ref|XP_011042705.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    6e-06   Populus euphratica
ref|XP_009345984.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           53.1    7e-06   
ref|XP_003632148.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.7    7e-06   Vitis vinifera
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           52.8    8e-06   
emb|CDP06874.1|  unnamed protein product                              53.9    1e-05   Coffea canephora [robusta coffee]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    1e-05   Vitis vinifera
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  54.3    2e-05   Prunus mume [ume]
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650  53.5    3e-05   Phoenix dactylifera
gb|KJB52811.1|  hypothetical protein B456_008G278300                  53.1    3e-05   Gossypium raimondii
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  52.0    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.6    4e-05   Populus euphratica
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...  53.1    4e-05   Gossypium arboreum [tree cotton]
ref|XP_008223622.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.4    4e-05   Prunus mume [ume]
gb|KHF99779.1|  Methyl-CpG-binding domain-containing 6 -like protein  51.6    6e-05   Gossypium arboreum [tree cotton]
emb|CDY33033.1|  BnaA10g12390D                                        52.4    6e-05   Brassica napus [oilseed rape]
gb|KJB83777.1|  hypothetical protein B456_013G263700                  51.6    7e-05   Gossypium raimondii
ref|XP_010106481.1|  Methyl-CpG-binding domain-containing protein 6   51.6    7e-05   Morus notabilis
ref|XP_009126698.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.2    8e-05   Brassica rapa
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  52.4    8e-05   
emb|CDY53445.1|  BnaA02g07070D                                        51.2    8e-05   Brassica napus [oilseed rape]
ref|XP_006400967.1|  hypothetical protein EUTSA_v10014530mg           51.2    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010541401.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    1e-04   Tarenaya hassleriana [spider flower]
gb|KHN35006.1|  hypothetical protein glysoja_004772                   50.4    1e-04   Glycine soja [wild soybean]
ref|XP_010541402.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    1e-04   Tarenaya hassleriana [spider flower]
emb|CDY59223.1|  BnaCnng34510D                                        50.8    1e-04   Brassica napus [oilseed rape]
emb|CDY48687.1|  BnaC02g09990D                                        50.8    1e-04   Brassica napus [oilseed rape]
emb|CDX80274.1|  BnaC09g34680D                                        51.6    1e-04   
gb|KFK27467.1|  hypothetical protein AALP_AA8G387100                  50.4    1e-04   Arabis alpina [alpine rockcress]
gb|KFK27470.1|  hypothetical protein AALP_AA8G387500                  50.4    2e-04   Arabis alpina [alpine rockcress]
ref|XP_007514055.1|  predicted protein                                51.2    2e-04   Bathycoccus prasinos
ref|XP_009371320.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    2e-04   Pyrus x bretschneideri [bai li]
ref|NP_200746.1|  methyl-CpG-binding domain-containing protein 6      50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009604783.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    2e-04   Nicotiana tomentosiformis
ref|XP_008376557.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    2e-04   
ref|XP_009371318.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_009787915.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.1    3e-04   Nicotiana sylvestris
ref|XP_002864630.1|  hypothetical protein ARALYDRAFT_919168           49.7    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_004168988.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.3    3e-04   
ref|XP_007016409.1|  Methyl-CPG-binding domain protein 5, putativ...  49.3    4e-04   
ref|XP_007016410.1|  Methyl-CPG-binding domain protein 5, putativ...  49.3    4e-04   Theobroma cacao [chocolate]
ref|XP_003549104.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   Glycine max [soybeans]
ref|XP_008457481.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    4e-04   
gb|KGN65724.1|  hypothetical protein Csa_1G522010                     49.3    5e-04   Cucumis sativus [cucumbers]
ref|XP_011012359.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_011030071.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_009121317.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.9    6e-04   
ref|XP_011012358.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_011012360.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_011030070.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_011030072.1|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    6e-04   Populus euphratica
ref|XP_007152298.1|  hypothetical protein PHAVU_004G117900g           49.3    6e-04   Phaseolus vulgaris [French bean]
gb|KHN31504.1|  Methyl-CpG-binding domain-containing protein 13       49.3    8e-04   Glycine soja [wild soybean]
gb|KFK33990.1|  hypothetical protein AALP_AA5G087600                  47.8    9e-04   Arabis alpina [alpine rockcress]
ref|XP_002875791.1|  hypothetical protein ARALYDRAFT_485028           47.8    0.001   



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 21/133 (16%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  534  DISADGLPAGWVK  572
            + + DGLP+GW+K
Sbjct  174  EYTPDGLPSGWIK  186



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 21/133 (16%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  130

Query  534  DISADGLPAGWVK  572
            + + DGLP+GW+K
Sbjct  131  EYTPDGLPSGWIK  143



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 21/133 (16%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  534  DISADGLPAGWVK  572
            + + DGLP+GW+K
Sbjct  174  EYTPDGLPSGWIK  186



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 21/133 (16%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+NQ    +       
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMENQVRSQI-------  173

Query  534  DISADGLPAGWVK  572
            + + DGLP+GW+K
Sbjct  174  EYTPDGLPSGWIK  186



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  365
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  365
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  365
            N S +WLPPGW VELKTR +GSH G+ YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  374
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N  I
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN--I  168

Query  375  snenknnieesssnleVPQNQTPK----ENQSRTSRKRKSVMDNQTP----KTVSPAVAA  530
            + E + + +   S     +++ PK      Q+R S++ KS  D  +P     + S   A+
Sbjct  169  AGEGQTHGDGEISTTNQKKSEDPKIIRGGGQTRKSKRLKSDTDQASPGIEEGSFSKLKAS  228

