BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS124E01

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343041.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    162   4e-43   Solanum tuberosum [potatoes]
ref|XP_004235645.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    158   1e-41   Solanum lycopersicum
ref|XP_010318529.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    158   1e-41   
ref|XP_009771112.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    155   8e-41   Nicotiana sylvestris
gb|EYU45830.1|  hypothetical protein MIMGU_mgv1a002611mg                155   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_011080458.1|  PREDICTED: NADP-dependent malic enzyme-like        154   3e-40   Sesamum indicum [beniseed]
ref|XP_009772764.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    154   3e-40   Nicotiana sylvestris
gb|ABI98682.2|  chloroplast NADP-malic enzyme precursor                 154   3e-40   Nicotiana tabacum [American tobacco]
ref|XP_009626739.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    154   3e-40   Nicotiana tomentosiformis
ref|XP_006359476.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    149   2e-38   Solanum tuberosum [potatoes]
ref|NP_001234458.1|  NADP-dependent malic enzyme, chloroplastic         145   4e-37   
emb|CDO97978.1|  unnamed protein product                                145   6e-37   Coffea canephora [robusta coffee]
ref|XP_009591013.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    144   1e-36   Nicotiana tomentosiformis
ref|XP_011072428.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    130   2e-31   Sesamum indicum [beniseed]
ref|XP_010098139.1|  NADP-dependent malic enzyme                        121   2e-28   
ref|XP_007216984.1|  hypothetical protein PRUPE_ppa002714mg             119   1e-27   Prunus persica
ref|XP_008228427.1|  PREDICTED: NADP-dependent malic enzyme             119   1e-27   Prunus mume [ume]
ref|XP_010267161.1|  PREDICTED: NADP-dependent malic enzyme-like ...    119   2e-27   Nelumbo nucifera [Indian lotus]
gb|AFR54473.1|  cytosolic NADP-malic protein                            117   5e-27   Prunus armeniaca
ref|XP_010267160.1|  PREDICTED: NADP-dependent malic enzyme-like ...    116   1e-26   Nelumbo nucifera [Indian lotus]
gb|ADU20198.1|  NADP-dependent malic enzyme                             116   1e-26   Pyrus pyrifolia [sha li]
ref|XP_009342530.1|  PREDICTED: NADP-dependent malic enzyme-like        116   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009353550.1|  PREDICTED: NADP-dependent malic enzyme             115   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_009348545.1|  PREDICTED: NADP-dependent malic enzyme-like        114   5e-26   Pyrus x bretschneideri [bai li]
gb|AHA11552.1|  NADP-malic enzyme                                       110   2e-24   Malus domestica [apple tree]
ref|NP_001268030.1|  malate dehydrogenase                               109   3e-24   Vitis vinifera
emb|CBI36068.3|  unnamed protein product                                109   4e-24   Vitis vinifera
emb|CAN69517.1|  hypothetical protein VITISV_024155                     109   4e-24   Vitis vinifera
ref|XP_007150609.1|  hypothetical protein PHAVU_005G166400g             108   7e-24   Phaseolus vulgaris [French bean]
ref|XP_008353539.1|  PREDICTED: NADP-dependent malic enzyme-like        107   2e-23   
gb|ABB86962.1|  cytosolic NADP-malic enzyme                             107   2e-23   Malus domestica [apple tree]
gb|KDP40863.1|  hypothetical protein JCGZ_24862                         107   3e-23   Jatropha curcas
ref|XP_003546557.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    107   3e-23   Glycine max [soybeans]
gb|KHM98720.1|  NADP-dependent malic enzyme, chloroplastic              107   3e-23   Glycine soja [wild soybean]
ref|XP_004302862.1|  PREDICTED: LOW QUALITY PROTEIN: NADP-depende...    106   4e-23   Fragaria vesca subsp. vesca
gb|KCW53678.1|  hypothetical protein EUGRSUZ_J02940                     104   1e-22   Eucalyptus grandis [rose gum]
gb|KCW53676.1|  hypothetical protein EUGRSUZ_J02940                     104   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010033838.1|  PREDICTED: NADP-dependent malic enzyme             104   2e-22   Eucalyptus grandis [rose gum]
gb|EYU21512.1|  hypothetical protein MIMGU_mgv1a002703mg                102   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_008352329.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  99.8    2e-21   
ref|XP_010267163.1|  PREDICTED: NADP-dependent malic enzyme-like ...    101   3e-21   Nelumbo nucifera [Indian lotus]
gb|EPS63115.1|  hypothetical protein M569_11673                       97.1    6e-21   Genlisea aurea
gb|AAF73006.1|AF262997_1  NADP-dependent malic protein                  100   7e-21   Ricinus communis
ref|XP_002515967.1|  malic enzyme, putative                             100   7e-21   
ref|XP_008361292.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  97.4    9e-21   
ref|XP_003543623.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  99.4    2e-20   Glycine max [soybeans]
ref|XP_010665912.1|  PREDICTED: NADP-dependent malic enzyme           98.2    3e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AAW56450.1|  chloroplast NADP-dependent malic enzyme precursor     97.8    4e-20   Flaveria bidentis
sp|P22178.1|MAOC_FLATR  RecName: Full=NADP-dependent malic enzyme...  97.4    6e-20   Flaveria trinervia
prf||1701292A  NADP dependent malic enzyme                            97.4    6e-20
ref|XP_008810493.1|  PREDICTED: NADP-dependent malic enzyme           97.4    7e-20   Phoenix dactylifera
sp|P36444.1|MAOC_FLAPR  RecName: Full=NADP-dependent malic enzyme...  95.9    2e-19   Flaveria pringlei
gb|AFM08812.1|  NADP-dependent malic protein                          94.7    5e-19   Dimocarpus longan [longan]
gb|KFK42380.1|  hypothetical protein AALP_AA2G248700                  94.7    6e-19   Arabis alpina [alpine rockcress]
ref|XP_010325074.1|  PREDICTED: NADP-dependent malic enzyme-like ...  93.6    1e-18   Solanum lycopersicum
ref|XP_006301745.1|  hypothetical protein CARUB_v10022207mg           92.8    2e-18   Capsella rubella
sp|P34105.3|MAOX_POPTR  RecName: Full=NADP-dependent malic enzyme...  92.0    4e-18   Populus trichocarpa [western balsam poplar]
prf||1803524A  malic enzyme                                           92.0    4e-18
ref|XP_011007124.1|  PREDICTED: NADP-dependent malic enzyme           92.0    4e-18   Populus euphratica
ref|XP_006853670.1|  hypothetical protein AMTR_s00056p00119870        91.7    6e-18   
ref|XP_011010431.1|  PREDICTED: NADP-dependent malic enzyme-like      91.7    6e-18   Populus euphratica
gb|KDO51778.1|  hypothetical protein CISIN_1g006454mg                 90.5    7e-18   Citrus sinensis [apfelsine]
ref|XP_002887860.1|  NADP-malic enzyme 4                              91.7    7e-18   Arabidopsis lyrata subsp. lyrata
gb|KDO51777.1|  hypothetical protein CISIN_1g006454mg                 90.5    1e-17   Citrus sinensis [apfelsine]
gb|KDO51773.1|  hypothetical protein CISIN_1g006454mg                 90.5    2e-17   Citrus sinensis [apfelsine]
gb|KDO51776.1|  hypothetical protein CISIN_1g006454mg                 90.5    2e-17   Citrus sinensis [apfelsine]
gb|AAB17593.1|  NADP-malic enzyme                                     84.7    2e-17   Flaveria bidentis
gb|KDO51774.1|  hypothetical protein CISIN_1g006454mg                 90.5    2e-17   Citrus sinensis [apfelsine]
ref|XP_006426882.1|  hypothetical protein CICLE_v10025125mg           90.5    2e-17   Citrus clementina [clementine]
gb|AEK25136.1|  NADP-dependent malic enzyme                           89.7    3e-17   Hylocereus undatus [dragon fruit]
ref|XP_010473033.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  89.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010325075.1|  PREDICTED: NADP-dependent malic enzyme-like ...  89.4    4e-17   Solanum lycopersicum
ref|XP_007015740.1|  NADP-malic enzyme 4 isoform 2                    88.6    6e-17   
ref|XP_004486781.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  88.6    7e-17   Cicer arietinum [garbanzo]
ref|XP_007015741.1|  NADP-malic enzyme 4 isoform 3                    88.6    7e-17   
ref|XP_007015739.1|  NADP-malic enzyme 4 isoform 1                    88.6    8e-17   Theobroma cacao [chocolate]
ref|XP_010417798.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  88.2    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007216983.1|  hypothetical protein PRUPE_ppa002714mg           88.2    9e-17   
ref|XP_010249514.1|  PREDICTED: NADP-dependent malic enzyme           88.2    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006364722.1|  PREDICTED: NADP-dependent malic enzyme-like      87.8    1e-16   Solanum tuberosum [potatoes]
ref|NP_178093.1|  NADP-malic enzyme 4                                 87.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510309.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  87.8    1e-16   Cicer arietinum [garbanzo]
gb|AAF68116.1|AC010793_11  F20B17.18                                  87.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324450.1|  hypothetical protein POPTR_0018s09380g           87.4    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007018504.1|  NADP-dependent malic enzyme                      87.4    1e-16   
ref|XP_010915357.1|  PREDICTED: NADP-dependent malic enzyme isofo...  87.4    2e-16   Elaeis guineensis
gb|KDO66544.1|  hypothetical protein CISIN_1g007703mg                 86.3    2e-16   Citrus sinensis [apfelsine]
emb|CBI28009.3|  unnamed protein product                              87.0    2e-16   Vitis vinifera
ref|NP_001268142.1|  NADP-dependent malic enzyme                      87.0    2e-16   Vitis vinifera
ref|XP_006451274.1|  hypothetical protein CICLE_v10007810mg           86.3    3e-16   
ref|XP_004135668.1|  PREDICTED: NADP-dependent malic enzyme-like      86.7    3e-16   Cucumis sativus [cucumbers]
ref|XP_008450776.1|  PREDICTED: NADP-dependent malic enzyme           86.7    3e-16   Cucumis melo [Oriental melon]
ref|XP_009801542.1|  PREDICTED: NADP-dependent malic enzyme-like ...  86.7    4e-16   Nicotiana sylvestris
gb|KDO66539.1|  hypothetical protein CISIN_1g007703mg                 85.9    4e-16   Citrus sinensis [apfelsine]
ref|XP_010915364.1|  PREDICTED: NADP-dependent malic enzyme isofo...  86.3    4e-16   Elaeis guineensis
gb|KDO66538.1|  hypothetical protein CISIN_1g007703mg                 85.9    4e-16   Citrus sinensis [apfelsine]
gb|KDO66541.1|  hypothetical protein CISIN_1g007703mg                 85.9    4e-16   Citrus sinensis [apfelsine]
ref|XP_004287468.2|  PREDICTED: NADP-dependent malic enzyme           86.3    4e-16   Fragaria vesca subsp. vesca
gb|KDO66536.1|  hypothetical protein CISIN_1g007703mg                 86.3    4e-16   Citrus sinensis [apfelsine]
ref|XP_006451273.1|  hypothetical protein CICLE_v10007810mg           86.3    4e-16   Citrus clementina [clementine]
gb|KDO66532.1|  hypothetical protein CISIN_1g007703mg                 86.3    4e-16   Citrus sinensis [apfelsine]
gb|KDO66535.1|  hypothetical protein CISIN_1g007703mg                 85.9    4e-16   Citrus sinensis [apfelsine]
ref|XP_009616523.1|  PREDICTED: NADP-dependent malic enzyme-like ...  86.3    4e-16   Nicotiana tomentosiformis
ref|XP_009801541.1|  PREDICTED: NADP-dependent malic enzyme-like ...  86.3    5e-16   Nicotiana sylvestris
gb|ABS32243.1|  NADP-malic enzyme                                     85.9    6e-16   Flaveria trinervia
ref|XP_006389736.1|  hypothetical protein EUTSA_v10018247mg           85.5    7e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002298241.2|  malate oxidoreductase family protein             85.5    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010095359.1|  NADP-dependent malic enzyme                      85.9    9e-16   
ref|XP_008242501.1|  PREDICTED: NADP-dependent malic enzyme           84.7    2e-15   Prunus mume [ume]
ref|XP_003597680.1|  Malic enzyme                                     84.0    2e-15   
ref|XP_002514230.1|  malic enzyme, putative                           84.0    2e-15   Ricinus communis
ref|XP_002303310.2|  malate oxidoreductase family protein             84.0    2e-15   
ref|XP_008447551.1|  PREDICTED: NADP-dependent malic enzyme           84.0    3e-15   Cucumis melo [Oriental melon]
gb|KEH39548.1|  NADP-dependent malic enzyme-like protein              84.0    3e-15   Medicago truncatula
gb|AES67931.2|  NADP-dependent malic enzyme-like protein              84.0    3e-15   Medicago truncatula
dbj|BAJ51944.1|  NADP-dependent malic enzyme                          83.6    3e-15   Nicotiana benthamiana
gb|AAK83073.1|AF288920_1  putative cytosolic NADP-malic enzyme        83.6    3e-15   Flaveria pringlei
ref|XP_007160295.1|  hypothetical protein PHAVU_002G309600g           84.0    3e-15   Phaseolus vulgaris [French bean]
gb|KEH39546.1|  NADP-dependent malic enzyme-like protein              84.0    3e-15   Medicago truncatula
ref|XP_009373433.1|  PREDICTED: NADP-dependent malic enzyme-like      80.9    3e-15   
gb|KEH39547.1|  NADP-dependent malic enzyme-like protein              83.6    3e-15   Medicago truncatula
ref|XP_004503480.1|  PREDICTED: NADP-dependent malic enzyme-like      83.6    3e-15   Cicer arietinum [garbanzo]