Query  531  QDISADG  551
            QD    G
Sbjct  229  QDFEEVG  235



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPI  374
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N  I
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN--I  168

Query  375  snenknnieesssnleVPQNQTPK----ENQSRTSRKRKSVMDNQTP----KTVSPAVAA  530
            + E + + +   S     +++ PK      Q+R S++ KS  D  +P     + S   A+
Sbjct  169  AGEGQTHGDGEISTTNQKKSEDPKIIRGGGQTRKSKRLKSDTDQASPGIEEGSFSKLKAS  228

Query  531  QDISADG  551
            QD    G
Sbjct  229  QDFEEVG  235



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSN  365
            N S +WLPPGW VELKTR +GSH G +YK YI PS G KFYSK +VS++L +   +N
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNN  167



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 64/135 (47%), Gaps = 42/135 (31%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  380
            S DWLPPGW VE+K  ST    G  YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTST----GRKYKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTP-----------KTVSPAVA  527
                           P N   +E+  + S +RK+ +    P             ++  V 
Sbjct  53   ---------------PLND--RESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCIAKKVV  95

Query  528  AQDISADGLPAGWVK  572
             + ++A+GLP GW+K
Sbjct  96   FERVTAEGLPPGWIK  110



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 64/140 (46%), Gaps = 52/140 (37%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  380
            S DWLPPGW VE+K  ST    G  YKCYI PS G KFYSK +VS++LN A         
Sbjct  6    SDDWLPPGWKVEMKLTST----GRKYKCYIHPSRGLKFYSKPEVSRYLNKA---------  52

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA-------------  521
                           P N        R S ++KS+      KT++PA             
Sbjct  53   ---------------PLN-------DRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCI  90

Query  522  ---VAAQDISADGLPAGWVK  572
               V  + ++A+GLP GW+K
Sbjct  91   AKKVVFERVTAEGLPPGWIK  110



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  128

Query  534  -DISADGLPAGWVK  572
             + + DGLP+GW+K
Sbjct  129  IEYTPDGLPSGWIK  142



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  171

Query  534  -DISADGLPAGWVK  572
             + + DGLP+GW+K
Sbjct  172  IEYTPDGLPSGWIK  185



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  29   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  88

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  89   CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  128

Query  534  -DISADGLPAGWVK  572
             + + DGLP+GW+K
Sbjct  129  IEYTPDGLPSGWIK  142



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 24/134 (18%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G+H G  YKCYI P +G +FYSK +V +++    +
Sbjct  72   LAEQIKDFPDWLPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDGMS  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRK--RKSVMDNQTPKTVSPAVAAQ  533
             N             +     V    T     S + RK  ++S M+N         V +Q
Sbjct  132  CNP-----------RAKRKRSVVTKVTENACSSTSQRKGIKRSTMEN---------VRSQ  171

Query  534  -DISADGLPAGWVK  572
             + + DGLP+GW+K
Sbjct  172  IEYTPDGLPSGWIK  185



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            +   T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   
Sbjct  106  IVEETKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQ  165

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMD  491
            +N     +     E SSSN +  +N      QSR S+++KS  D
Sbjct  166  NNIAGEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGD  209



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            +   T +S +WLP GW VEL+ R +GSH G  YK YI PS G KFYS+ +VS++L +   
Sbjct  106  IVEETKKSPEWLPAGWIVELRNRKSGSHAGLAYKVYIDPSTGNKFYSRPEVSKYLKTMKQ  165

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMD  491
            +N     +     E SSSN +  +N      QSR S+++KS  D
Sbjct  166  NNIAGEEQIHGTGEVSSSNQKASENSKDIGGQSRISKRQKSDGD  209



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  366  T  368
            +
Sbjct  84   S  84



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  366  T  368
            +
Sbjct  84   S  84



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  366  T  368
            +
Sbjct  84   S  84



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            A  +N+  +WLP GW VE KTR +G++ G  YKCYI P+G KFYSK +V ++L +  NSN
Sbjct  25   AEKSNEHPEWLPDGWIVESKTRKSGANMGCGYKCYIDPTGCKFYSKPEVLRYLET-VNSN  83

Query  366  T  368
            +
Sbjct  84   S  84



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            L  NT +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  77   LVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTECSFYSKPEVFRYLKTV  134



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L +  +
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKD  87



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            N+  DWLP GW VE++TR +G H GS YKCYI P  G KF+SK +V ++L +  +
Sbjct  33   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKD  87



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  359
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L +  +
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETVKD  86



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN  359
            N+  DWLP GW VE++TR +G H GS YKCYI P  R KF+SK +V ++L +  +
Sbjct  32   NEHPDWLPDGWNVEVRTRKSGVHMGSGYKCYIEPLKRYKFFSKPEVLRYLETVKD  86



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            L  NT +  +WLP GW VE++TR TG H G  YKCYI PS    FYSK +V ++L + 
Sbjct  77   LVVNTTEYPEWLPKGWKVEVRTRKTGVHVGKEYKCYIDPSTESSFYSKPEVFRYLKTV  134



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 75/159 (47%), Gaps = 32/159 (20%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAAN  359
            +   TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +
Sbjct  77   ILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDH  136

Query  360  SNTPIsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSP  518
            SNT ++ +NK +  +       PQ       +  P++N    S KR   +D  +P     
Sbjct  137  SNT-VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFRE  193