ref|XP_009801543.1|  PREDICTED: NADP-dependent malic enzyme-like ...  83.6    4e-15   Nicotiana sylvestris
gb|KDP33810.1|  hypothetical protein JCGZ_07381                       83.2    4e-15   Jatropha curcas
ref|XP_009616524.1|  PREDICTED: NADP-dependent malic enzyme-like ...  83.2    4e-15   Nicotiana tomentosiformis
ref|XP_010430068.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  83.2    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011092518.1|  PREDICTED: NADP-dependent malic enzyme-like ...  83.2    5e-15   Sesamum indicum [beniseed]
gb|KJB06731.1|  hypothetical protein B456_001G008900                  82.8    6e-15   Gossypium raimondii
ref|XP_010648278.1|  PREDICTED: NADP-dependent malic enzyme isofo...  82.8    6e-15   Vitis vinifera
ref|XP_004150784.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  82.8    7e-15   Cucumis sativus [cucumbers]
gb|ABS32242.1|  NADP-malic enzyme                                     82.8    7e-15   Flaveria floridana
ref|XP_008362959.1|  PREDICTED: NADP-dependent malic enzyme           82.4    9e-15   
ref|XP_007222062.1|  hypothetical protein PRUPE_ppa003210mg           82.4    9e-15   
ref|XP_011093633.1|  PREDICTED: NADP-dependent malic enzyme           82.0    9e-15   Sesamum indicum [beniseed]
ref|XP_006580482.1|  PREDICTED: NADP-dependent malic enzyme-like ...  82.0    9e-15   Glycine max [soybeans]
ref|XP_003533042.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  82.4    1e-14   Glycine max [soybeans]
gb|ABK94851.1|  unknown                                               82.4    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_003525285.1|  PREDICTED: NADP-dependent malic enzyme-like ...  82.0    1e-14   Glycine max [soybeans]
gb|KHN41665.1|  NADP-dependent malic enzyme                           82.0    1e-14   Glycine soja [wild soybean]
emb|CDP08185.1|  unnamed protein product                              82.0    1e-14   Coffea canephora [robusta coffee]
ref|XP_004969796.1|  PREDICTED: NADP-dependent malic enzyme-like ...  82.0    1e-14   Setaria italica
ref|XP_007152912.1|  hypothetical protein PHAVU_004G170800g           81.6    1e-14   Phaseolus vulgaris [French bean]
gb|AAK83074.1|AF288921_1  putative cytosolic NADP-malic enzyme        81.6    1e-14   Flaveria pringlei
ref|XP_009779848.1|  PREDICTED: NADP-dependent malic enzyme           81.6    2e-14   Nicotiana sylvestris
gb|KHN16969.1|  NADP-dependent malic enzyme                           81.6    2e-14   Glycine soja [wild soybean]
ref|XP_003547744.1|  PREDICTED: NADP-dependent malic enzyme-like      81.3    2e-14   Glycine max [soybeans]
gb|ABI98681.2|  cytosolic NADP-malic enzyme                           81.3    2e-14   Nicotiana tabacum [American tobacco]
ref|XP_009614468.1|  PREDICTED: NADP-dependent malic enzyme-like      81.3    2e-14   Nicotiana tomentosiformis
ref|XP_011078255.1|  PREDICTED: NADP-dependent malic enzyme-like      81.3    2e-14   Sesamum indicum [beniseed]
ref|XP_010915394.1|  PREDICTED: NADP-dependent malic enzyme-like      81.3    2e-14   Elaeis guineensis
gb|KHN40389.1|  NADP-dependent malic enzyme                           81.3    2e-14   Glycine soja [wild soybean]
ref|XP_006389737.1|  hypothetical protein EUTSA_v10018247mg           81.3    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009352546.1|  PREDICTED: NADP-dependent malic enzyme           81.3    2e-14   
ref|XP_003516804.1|  PREDICTED: NADP-dependent malic enzyme-like      80.9    2e-14   Glycine max [soybeans]
gb|EYU27276.1|  hypothetical protein MIMGU_mgv1a003339mg              80.9    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_011081064.1|  PREDICTED: NADP-dependent malic enzyme-like      80.9    2e-14   Sesamum indicum [beniseed]
ref|XP_003630727.1|  Malic enzyme                                     80.9    3e-14   Medicago truncatula
ref|XP_008337596.1|  PREDICTED: NADP-dependent malic enzyme           80.9    3e-14   Malus domestica [apple tree]
gb|AGJ76631.1|  NADP-malic enzyme 1                                   80.9    3e-14   Echinochloa crus-galli var. crus-galli
ref|XP_007204216.1|  hypothetical protein PRUPE_ppa003142mg           80.5    3e-14   
ref|XP_010062528.1|  PREDICTED: NADP-dependent malic enzyme isofo...  80.9    3e-14   Eucalyptus grandis [rose gum]
gb|AFK40116.1|  unknown                                               80.5    3e-14   Medicago truncatula
ref|XP_007135635.1|  hypothetical protein PHAVU_010G145500g           80.9    3e-14   Phaseolus vulgaris [French bean]
ref|XP_007204214.1|  hypothetical protein PRUPE_ppa003142mg           80.1    3e-14   
gb|ABV72704.1|  non-C4 NADP-dependent malic enzyme                    80.5    3e-14   Flaveria trinervia
ref|XP_007204217.1|  hypothetical protein PRUPE_ppa003142mg           80.5    4e-14   
ref|XP_007204218.1|  hypothetical protein PRUPE_ppa003142mg           80.5    4e-14   
gb|KJB18587.1|  hypothetical protein B456_003G061800                  80.1    5e-14   Gossypium raimondii
gb|AIR93779.1|  chloroplast NADP-malic enzyme                         80.1    5e-14   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KJB18586.1|  hypothetical protein B456_003G061800                  80.1    5e-14   Gossypium raimondii
ref|XP_009367432.1|  PREDICTED: NADP-dependent malic enzyme isofo...  79.7    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_009367431.1|  PREDICTED: NADP-dependent malic enzyme isofo...  80.1    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_010062530.1|  PREDICTED: NADP-dependent malic enzyme isofo...  79.7    7e-14   Eucalyptus grandis [rose gum]
ref|XP_008361018.1|  PREDICTED: NADP-dependent malic enzyme-like      79.7    7e-14   
gb|KHN32646.1|  NADP-dependent malic enzyme, chloroplastic            79.7    7e-14   Glycine soja [wild soybean]
ref|XP_008791442.1|  PREDICTED: NADP-dependent malic enzyme-like      79.7    8e-14   Phoenix dactylifera
ref|XP_010688309.1|  PREDICTED: NADP-dependent malic enzyme           79.3    9e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008220114.1|  PREDICTED: NADP-dependent malic enzyme isofo...  79.0    1e-13   Prunus mume [ume]
ref|XP_010062529.1|  PREDICTED: NADP-dependent malic enzyme isofo...  79.0    1e-13   Eucalyptus grandis [rose gum]
gb|AAB17591.1|  NADP-malic enzyme                                     73.9    1e-13   Flaveria bidentis
dbj|BAA74735.1|  NADP-malic enzyme                                    78.6    1e-13   Aloe arborescens
gb|KJB70391.1|  hypothetical protein B456_011G071400                  78.6    2e-13   Gossypium raimondii
ref|XP_008220115.1|  PREDICTED: NADP-dependent malic enzyme isofo...  78.6    2e-13   Prunus mume [ume]