Query  519  A---------------------VAAQDISADGLPAGWVK  572
                                  VA +  +AD LP GW+K
Sbjct  194  GISMTNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIK  232



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 75/159 (47%), Gaps = 32/159 (20%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAAN  359
            +   TN S  WLP GWT+E KTR +GS  GS YK Y    SG +FYS+A V+++LN+  +
Sbjct  78   ILDKTNDSPGWLPSGWTMEEKTRQSGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDH  137

Query  360  SNTPIsnenknnieesssnleVPQ-------NQTPKENQSRTSRKRKSVMDNQTPKTVSP  518
            SNT ++ +NK +  +       PQ       +  P++N    S KR   +D  +P     
Sbjct  138  SNT-VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNG--SFKRLDNVDEPSPDMFRE  194

Query  519  A---------------------VAAQDISADGLPAGWVK  572
                                  VA +  +AD LP GW+K
Sbjct  195  GISMTNTDHVPEKKKKSNSFETVAVESSAADDLPPGWIK  233



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 62/137 (45%), Gaps = 48/137 (35%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  14   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  68

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  521
                                     +T K N S TSR++K          V P       
Sbjct  69   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  92

Query  522  VAAQDISADGLPAGWVK  572
            V  +  +ADGLPAGW+K
Sbjct  93   VVIERSTADGLPAGWIK  109



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 62/137 (45%), Gaps = 48/137 (35%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  76   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  130

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  521
                                     +T K N S TSR++K          V P       
Sbjct  131  -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  154

Query  522  VAAQDISADGLPAGWVK  572
            V  +  +ADGLPAGW+K
Sbjct  155  VVIERSTADGLPAGWIK  171



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 62/137 (45%), Gaps = 48/137 (35%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  82

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  521
                                     +T K N S TSR++K          V P       
Sbjct  83   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  106

Query  522  VAAQDISADGLPAGWVK  572
            V  +  +ADGLPAGW+K
Sbjct  107  VVIERSTADGLPAGWIK  123



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 62/137 (45%), Gaps = 48/137 (35%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            L   T +  DWLP GW +ELKT+ +GS  G  YKCY+ PS G +FYSK  V ++L     
Sbjct  28   LGIKTKKFPDWLPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYL-----  82

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------  521
                                     +T K N S TSR++K          V P       
Sbjct  83   -------------------------KTIKHN-SCTSRQKK----------VGPGMPSLGK  106

Query  522  VAAQDISADGLPAGWVK  572
            V  +  +ADGLPAGW+K
Sbjct  107  VVIERSTADGLPAGWIK  123



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            +   T +S +WLP GW VELKTR +GS+ G  YK YI PS G KFYS+ +VS++L +
Sbjct  106  IVEETKKSPEWLPAGWIVELKTRKSGSNAGLAYKVYIDPSTGNKFYSRPEVSKYLKT  162



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 36/140 (26%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  46   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG--  103

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTV  512
                                 +P+N   K  +S         R+S  ++  +   T + +
Sbjct  104  ---------------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENL  142

Query  513  SPAVAAQDISADGLPAGWVK  572
               +   + + DGLP+GW+K
Sbjct  143  RSQI---EYTPDGLPSGWIK  159



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 36/140 (26%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            LA       DWLP GW +E KTR +G++ G  YKCYI P +G KFYSK +V +++     
Sbjct  72   LAEQIKDFPDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG--  129

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQS---------RTSRKRKSVMDNQTPKTV  512
                                 +P+N   K  +S         R+S  ++  +   T + +
Sbjct  130  ---------------------IPRNPRAKRKRSVVTRITEHTRSSTNQRKGIKRSTRENL  168

Query  513  SPAVAAQDISADGLPAGWVK  572
               +   + + DGLP+GW+K
Sbjct  169  RSQI---EYTPDGLPSGWIK  185



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 15/131 (11%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS--AANSNTPIs  377
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S      N   S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  378  nenknnieesssnleVPQ------NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  539
             +      E SS+  V +      N  PK +Q   SR RKS+  ++ PK V+   A ++ 
Sbjct  142  RQKDRGGSEHSSSKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE-  199

Query  540  SADGLPAGWVK  572
                LP+GW+K
Sbjct  200  ----LPSGWIK  206



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (54%), Gaps = 16/132 (12%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  362
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  363  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  536
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  537  ISADGLPAGWVK  572
                 LP+GW+K
Sbjct  201  -----LPSGWIK  207



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 5/51 (10%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            S DWLPPGW VE+K  STG      YKCYI PS G KFYSK +VS++LN A
Sbjct  6    SDDWLPPGWKVEMKLTSTGRK----YKCYIHPSRGLKFYSKPEVSRYLNKA  52



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (54%), Gaps = 16/132 (12%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS-------AANS  362
            S+WLP GW +E + R +G+  G+ YKC+I PS G K +SK +V ++L S       A +S
Sbjct  82   SEWLPSGWVMETRFRKSGARVGTEYKCFIDPSTGTKLFSKPEVLRYLGSEKTKQHNAESS  141

Query  363  NTPIsnenknnieesssnleVPQ--NQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQD  536
                   ++++  +   +    Q  N  PK +Q   SR RKS+  ++ PK V+   A ++
Sbjct  142  RQKDRGGSEHSSSKKVVDRLSAQKSNLEPKVSQISKSRVRKSI-SSEKPKVVTERTADEE  200

Query  537  ISADGLPAGWVK  572
                 LP+GW+K
Sbjct  201  -----LPSGWIK  207



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            L    N+  +WLP GW VELKTR +G  +G  YKCY+ PS G KFYSK  V ++L +
Sbjct  75   LIEYANERPEWLPNGWVVELKTRKSGDASGKVYKCYVDPSTGCKFYSKPAVVRYLET  131



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            L   TN+  +WLP GW VELK +++GS  G  YKCY+ PS G KFYSK +V + L +
Sbjct  3    LIEYTNERPEWLPHGWIVELKIKNSGSARGRKYKCYVEPSTGYKFYSKPEVFRHLET  59



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLN  347
            A N N+  +WLP  W +ELKTR +G   G  YK YI PS G +FYSK QV +FLN
Sbjct  78   AVNANERPEWLPKNWFMELKTRKSGVRIGKHYKIYIDPSTGSRFYSKLQVFRFLN  132


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (43%), Gaps = 38/131 (29%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            +    ++  +WLP  W  ELKT  +G+  G +YK Y+ PS G +F+S+ +V +FL+    
Sbjct  154  IVVKAHEHPEWLPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKG--  211

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  539
                                         E +S  S+ +K  + + +       V  +  
Sbjct  212  -----------------------------EQKSTKSKPKKRALCSTS------KVVTRKS  236

Query  540  SADGLPAGWVK  572
            + D LPAGW+K
Sbjct  237  TVDDLPAGWIK  247



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            +WLP GW VE+KTR +GS  G  YKCYI+PS G K YSK +V ++L+ 
Sbjct  29   EWLPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYLSC  76



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANS  362
            ++  +WLP GW +E++ R +G H GS YKCYI P  G KF+SK +V ++L +  +S
Sbjct  33   DEHPEWLPDGWNMEVRIRKSGLHMGSGYKCYIEPLKGYKFFSKPEVLRYLETVKDS  88



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW VELKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  102  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  161



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  96   DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  155



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            L   +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  75   LTVKSNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            S DWLP GW VE+KTR  GS  G  YKCYI+P +G + YSK  V ++L   A+
Sbjct  104  SPDWLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYLRYYAS  156



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            S DWLP GW VE+KTR  GS  G  YKCYI+P +G + YSK  V ++L   A+
Sbjct  104  SPDWLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSKRDVYRYLRYYAS  156



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            L  +  +  +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L + 
Sbjct  77   LEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTV  134



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  79   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  134



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            +N+  +WLP GW VE +TR +GS+ G+ YKCYI P +  +FYSK +V + L +  N
Sbjct  78   SNEHPEWLPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKN  133



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  192  NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            + N   DWLP GW V+LKTR +GS  G  YK YI P +G KF+S  +V + L S  N N+
Sbjct  125  DENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNS  184



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            L  +  +  +WLP GW VEL+TR +G   G  YKCYI PSG   FYSK +V ++L + 
Sbjct  77   LEVDPTECPEWLPNGWKVELRTRQSGVQVGKEYKCYIDPSGECTFYSKPEVFRYLKTV  134



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (47%), Gaps = 39/124 (31%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSG-RKFYSKAQVSQFLNSAANSNTPIsn  380
            S DWLP GW VE++ R TG  +    KCY+ PS  RKFYSK +V ++L     S  P+  
Sbjct  7    SDDWLPAGWKVEVRVRKTGKKD----KCYVDPSNERKFYSKPEVLRYLKDVGVSQ-PVHE  61

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
            E                     +N+S +SR             ++     ++ +A+GLPA
Sbjct  62   ET--------------------QNKSISSR-------------LAIKFVVKEEAAEGLPA  88

Query  561  GWVK  572
            GW+K
Sbjct  89   GWIK  92



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANS  362
            A   N+  DWLP GW +E++TR +G   GS YKCYI S +G KFYSK +V ++L +   +
Sbjct  29   AEKGNEWPDWLPDGWDMEVRTRKSGPLMGSGYKCYIDSLNGNKFYSKPEVLRYLETTKGN  88

Query  363  N  365
            N
Sbjct  89   N  89



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  371
            N S +WLP GW +E + R +G+  GS YK Y+ P +G KFYSK QV Q+L S   + +P
Sbjct  85   NSSLEWLPQGWIIESRYRKSGATAGSVYKTYVDPLTGSKFYSKPQVMQYLESVNFNASP  143



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 54/131 (41%), Gaps = 35/131 (27%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAAN  359
            L      S  WLP GW +E++TR  G+     YKCY+  S G  FYSK +V QF+ +   
Sbjct  72   LVHKVKDSLKWLPRGWIMEIRTRKIGAEAEERYKCYLHQSTGTVFYSKEEVLQFIEAGNA  131

Query  360  SNTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI  539
               P                              +SRKR+    N++   V   +   + 
Sbjct  132  CGPPT-----------------------------SSRKRRC--RNKSGDLVLYRI---EY  157

Query  540  SADGLPAGWVK  572
            S DGLP GW+K
Sbjct  158  SPDGLPDGWIK  168



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 54/130 (42%), Gaps = 38/130 (29%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANS  362
            A   N+  +WLP  W VE+KT  +G   G   K Y+ PS G +FYSK  V +FL  A   
Sbjct  82   AVKENECPEWLPKNWFVEVKTHKSGEFIGKRVKIYVDPSTGLRFYSKPAVFRFLKQAEQR  141

Query  363  NTPIsnenknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDIS  542
            N                       +T K+ Q+  SRK+               V  +  +
Sbjct  142  N----------------------RKTNKKKQAAYSRKK---------------VVIEKST  164