gb|EEC71406.1|  hypothetical protein OsI_03572                        78.6    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KJB70393.1|  hypothetical protein B456_011G071400                  78.6    2e-13   Gossypium raimondii
ref|XP_003631773.1|  PREDICTED: NADP-dependent malic enzyme isofo...  78.2    2e-13   Vitis vinifera
ref|XP_011092589.1|  PREDICTED: NADP-dependent malic enzyme-like ...  78.2    2e-13   Sesamum indicum [beniseed]
ref|XP_006644644.1|  PREDICTED: NADP-dependent malic enzyme-like      78.2    2e-13   Oryza brachyantha
dbj|BAB20887.2|  NADP dependent malic enzyme                          78.2    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHG23103.1|  NADP-dependent malic enzyme                           77.8    3e-13   Gossypium arboreum [tree cotton]
emb|CBI20568.3|  unnamed protein product                              77.8    3e-13   Vitis vinifera
gb|AHA11551.1|  NADP-malic enzyme                                     77.8    3e-13   Malus domestica [apple tree]
gb|ACX50497.1|  NADP-dependent malic enzyme                           77.8    3e-13   Zea mays [maize]
emb|CDP03266.1|  unnamed protein product                              77.8    3e-13   Coffea canephora [robusta coffee]
tpg|DAA57814.1|  TPA: malic enzyme                                    77.8    3e-13   
ref|XP_009387625.1|  PREDICTED: NADP-dependent malic enzyme           77.8    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS58449.1|  malic enzyme                                          77.8    3e-13   Genlisea aurea
ref|NP_001152396.1|  LOC100286036                                     77.8    3e-13   
gb|ACL54508.1|  unknown                                               77.8    3e-13   Zea mays [maize]
tpg|DAA57813.1|  TPA: malic enzyme                                    77.4    3e-13   
gb|EYU20414.1|  hypothetical protein MIMGU_mgv1a003353mg              77.4    4e-13   Erythranthe guttata [common monkey flower]
tpg|DAA57815.1|  TPA: malic enzyme                                    77.4    4e-13   
ref|XP_010102421.1|  NADP-dependent malic enzyme                      77.8    4e-13   
ref|XP_010925546.1|  PREDICTED: NADP-dependent malic enzyme-like ...  77.0    5e-13   Elaeis guineensis
ref|XP_010925545.1|  PREDICTED: NADP-dependent malic enzyme-like ...  77.0    5e-13   Elaeis guineensis
gb|EMS62941.1|  NADP-dependent malic enzyme                           76.6    7e-13   Triticum urartu
emb|CDM84157.1|  unnamed protein product                              75.9    1e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003627038.1|  Malic enzyme                                     75.9    1e-12   
ref|XP_006353488.1|  PREDICTED: NADP-dependent malic enzyme-like      75.9    1e-12   Solanum tuberosum [potatoes]
gb|AET01514.2|  NADP-dependent malic enzyme-like protein              75.5    2e-12   Medicago truncatula
ref|XP_004251632.1|  PREDICTED: NADP-dependent malic enzyme           75.5    2e-12   Solanum lycopersicum
ref|XP_010526435.1|  PREDICTED: NADP-dependent malic enzyme 1 iso...  74.7    3e-12   Tarenaya hassleriana [spider flower]
sp|P37222.1|MAOC_SOLLC  RecName: Full=NADP-dependent malic enzyme...  74.7    3e-12   Solanum lycopersicum
ref|XP_010526436.1|  PREDICTED: NADP-dependent malic enzyme 1 iso...  74.7    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_010668641.1|  PREDICTED: NADP-dependent malic enzyme           74.3    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004173611.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  73.6    4e-12   
ref|XP_008794109.1|  PREDICTED: NADP-dependent malic enzyme-like ...  73.9    5e-12   Phoenix dactylifera
ref|XP_008794107.1|  PREDICTED: NADP-dependent malic enzyme-like ...  73.9    6e-12   Phoenix dactylifera
gb|EYU30716.1|  hypothetical protein MIMGU_mgv1a0033651mg             73.6    6e-12   Erythranthe guttata [common monkey flower]
gb|EPS63619.1|  malic enzyme                                          72.8    8e-12   Genlisea aurea
ref|XP_011081758.1|  PREDICTED: NADP-dependent malic enzyme-like      73.6    8e-12   
emb|CDX85926.1|  BnaC06g22080D                                        73.6    9e-12   
ref|XP_009409372.1|  PREDICTED: NADP-dependent malic enzyme-like      73.6    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABS32241.1|  NADP-malic enzyme                                     73.2    1e-11   Flaveria palmeri
ref|XP_010521509.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  73.2    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_003569705.1|  PREDICTED: NADP-dependent malic enzyme-like      73.2    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_008794110.1|  PREDICTED: NADP-dependent malic enzyme-like ...  73.2    1e-11   Phoenix dactylifera
ref|XP_006345575.1|  PREDICTED: NADP-dependent malic enzyme-like      72.8    1e-11   Solanum tuberosum [potatoes]
gb|AAA83963.1|  malate dehydrogenase                                  69.7    1e-11   Solanum lycopersicum
ref|NP_001233951.1|  cytosolic NADP-malic enzyme                      72.4    2e-11   
gb|AGH32501.1|  malic enzyme                                          72.0    3e-11   Stylosanthes guianensis [stylo]
gb|KJB54773.1|  hypothetical protein B456_009G048600                  71.6    3e-11   Gossypium raimondii
gb|KHG14917.1|  NADP-dependent malic enzyme                           72.0    3e-11   Gossypium arboreum [tree cotton]
gb|KHN05334.1|  NADP-dependent malic enzyme, chloroplastic            71.6    3e-11   Glycine soja [wild soybean]
gb|KDP34170.1|  hypothetical protein JCGZ_07741                       71.6    3e-11   Jatropha curcas
ref|XP_009380466.1|  PREDICTED: NADP-dependent malic enzyme           71.6    3e-11   
gb|AEJ33773.1|  putative NADP-dependent malic enzyme                  71.6    3e-11   Solanum habrochaites
gb|KJB54772.1|  hypothetical protein B456_009G048600                  71.2    4e-11   Gossypium raimondii
gb|KJB54774.1|  hypothetical protein B456_009G048600                  71.2    4e-11   Gossypium raimondii
emb|CDX68115.1|  BnaA07g21550D                                        71.2    5e-11   
ref|XP_009104694.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  71.2    5e-11   Brassica rapa
ref|XP_010539482.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  70.9    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_002989806.1|  hypothetical protein SELMODRAFT_130484           70.5    7e-11   
dbj|BAG16517.1|  putative NADP-dependent malic enzyme                 70.5    7e-11   Capsicum chinense [bonnet pepper]
ref|XP_002872183.1|  hypothetical protein ARALYDRAFT_489440           69.7    1e-10   
ref|XP_007012167.1|  NADP-malic enzyme 4                              70.1    1e-10   
gb|AFW82002.1|  hypothetical protein ZEAMMB73_408175                  67.8    1e-10   
gb|KDO66537.1|  hypothetical protein CISIN_1g007703mg                 69.7    2e-10   Citrus sinensis [apfelsine]
gb|KCW79169.1|  hypothetical protein EUGRSUZ_C00609                   69.3    2e-10   Eucalyptus grandis [rose gum]
ref|XP_009151107.1|  PREDICTED: NADP-dependent malic enzyme 3         69.3    2e-10   Brassica rapa
emb|CDX80544.1|  BnaC07g29000D                                        69.3    2e-10   
ref|XP_006287343.1|  hypothetical protein CARUB_v10000542mg           69.3    2e-10   Capsella rubella
ref|XP_002990115.1|  hypothetical protein SELMODRAFT_185015           68.9    2e-10   
gb|KCW79649.1|  hypothetical protein EUGRSUZ_C01003                   68.6    2e-10   Eucalyptus grandis [rose gum]
gb|KEH36085.1|  NADP-dependent malic enzyme-like protein              68.9    2e-10   Medicago truncatula
ref|XP_010047689.1|  PREDICTED: NADP-dependent malic enzyme           68.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_006581458.1|  PREDICTED: NADP-dependent malic enzyme-like ...  68.6    3e-10   Glycine max [soybeans]
ref|XP_006581457.1|  PREDICTED: NADP-dependent malic enzyme-like ...  68.6    3e-10   Glycine max [soybeans]
ref|XP_010047290.1|  PREDICTED: NADP-dependent malic enzyme           68.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_003526504.2|  PREDICTED: NADP-dependent malic enzyme-like ...  68.6    3e-10   Glycine max [soybeans]
ref|XP_004501098.1|  PREDICTED: NADP-dependent malic enzyme-like      68.6    4e-10   Cicer arietinum [garbanzo]
ref|NP_196728.1|  NADP-dependent malic enzyme 2                       68.2    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAT02535.1|  NADP-dependent malic enzyme 3                         68.2    5e-10   Hydrilla verticillata
gb|ABD62355.2|  NADP-dependent malic enzyme                           65.9    5e-10   Hydrilla verticillata
emb|CAB66003.1|  NADP-dependent malate dehydrogenase (decarboxyla...  67.8    6e-10   Apium graveolens
ref|NP_197960.1|  NADP-dependent malic enzyme 3                       67.8    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454927.1|  PREDICTED: NADP-dependent malic enzyme 3         67.8    6e-10   Camelina sativa [gold-of-pleasure]
gb|KHG27198.1|  NADP-dependent malic enzyme                           67.8    6e-10   Gossypium arboreum [tree cotton]
gb|EMT25327.1|  NADP-dependent malic enzyme                           68.2    6e-10   
ref|XP_002516526.1|  malic enzyme, putative                           67.8    7e-10   
ref|XP_004172740.1|  PREDICTED: NADP-dependent malic enzyme-like      65.5    7e-10   
ref|XP_003522719.1|  PREDICTED: NADP-dependent malic enzyme-like ...  67.4    9e-10   Glycine max [soybeans]
gb|EEE62580.1|  hypothetical protein OsJ_17383                        67.0    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010536224.1|  PREDICTED: NADP-dependent malic enzyme 2         67.4    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_006578240.1|  PREDICTED: NADP-dependent malic enzyme-like ...  67.4    9e-10   Glycine max [soybeans]
ref|XP_006578239.1|  PREDICTED: NADP-dependent malic enzyme-like ...  67.4    9e-10   
gb|KJB07475.1|  hypothetical protein B456_001G026200                  67.0    1e-09   Gossypium raimondii
gb|KJB07473.1|  hypothetical protein B456_001G026200                  67.0    1e-09   Gossypium raimondii
ref|NP_001054832.1|  Os05g0186300                                     67.0    1e-09   
ref|XP_006290164.1|  hypothetical protein CARUB_v10003832mg           67.0    1e-09   
ref|XP_002871486.1|  NADP-malic enzyme 2                              67.0    1e-09   
ref|XP_002440734.1|  hypothetical protein SORBIDRAFT_09g005810        67.0    1e-09   
ref|XP_010419745.1|  PREDICTED: NADP-dependent malic enzyme 2-lik...  67.0    1e-09   
ref|XP_010419746.1|  PREDICTED: NADP-dependent malic enzyme 2-lik...  67.0    1e-09   
ref|XP_010491906.1|  PREDICTED: NADP-dependent malic enzyme 2         67.0    1e-09   
ref|XP_010453214.1|  PREDICTED: NADP-dependent malic enzyme 2-like    67.0    1e-09   
ref|XP_008656303.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  67.0    1e-09   
gb|KHG27199.1|  NADP-dependent malic enzyme, chloroplastic            66.6    1e-09   
gb|KJB65652.1|  hypothetical protein B456_010G105100                  66.6    1e-09   
gb|AFW82003.1|  hypothetical protein ZEAMMB73_408175                  66.6    1e-09   
emb|CDX70409.1|  BnaC03g04930D                                        66.6    2e-09   
gb|KFK25427.1|  hypothetical protein AALP_AA8G113600                  66.6    2e-09   
dbj|BAC54101.1|  cytosolic NADP-malic enzyme                          66.2    2e-09   
ref|XP_009131215.1|  PREDICTED: NADP-dependent malic enzyme 2         66.6    2e-09   
emb|CDX78432.1|  BnaA03g03440D                                        66.2    2e-09   
gb|KHN18149.1|  NADP-dependent malic enzyme                           65.9    2e-09   
ref|XP_007137243.1|  hypothetical protein PHAVU_009G111500g           65.9    2e-09   
sp|P12628.1|MAOX_PHAVU  RecName: Full=NADP-dependent malic enzyme...  65.9    2e-09   
emb|CAA56354.1|  NADP dependent malic enzyme                          65.9    2e-09   
ref|XP_007137244.1|  hypothetical protein PHAVU_009G111500g           65.9    2e-09   
ref|XP_006581459.1|  PREDICTED: NADP-dependent malic enzyme-like ...  65.9    2e-09   
emb|CDX91199.1|  BnaC02g03980D                                        65.5    3e-09   
gb|AAT02533.1|  NADP-dependent malic enzyme 1                         65.9    3e-09   
gb|KHG05054.1|  NADP-dependent malic enzyme                           65.5    3e-09   
ref|XP_006408906.1|  hypothetical protein EUTSA_v10001940mg           65.5    3e-09   
emb|CDX82748.1|  BnaC07g01180D                                        65.1    4e-09   
ref|XP_006299698.1|  hypothetical protein CARUB_v10015889mg           64.7    5e-09   
ref|XP_010416557.1|  PREDICTED: NADP-dependent malic enzyme 1 iso...  64.7    5e-09   
ref|NP_179580.1|  NADP-dependent malic enzyme 1                       64.7    6e-09   
ref|XP_002883966.1|  NADP-malic enzyme 1                              64.7    6e-09   
ref|XP_006643858.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  64.7    6e-09   
ref|XP_009102128.1|  PREDICTED: NADP-dependent malic enzyme 1         64.7    6e-09   
ref|XP_009125825.1|  PREDICTED: NADP-dependent malic enzyme 2-like    64.7    6e-09   
emb|CDY35901.1|  BnaA07g00860D                                        64.7    6e-09   
gb|KFK26368.1|  hypothetical protein AALP_AA8G239500                  64.3    7e-09   