Query  543  ADGLPAGWVK  572
             D LPAGW+K
Sbjct  165  VDDLPAGWIK  174



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            + +NT +  +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L + 
Sbjct  75   VVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV  132



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            + +NT +  +WLP GW VEL+TR +G   G  YKCYI PS    FYSK +V + L + 
Sbjct  75   VVANTVEYPEWLPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRTV  132



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            +WLP GW VE++TR +G+  G  YK YI P +G KFYSK +V ++L +  +
Sbjct  86   EWLPKGWKVEVRTRKSGTLAGKEYKSYIDPLNGSKFYSKLEVLRYLKTVRH  136



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +3

Query  189  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSA-ANS  362
            S + QSSDWLPPGWT+E+KTR  G   G   K YI   +G+KF S+  V ++L    A+ 
Sbjct  101  SESGQSSDWLPPGWTIEIKTRKNGVSAGMREKFYIELATGKKFASRLAVLRYLTDGNASV  160

Query  363  NTP  371
            +TP
Sbjct  161  STP  163


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            Q  +WLPPGWT+E+K R +G   G   K YI P+ GR F S+  + +++ + 
Sbjct  652  QPPEWLPPGWTMEIKERKSGKSAGLREKYYIDPATGRSFRSRIAIVRYIEAG  703



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNS  350
            L      S DWLP GW +E +T+  G++ G   KCY +PS G +FYSK QV + LN+
Sbjct  25   LVREVKDSPDWLPSGWVLETRTQKNGAYAGREIKCYYNPSTGSRFYSKKQVFRHLNA  81



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +3

Query  198  NQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNS  350
            ++  +WLP GW +E++TR +G   GS YKCYI PS   KFYSK +V + L +
Sbjct  33   DEHPEWLPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTYKFYSKPEVLRHLET  84



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 54/124 (44%), Gaps = 36/124 (29%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  561  GWVK  572
            GW K
Sbjct  164  GWYK  167



>ref|XP_010934848.1| PREDICTED: uncharacterized protein LOC105054908 isoform X3 [Elaeis 
guineensis]
Length=638

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 54/124 (44%), Gaps = 36/124 (29%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S          
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG---------  129

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                            +  +P  +Q R         ++++P+ V   +A  +   DGLP 
Sbjct  130  ----------------KIYSPTSDQKRH-------CESESPEHV---IAQIEFYPDGLPD  163

Query  561  GWVK  572
            GW K
Sbjct  164  GWYK  167



>emb|CBI16127.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  371
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +      P
Sbjct  5    EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRKKP  62



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNT  368
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS  139



>ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29524.1| DNA binding protein, putative [Ricinus communis]
Length=234

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNT  368
            S++WLPPGW VE + R++G+  G+  K YI P +GR+F SK +V  FL +     T
Sbjct  96   SANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRRFRSKKEVQYFLETGTKKKT  151



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNT  368
            +WLP GW VEL+TR +G   G  YKCYI P     FYSK +V ++L +    N+
Sbjct  86   EWLPNGWKVELRTRQSGVQVGKEYKCYIDPFRECTFYSKPEVFRYLKTVKRKNS  139



>gb|KDP34493.1| hypothetical protein JCGZ_11043 [Jatropha curcas]
Length=237

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  183  LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            +A  + +S+ WLPPGW VE + R++G+  G+  K YI P +GRKF SK +V  +L + 
Sbjct  92   MAPGSAESASWLPPGWLVEDRVRTSGATAGTVDKYYIEPTTGRKFRSKREVQYYLETG  149



>ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
             S DWLP GW VE K RS+G+  GST + Y  P SGR+F SK +V  FL + 
Sbjct  70   MSMDWLPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLETG  121



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            +WLP GW VEL+ R +G+  G  YKCYI PS    FYSK +V ++L + 
Sbjct  86   EWLPNGWKVELRIRQSGAQVGREYKCYIDPSRECTFYSKPEVFRYLKTV  134



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (42%), Gaps = 39/124 (31%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            + DWLPPGW VE++ R  G  +     CY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQRRNGKKDKLRVMCYYAPCGELRFISRAEVSRYLDKCG--------  57

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  58   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  87

Query  561  GWVK  572
            GW+K
Sbjct  88   GWIK  91



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 53/124 (43%), Gaps = 43/124 (35%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            + DWLPPGW VE++ R     NG   KCY +P G  +F S+A+VS++L+           
Sbjct  6    TDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVSRYLDKCG--------  53

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                                      +T  K     +N + K  S  V  +  +A+GLP 
Sbjct  54   -------------------------CKTEEK-----ENGSGKQSSKNVTVEKAAAEGLPP  83

Query  561  GWVK  572
            GW+K
Sbjct  84   GWIK  87



>ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>ref|XP_010934849.1| PREDICTED: uncharacterized protein LOC105054908 isoform X4 [Elaeis 
guineensis]
Length=605

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S 
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG  129



>ref|XP_009364396.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=236

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  350
            +WLPPGW+V+ K RS+G   GST + Y  P SGR+F SK +V +FL +
Sbjct  100  NWLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET  147



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSA  353
            S  WLPPGW +E++T+  GS     YK Y  PS R +FYSK  V QF+ S 
Sbjct  79   SFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSG  129



>ref|XP_009353664.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=231

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL + 
Sbjct  91   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETG  144



>ref|XP_009345985.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL + 
Sbjct  94   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETG  147