ref|XP_006654124.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  64.3    7e-09   
gb|KFK40358.1|  hypothetical protein AALP_AA3G363600                  64.3    7e-09   
ref|XP_006394837.1|  hypothetical protein EUTSA_v10003882mg           64.3    8e-09   
ref|NP_001150965.1|  NADP-dependent malic enzyme                      64.3    8e-09   
ref|XP_002988197.1|  hypothetical protein SELMODRAFT_183698           63.9    1e-08   
ref|XP_011458980.1|  PREDICTED: NADP-dependent malic enzyme           63.9    1e-08   
ref|XP_002963488.1|  hypothetical protein SELMODRAFT_142026           63.9    1e-08   
ref|XP_006399678.1|  hypothetical protein EUTSA_v10013057mg           63.9    1e-08   
ref|XP_010489119.1|  PREDICTED: NADP-dependent malic enzyme 1-like    63.9    1e-08   
ref|XP_010467915.1|  PREDICTED: NADP-dependent malic enzyme 1-like    63.9    1e-08   
gb|AFW85113.1|  malic enzyme Precursor                                63.5    1e-08   
emb|CAA12157.1|  oxidoreductase                                       63.5    1e-08   
gb|ABR18338.1|  unknown                                               63.5    2e-08   
ref|NP_001105292.1|  NADP malic enzyme4                               63.5    2e-08   
gb|EYU29291.1|  hypothetical protein MIMGU_mgv1a002717mg              63.2    2e-08   
dbj|BAJ90221.1|  predicted protein                                    63.2    2e-08   
ref|XP_010230567.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  63.2    2e-08   
emb|CDM81737.1|  unnamed protein product                              62.8    2e-08   
ref|XP_009394173.1|  PREDICTED: NADP-dependent malic enzyme-like ...  62.8    2e-08   
ref|XP_009394174.1|  PREDICTED: NADP-dependent malic enzyme-like ...  62.8    3e-08   
gb|ABY25986.1|  NADP-dependent malic enzyme 1                         62.8    3e-08   
ref|XP_004960887.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  62.4    4e-08   
ref|XP_011019575.1|  PREDICTED: NADP-dependent malic enzyme isofo...  62.4    4e-08   
gb|KHN16636.1|  NADP-dependent malic enzyme                           62.0    4e-08   
ref|NP_001044219.1|  Os01g0743500                                     62.0    4e-08   
ref|XP_003569785.2|  PREDICTED: NADP-dependent malic enzyme-like      62.0    5e-08   
ref|XP_003568785.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  62.0    5e-08   
gb|ABW77317.1|  NADP-dependent malic enzyme                           61.6    5e-08   
dbj|BAK08307.1|  predicted protein                                    61.6    6e-08   
gb|EMS59690.1|  NADP-dependent malic enzyme, chloroplastic            62.0    6e-08   
gb|EMT10266.1|  NADP-dependent malic enzyme, chloroplastic            61.6    6e-08   
ref|XP_011019576.1|  PREDICTED: NADP-dependent malic enzyme isofo...  61.6    6e-08   
gb|EAY75782.1|  hypothetical protein OsI_03698                        61.2    9e-08   
gb|EAZ13499.1|  hypothetical protein OsJ_03416                        60.8    9e-08   
ref|XP_008445000.1|  PREDICTED: NADP-dependent malic enzyme           60.8    1e-07   
gb|ACI46151.1|  NADP-dependent malic enzyme                           60.8    1e-07   
gb|KGN62800.1|  hypothetical protein Csa_2G373430                     60.8    1e-07   
gb|EMT16777.1|  NADP-dependent malic enzyme                           60.8    1e-07   
emb|CDM84042.1|  unnamed protein product                              60.8    1e-07   
ref|XP_004148395.1|  PREDICTED: NADP-dependent malic enzyme-like      60.8    1e-07   
ref|XP_001751342.1|  predicted protein                                60.8    1e-07   
ref|XP_004969917.1|  PREDICTED: NADP-dependent malic enzyme-like      60.8    1e-07   
gb|EMT09696.1|  hypothetical protein F775_52101                       60.8    1e-07   
gb|EMS56730.1|  NADP-dependent malic enzyme                           60.8    1e-07   
gb|KCW82358.1|  hypothetical protein EUGRSUZ_C03762                   60.5    1e-07   
ref|XP_004164764.1|  PREDICTED: NADP-dependent malic enzyme-like      60.5    1e-07   
ref|XP_002456340.1|  hypothetical protein SORBIDRAFT_03g034280        60.5    1e-07   
sp|P37223.1|MAOX_MESCR  RecName: Full=NADP-dependent malic enzyme...  60.1    2e-07   
ref|XP_001759552.1|  predicted protein                                60.1    2e-07   
ref|XP_004969797.1|  PREDICTED: NADP-dependent malic enzyme-like ...  60.1    2e-07   
gb|ABA33610.1|  NADP-linked malic enzyme                              58.2    2e-07   
dbj|BAA24950.1|  NADP-malic enzyme                                    59.7    2e-07   
ref|XP_002309534.1|  hypothetical protein POPTR_0006s25280g           59.7    2e-07   
ref|XP_002455029.1|  hypothetical protein SORBIDRAFT_03g003220        59.7    3e-07   
ref|XP_011019577.1|  PREDICTED: NADP-dependent malic enzyme isofo...  59.3    3e-07   
gb|KDO79869.1|  hypothetical protein CISIN_1g007112mg                 58.9    4e-07   
ref|XP_006476016.1|  PREDICTED: NADP-dependent malic enzyme-like ...  58.9    5e-07   
gb|KDO79867.1|  hypothetical protein CISIN_1g007112mg                 58.9    5e-07   
ref|XP_006476015.1|  PREDICTED: NADP-dependent malic enzyme-like ...  58.9    5e-07   
ref|XP_006450720.1|  hypothetical protein CICLE_v10007668mg           58.5    5e-07   
gb|AFW77689.1|  malic enzyme                                          58.2    6e-07   
gb|AAK91502.1|  NADP-dependent malic enzyme                           58.2    7e-07   
ref|XP_008648299.1|  PREDICTED: NADP-dependent malic enzyme isofo...  58.2    7e-07   
ref|XP_008648302.1|  PREDICTED: NADP-dependent malic enzyme isofo...  58.2    8e-07   
ref|XP_008648298.1|  PREDICTED: NADP-dependent malic enzyme isofo...  58.2    8e-07   
ref|XP_008648301.1|  PREDICTED: NADP-dependent malic enzyme isofo...  58.2    8e-07   
gb|AAQ88396.1|  non-photosynthetic NADP-malic enzyme                  58.2    8e-07   
ref|XP_006450719.1|  hypothetical protein CICLE_v10007668mg           57.8    1e-06   
gb|AFL65183.1|  plastid NADP-malic enzyme                             56.2    4e-06   
dbj|BAA03949.1|  NADP-dependent malic enzyme                          55.1    8e-06   
gb|EAY72841.1|  hypothetical protein OsI_00711                        55.1    9e-06   
gb|AGT42314.1|  NADP-dependent malic enzyme                           54.3    1e-05   
ref|NP_001042257.1|  Os01g0188400                                     54.3    1e-05   
ref|XP_002324789.2|  hypothetical protein POPTR_0018s08250g           53.9    2e-05   
ref|XP_011002817.1|  PREDICTED: NADP-dependent malic enzyme-like      52.8    5e-05   
ref|XP_001751852.1|  predicted protein                                51.2    1e-04   
ref|XP_004968467.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  50.1    4e-04   



>ref|XP_006343041.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=642

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M SL+GT F N+SLSGVS+CL QS+  ++ S P VVA+VS NGRP DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNDSLSGVSRCLIQSR--KKVSFPMVVASVSPNGRPADRNVSVLMENTLKE  58

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + E+ PV+EK++KSTV GGVGD YGED+ATEDQ ITPW  SVASGY+LLR+PHY
Sbjct  59   MKENSPVIEKDSKSTVTGGVGDVYGEDSATEDQTITPWNFSVASGYSLLRNPHY  112



>ref|XP_004235645.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=642

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M SL+GT F NNSLSGVS+CLTQS+  +R S P VV +V+ NGR  DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNNSLSGVSRCLTQSR--KRVSFPMVVVSVNPNGRSADRNVSVLMENTLKE  58

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + E+ PV++++++STV GGVGD YGEDTATEDQ ITPW  SVASGY+LLR+PHY
Sbjct  59   MKENAPVIDEDSESTVTGGVGDVYGEDTATEDQTITPWNFSVASGYSLLRNPHY  112



>ref|XP_010318529.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=634

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M SL+GT F NNSLSGVS+CLTQS+  +R S P VV +V+ NGR  DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNNSLSGVSRCLTQSR--KRVSFPMVVVSVNPNGRSADRNVSVLMENTLKE  58

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + E+ PV++++++STV GGVGD YGEDTATEDQ ITPW  SVASGY+LLR+PHY
Sbjct  59   MKENAPVIDEDSESTVTGGVGDVYGEDTATEDQTITPWNFSVASGYSLLRNPHY  112



>ref|XP_009771112.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
sylvestris]
Length=643

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKV-VAAVSSNGRPGDRNASIVMESALK  402
            M SL+G++  NNS+SGVS+CLTQS+  +R S P V VA+VSSN +PG+R+AS++ME+ LK
Sbjct  1    MFSLNGSSCTNNSVSGVSRCLTQSR--KRMSVPMVAVASVSSNVKPGERHASVLMENTLK  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ ES PV+EK++KS V+GGVGD YGED+ATEDQ ITPWT SVASGY+LLRDP+Y
Sbjct  59   EMKESAPVIEKDSKSAVSGGVGDVYGEDSATEDQTITPWTHSVASGYSLLRDPNY  113



>gb|EYU45830.1| hypothetical protein MIMGU_mgv1a002611mg [Erythranthe guttata]
Length=654

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 12/125 (10%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP--KVVAAVSSNGRPGDRNASIVMESAL  399
            M SL+G+ F+NNSL GVSK LTQS +QR+ SAP   VVA+VSSNGR GDRN  ++MES L
Sbjct  1    MFSLNGSTFLNNSLCGVSKSLTQS-AQRKISAPPTTVVASVSSNGRSGDRNVGVLMESTL  59

Query  400  KEVTES---------VPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLL  552
            KE+ E+         + V+EK+ KSTV GGV D YGED+ATEDQ ITPWTV+VASGY LL
Sbjct  60   KEMNENATSSSSASQITVIEKDTKSTVGGGVEDVYGEDSATEDQYITPWTVTVASGYPLL  119

Query  553  RDPHY  567
            RDPHY
Sbjct  120  RDPHY  124



>ref|XP_011080458.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=650

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 8/121 (7%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  402
            M SL+G++F+NNSLSGVS+ LTQS +QR+ SAP  VVA+V+ NG+PGDRN S++ME+ LK
Sbjct  1    MFSLNGSSFLNNSLSGVSRNLTQS-TQRKISAPPMVVASVTPNGKPGDRNVSVLMENTLK  59

Query  403  EVTESVP------VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            E+ E+ P      + E E+KSTV GGV D YGED+ATED  ITPWTV+VASGY LLRDPH
Sbjct  60   EMRENAPSSSSPSLTENESKSTVGGGVEDVYGEDSATEDHYITPWTVTVASGYPLLRDPH  119

Query  565  Y  567
            Y
Sbjct  120  Y  120



>ref|XP_009772764.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
sylvestris]
Length=642

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAA-VSSNGRPGDRNASIVMESALK  402
            M SL+G++F NNSLSGVS+CLTQS S+R  S P VVAA V+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVAAAVNSNGKPGDRNVSVLVENSMK  59

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E + + PV EKE KSTV GGVGD YGED+ATEDQ ITPWT+SVASGY+LLR+PHY
Sbjct  60   E-SAAAPV-EKEIKSTVTGGVGDVYGEDSATEDQSITPWTLSVASGYSLLRNPHY  112



>gb|ABI98682.2| chloroplast NADP-malic enzyme precursor [Nicotiana tabacum]
Length=642