>ref|XP_008357235.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Malus 
domestica]
Length=236

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  350
            +WLPPGW+V+ K RS+G   GST + Y  P SGR+F SK +V +FL +
Sbjct  100  NWLPPGWSVQEKVRSSGLTAGSTDRYYFDPVSGRRFRSKIEVLRFLET  147



>ref|XP_011042705.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Populus euphratica]
Length=214

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  186  ASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            +S T   + WLPPGW VE + R++G+  G+  K YI P SGRKF SK  V  +L + 
Sbjct  64   SSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG  120



>ref|XP_009345984.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            T+    WLP GW+V+ K RS+G+  GST + YI P SGR+F SK +V +FL + 
Sbjct  94   TDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETG  147



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_003632148.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Vitis vinifera]
Length=297

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTP  371
            +  DWLPPGW VE + RS+G+  GS  K +I P +GR+F SK +V  +L +      P
Sbjct  167  EREDWLPPGWIVEGRVRSSGASAGSRDKYFIEPITGRRFRSKKEVRYYLETGEVRKKP  224



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>emb|CDP06874.1| unnamed protein product [Coffea canephora]
Length=254

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAA  356
            DWLP  W +E++ R++G+  G++ + + SPSG KF SK +V +FL + +
Sbjct  98   DWLPDDWKIEVRVRTSGATAGTSDRYFFSPSGLKFRSKVEVLEFLETGS  146



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 57/130 (44%), Gaps = 52/130 (40%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSAANSNTPIsn  380
            S DW+P GWTV++K     + NG   KCY+ PS G +FYSK  V ++L            
Sbjct  5    SPDWIPEGWTVQVKL----AKNGRNVKCYLDPSTGYRFYSKPDVFRYL------------  48

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPA------VAAQDIS  542
                              +T K N S TSR++K          V P       V  +  +
Sbjct  49   ------------------KTIKHN-SCTSRQKK----------VGPGMPSLGKVVIERST  79

Query  543  ADGLPAGWVK  572
            ADGLPAGW+K
Sbjct  80   ADGLPAGWIK  89



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            +S DWLP GWTVE+K R+ G  +   Y    S SG KF SKA+VS++LN++  S+
Sbjct  5    KSEDWLPTGWTVEVKVRNNGKRDKYYYD---SASGHKFNSKAEVSRYLNTSQISD  56



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            S  WLPPGW +E++T+  GS     Y  Y  PS G +FYSK  V QF+ S 
Sbjct  79   SFKWLPPGWLLEIRTQRRGSKAQQIYMSYFEPSTGSRFYSKGDVLQFVKSG  129



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 52/124 (42%), Gaps = 43/124 (35%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L +          
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYAPCGELRFISRAEVVRYLKNCG--------  53

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                                     S+T  K K V   Q+ K V+     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNVT----VEKAEAEGLPP  83

Query  561  GWVK  572
            GW K
Sbjct  84   GWTK  87



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            S T   + WLPPGW VE + R++G+  G+  K YI P SGR+F SK  V  +L + 
Sbjct  65   SETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG  120



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +3

Query  189  SNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            S T   + WLPPGW VE + RS+G+  G+  K Y  P SGR+F SK  V  +L + 
Sbjct  53   SETAVDTSWLPPGWIVEDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLETG  108



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 51/124 (41%), Gaps = 43/124 (35%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNTPIsn  380
            S DWLPPGW VE++ R     NG   KCY +P G  +F S+A+V ++L            
Sbjct  6    SDDWLPPGWKVEVRQR----RNGKKDKCYYTPCGELRFISRAEVVRYLEKCG--------  53

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                                     S+T  K K V   Q+ K ++     +   A+GLP 
Sbjct  54   -------------------------SKTEEKEK-VPSKQSSKNIT----VEKAEAEGLPP  83

Query  561  GWVK  572
            GW K
Sbjct  84   GWTK  87



>ref|XP_008223622.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Prunus mume]
Length=244

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            +WLP GW+VE + R++G+  GST + Y+ P SGR+F SK +V  FL + 
Sbjct  106  NWLPQGWSVEERVRASGATAGSTDRYYVDPVSGRRFRSKVEVLYFLETG  154



>gb|KHF99779.1| Methyl-CpG-binding domain-containing 6 -like protein [Gossypium 
arboreum]
Length=219

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            WLPPGW +E + R++G+  G   K Y+ P SGRKF SK +V  FL + +
Sbjct  77   WLPPGWLIEDRVRTSGATAGLVDKYYVDPTSGRKFRSKKEVLYFLENGS  125



>emb|CDY33033.1| BnaA10g12390D [Brassica napus]
Length=541

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  347
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF SK +V  +L 
Sbjct  387  SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSKTEVLYYLE  434



>gb|KJB83777.1| hypothetical protein B456_013G263700 [Gossypium raimondii]
Length=219

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            WLPPGW +E + R++G+  G   K Y+ P SGRKF SK +V  FL + +
Sbjct  77   WLPPGWLIEDRVRTSGATAGLVDKYYVDPTSGRKFRSKKEVLYFLENGS  125



>ref|XP_010106481.1| Methyl-CpG-binding domain-containing protein 6 [Morus notabilis]
 gb|EXC10657.1| Methyl-CpG-binding domain-containing protein 6 [Morus notabilis]
Length=237

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            DWLP GWTVE K RS+G+  GS  + Y  P SG KF SK +V  FL + 
Sbjct  95   DWLPRGWTVEDKVRSSGATAGSKDRYYFDPVSGLKFRSKKEVLYFLETG  143



>ref|XP_009126698.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like 
[Brassica rapa]
Length=229

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKVRASGAKAGSVDKYYLEPITGRKFRSRTEVLYYL  131



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 39/123 (32%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNTPIsne  383
            S +WLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L++           
Sbjct  174  SEEWLPAGWTVEVKVRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLST-----------  219

Query  384  nknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAG  563
                                    S+TSR+ K  ++ +T K  S  V  +   A+ LP G
Sbjct  220  ------------------------SKTSREDKQKIE-ETLKRPSDDVVVEKTVAERLPPG  254

Query  564  WVK  572
            W+K
Sbjct  255  WIK  257



>emb|CDY53445.1| BnaA02g07070D [Brassica napus]
Length=229

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKVRASGAKAGSVDKYYLEPITGRKFRSRTEVLYYL  131



>ref|XP_006400967.1| hypothetical protein EUTSA_v10014530mg [Eutrema salsugineum]
 gb|ESQ42420.1| hypothetical protein EUTSA_v10014530mg [Eutrema salsugineum]
Length=241

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  97   SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSRTEVLYYL  143



>ref|XP_010541401.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
isoform X1 [Tarenaya hassleriana]
Length=223

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            WLPPGW VE + R++G+  GS  K Y  P +GRKF SK +V  +L   A
Sbjct  80   WLPPGWRVEDRVRTSGATAGSVDKYYHEPGTGRKFRSKTEVMYYLEKGA  128



>gb|KHN35006.1| hypothetical protein glysoja_004772 [Glycine soja]
Length=188

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 64/154 (42%), Gaps = 39/154 (25%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNG----------------------------STYKCY  290
            +N+  +WLP  W V+ +TR +G++ G                                CY
Sbjct  28   SNEHPEWLPDDWNVDFRTRKSGANMGHGQSKGPLAKCSILRLFMAGTSQGHPQICIEYCY  87

Query  291  ISPSGRKFYSKAQVSQFLNSA-ANSNTPIsnenknnieesssnleVPQNQTPKENQSRTS  467
            I+PSG KFYSK +V ++L++   NSN+  S + K      +      ++  P   Q +  
Sbjct  88   IAPSGHKFYSKPEVLRYLDTVNINSNSHTSKKEKICKSNDTVEKSTIEDLPP--GQIKEV  145

Query  468  RKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  569
            + RK   DN+     SP         + LP GW+
Sbjct  146  KIRKGSNDNRDVVEKSP--------VEDLPPGWI  171



>ref|XP_010541402.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
isoform X2 [Tarenaya hassleriana]
Length=222

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            WLPPGW VE + R++G+  GS  K Y  P +GRKF SK +V  +L   A
Sbjct  80   WLPPGWRVEDRVRTSGATAGSVDKYYHEPGTGRKFRSKTEVMYYLEKGA  128



>emb|CDY59223.1| BnaCnng34510D [Brassica napus]
Length=229

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKVRASGATAGSVDKYYLEPITGRKFRSRTEVLYYL  131



>emb|CDY48687.1| BnaC02g09990D [Brassica napus]
Length=229

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y+ P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKVRASGATAGSVDKYYLEPITGRKFRSRTEVLYYL  131



>emb|CDX80274.1| BnaC09g34680D [Brassica napus]
Length=549

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  347
            S+WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L 
Sbjct  394  SNWLPPGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSRTEVLYYLE  441



>gb|KFK27467.1| hypothetical protein AALP_AA8G387100 [Arabis alpina]
Length=205

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFL  344
            WLPPGW +E K R++G+  G   + Y SP G KF SK +V  +L
Sbjct  52   WLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSKTEVLHYL  95



>gb|KFK27470.1| hypothetical protein AALP_AA8G387500 [Arabis alpina]
Length=226

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFL  344
            WLPPGW +E K R++G+  G   + Y SP G KF SK +V  +L
Sbjct  79   WLPPGWRIEDKVRTSGATAGIRDRYYYSPGGHKFRSKTEVLHYL  122



>ref|XP_007514055.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15492.1| predicted protein [Bathycoccus prasinos]
Length=872

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  216  LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN  359
            L PGW V ++TR +G+  G T K Y SP GRK  SK +V +FL+S  +
Sbjct  23   LAPGWRVAIETRKSGATKGGTDKYYFSPDGRKLRSKTEVMRFLSSTTS  70



>ref|XP_009371320.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Pyrus x bretschneideri]
Length=572

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED  56



>ref|NP_200746.1| methyl-CpG-binding domain-containing protein 6 [Arabidopsis thaliana]
 sp|Q9LTJ1.1|MBD6_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 6; 
Short=AtMBD6; Short=MBD06; AltName: Full=Methyl-CpG-binding 
protein MBD6 [Arabidopsis thaliana]
 dbj|BAA97474.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42852.1| At5g59380 [Arabidopsis thaliana]
 dbj|BAE99559.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97178.1| methyl-CpG-binding domain-containing protein 6 [Arabidopsis thaliana]
Length=225

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  80   WLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYL  124



>ref|XP_009604783.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Nicotiana tomentosiformis]
Length=251

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            T++   WLP  W +E++ R++G+  GST + +  P SGRKF SK +V  FL +  
Sbjct  107  TSERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSKVEVLYFLETGG  161



>ref|XP_008376557.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Malus 
domestica]
Length=574

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +
Sbjct  6    SEDWLPTGWTVEVKFRKNGKRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED  56



>ref|XP_009371318.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN  365
            S DWLP GWTVE+K R  G  +   Y+   S SG +F S+A+VS++L+++++ +
Sbjct  6    SEDWLPTGWTVEVKFRKNGRRDKYYYE---SSSGHRFSSRAEVSRYLSTSSHED  56



>ref|XP_009787915.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Nicotiana sylvestris]
Length=251

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  195  TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            T++   WLP  W +E++ R++G+  GST + +  P SGRKF SK +V  FL +  
Sbjct  107  TSERPSWLPENWKIEMRVRTSGATAGSTDRYFFEPVSGRKFRSKVEVLYFLETGG  161



>ref|XP_002864630.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40889.1| hypothetical protein ARALYDRAFT_919168 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct  87   WLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYL  131



>ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like 
[Cucumis sativus]
Length=206

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            WLPPGW VE + RS+G+  G+  K Y  P S R+F SK +V  FL + 
Sbjct  143  WLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG  190



>ref|XP_007016409.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOY34028.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma 
cacao]
Length=232

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  350
            WLP GW VE + R++G+  G+  K Y+ P SGRKF SK +V  F+ +
Sbjct  71   WLPAGWLVEDRVRTSGATAGTVDKYYVDPSSGRKFRSKKEVLYFIET  117



>ref|XP_007016410.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma 
cacao]
 gb|EOY34029.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma 
cacao]
Length=212

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNS  350
            WLP GW VE + R++G+  G+  K Y+ P SGRKF SK +V  F+ +
Sbjct  71   WLPAGWLVEDRVRTSGATAGTVDKYYVDPSSGRKFRSKKEVLYFIET  117



>ref|XP_003549104.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Glycine max]
Length=546

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 51/121 (42%), Gaps = 49/121 (40%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsnenk  389
            WLPPGWTVE++ R     NG   K Y  P SG KF SK +V ++L++A            
Sbjct  9    WLPPGWTVEVRVR----KNGKRDKYYFPPSSGLKFNSKVEVFRYLDNA------------  52

Query  390  nnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV  569
                                 Q++ S ++           +SP V  +   A+GLP GWV
Sbjct  53   ---------------------QNKVSIQK-----------ISPNVIVEKAIAEGLPPGWV  80

Query  570  K  572
            K
Sbjct  81   K  81



>ref|XP_008457481.1| PREDICTED: methyl-CpG-binding domain-containing protein 5 [Cucumis 
melo]
Length=280

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            WLPPGW VE + RS+G+  G+  K Y  P S R+F SK +V  FL + 
Sbjct  145  WLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG  192



>gb|KGN65724.1| hypothetical protein Csa_1G522010 [Cucumis sativus]
Length=278

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSA  353
            WLPPGW VE + RS+G+  G+  K Y  P S R+F SK +V  FL + 
Sbjct  143  WLPPGWVVEDRVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG  190



>ref|XP_011012359.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_011030071.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_009121317.1| PREDICTED: methyl-CpG-binding domain-containing protein 6, partial 
[Brassica rapa]
Length=232

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  207  SDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL  344
            S+WLP GW VE K R++G+  GS  K Y  P +GRKF SK +V  +L
Sbjct  78   SNWLPSGWRVEDKVRTSGATAGSVDKYYYEPITGRKFRSKTEVLYYL  124



>ref|XP_011012358.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_011012360.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_011030070.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_011030072.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = +3

Query  201  QSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPS-GRKFYSKAQVSQFLNSA  353
            +S DWLP GW VE+K R    +NG   K Y  PS G +F SK +VS++LNS+
Sbjct  5    KSDDWLPEGWRVEVKVR----NNGKKDKFYFPPSGGCRFNSKIEVSRYLNSS  52



>ref|XP_007152298.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
 gb|ESW24292.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
Length=579

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 49/124 (40%), Gaps = 49/124 (40%)
 Frame = +3

Query  204  SSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIsn  380
            S D LPPGWTVE+K R     NG   K Y  P SG KF SK +V ++L++A N       
Sbjct  6    SDDQLPPGWTVEVKVRK----NGKRDKYYFLPSSGLKFNSKVEVYRYLDNANN-------  54

Query  381  enknnieesssnleVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPA  560
                                                   + + +SP V  +   A+GLP 
Sbjct  55   -------------------------------------KVSIQKISPNVVVEKAIAEGLPP  77

Query  561  GWVK  572
            GWVK
Sbjct  78   GWVK  81



>gb|KHN31504.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=590

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 5/50 (10%)
 Frame = +3

Query  213  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAAN  359
            WLPPGWTVE++ R     NG   K Y  P SG KF SK +V ++L++A N
Sbjct  9    WLPPGWTVEVRVR----KNGKRDKYYFPPSSGLKFNSKVEVFRYLDNAQN  54



>gb|KFK33990.1| hypothetical protein AALP_AA5G087600 [Arabis alpina]
Length=183

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLN  347
            +WLPPGWT + K R++G+  G+  K Y  P +GRKF SK +V  ++ 
Sbjct  33   NWLPPGWTTQEKVRTSGTKAGTVDKFYYEPVTGRKFRSKTEVMYYVE  79



>ref|XP_002875791.1| hypothetical protein ARALYDRAFT_485028 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52050.1| hypothetical protein ARALYDRAFT_485028 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +3

Query  210  DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA  356
            +WLPP W  E++ R++G+  G+  K Y  P +GRKF SK +V  +L   A
Sbjct  33   NWLPPDWRTEVRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHGA  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515