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  402
            M SL+G++F NNSLSGVS+CLTQS S+R  S P VV AAV+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVVAAVNSNGKPGDRNVSVLVENSMK  59

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E + + PV EKE KSTV GGVGD YGED+ATEDQ ITPWT+SVASGY+LLR+PHY
Sbjct  60   E-SAAAPV-EKEIKSTVTGGVGDVYGEDSATEDQSITPWTLSVASGYSLLRNPHY  112



>ref|XP_009626739.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
tomentosiformis]
Length=642

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  402
            M SL+G++F NNSLSGVS+CLTQS S+R  S P VV AAV+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVVAAVNSNGKPGDRNVSVLVENSMK  59

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E + + PV EKE KSTV GGVGD YGED+ATEDQ ITPWT+SVASGY+LLR+PHY
Sbjct  60   E-SAAAPV-EKEIKSTVTGGVGDVYGEDSATEDQSITPWTLSVASGYSLLRNPHY  112



>ref|XP_006359476.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=640

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  402
            M SL+GT+F NNSLSGVS+CLTQS   RR SAP VV AAVSSNG+PGD + S+++E+AL 
Sbjct  1    MFSLNGTSFTNNSLSGVSRCLTQSS--RRVSAPMVVVAAVSSNGKPGDGSVSVLVENAL-  57

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
              TES   VE E KSTV GGV D YGED+ATEDQ ITPWT+SVASG++LLR+PHY
Sbjct  58   --TESAAPVEMEVKSTVTGGVQDVYGEDSATEDQSITPWTLSVASGFSLLRNPHY  110



>ref|NP_001234458.1| NADP-dependent malic enzyme, chloroplastic [Solanum lycopersicum]
 gb|AAB58727.1| NADP-malic enzyme [Solanum lycopersicum]
Length=640

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  402
            M SL+GT+F NNSLSGVS+CL  +QS RR SAP VV AAV+SNG+PGD + S+++E+AL 
Sbjct  1    MFSLNGTSFTNNSLSGVSRCL--NQSSRRVSAPMVVVAAVNSNGKPGDGSVSVLVENAL-  57

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
              TES   VE E KSTV GGV D YGED+ATEDQ ITPWT+SVASG++LLR+PHY
Sbjct  58   --TESPAPVEMEVKSTVTGGVQDVYGEDSATEDQSITPWTLSVASGFSLLRNPHY  110



>emb|CDO97978.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 5/117 (4%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  402
            M+SL+GT+F++NSL GVS+ + Q    RR + P VV A+VSSNGR GDRN S+++E++LK
Sbjct  1    MLSLNGTSFLDNSLYGVSRGVVQQH--RRVAPPMVVVASVSSNGRAGDRNVSVLVETSLK  58

Query  403  EVTESVPV--VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ ++ P    +K++KS V GG+GD YGEDTATEDQ ITPWTVSVASGY LLRDPHY
Sbjct  59   EIRDASPAPPADKDSKSKVTGGIGDVYGEDTATEDQSITPWTVSVASGYPLLRDPHY  115



>ref|XP_009591013.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=643

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M SL+G++F NNS+SGVS+CLTQS  +R      VVA+VSSN +PGDRN SI+ME+ LKE
Sbjct  1    MFSLNGSSFTNNSVSGVSRCLTQS-PKRMLVPMVVVASVSSNVKPGDRNVSILMENTLKE  59

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + E  P +EK++KS V+GGVGD YGED+ATEDQ ITPWT SVASGY+LLRDP+Y
Sbjct  60   MKEDAPFIEKDSKSAVSGGVGDVYGEDSATEDQTITPWTHSVASGYSLLRDPNY  113



>ref|XP_011072428.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Sesamum 
indicum]
Length=648

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M SL+G++  NN L GVSK LTQS  + + + P VVAAVSSN RP D N  + +E+ LKE
Sbjct  1    MFSLNGSSTRNNPLYGVSKSLTQSAQKHKSAPPLVVAAVSSNARPRDGNV-LAVENTLKE  59

Query  406  VTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +T + P      + K++ S+VAGGV D YGEDTATEDQ ITPWTVSVASGY LLRDP Y
Sbjct  60   MTANPPSTSSSGIAKDSSSSVAGGVEDVYGEDTATEDQFITPWTVSVASGYPLLRDPRY  118



>ref|XP_010098139.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB74576.1| NADP-dependent malic enzyme [Morus notabilis]
Length=621

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 11/117 (9%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQS--QRRFSAP-KVVAAVSSNGRPGDRNASIVMESA  396
            MISLS T F+NN+  GVS+  + + S  QRR++A  KVVA+       G+RN ++VME A
Sbjct  1    MISLSRTCFLNNA--GVSELYSPANSTRQRRYAASLKVVASA------GERNGTVVMEGA  52

Query  397  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            LKE  +   VVE + KSTV GGV D YGED+ATEDQ +TPW++SVASGYTLLRDPH+
Sbjct  53   LKESKDVSSVVEVDNKSTVGGGVQDVYGEDSATEDQFVTPWSISVASGYTLLRDPHH  109



>ref|XP_007216984.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
 gb|EMJ18183.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
Length=641

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N +++G S   + SQ +RR ++ KVVA V    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAIAGSSSPFSHSQ-KRRSASLKVVALVP-KARTGDRNGSVVMESTLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV +   VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+RDPH+
Sbjct  59   EVKDESSVVE--LKSTVHGGVQDVYGEDTATEDQFVTPWSVSVASGYTLIRDPHH  111



>ref|XP_008228427.1| PREDICTED: NADP-dependent malic enzyme [Prunus mume]
Length=641

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N +++G S   + SQ +RR ++ KVVA V    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAIAGSSSPFSHSQ-KRRSASLKVVALVPKT-RTGDRNGSVVMESTLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV +   VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+RDPH+
Sbjct  59   EVKDESSVVE--LKSTVHGGVQDVYGEDTATEDQFVTPWSVSVASGYTLIRDPHH  111



>ref|XP_010267161.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNS--LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  399
            MISL   +F+NNS   SG+S   + S SQR+ SAP VV A++SNGR G+R    +MES L
Sbjct  1    MISLKAGSFLNNSTSFSGIS---SFSHSQRKVSAP-VVVALNSNGRGGERKFKALMESTL  56

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KE+ E    ++ + K     GV D YGED ATEDQ +TPWT SVASGY+LLRDPH+
Sbjct  57   KEIREGASALDMDPKPNPGAGVEDVYGEDRATEDQPVTPWTTSVASGYSLLRDPHH  112



>gb|AFR54473.1| cytosolic NADP-malic protein [Prunus armeniaca]
Length=640

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 5/114 (4%)
 Frame = +1

Query  229  ISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            +SL+ + F+ N  ++G S   +QSQ +RR ++ KVVA +    R GDRN S+VMES L+E
Sbjct  1    MSLNRSCFLGNPGIAGSSSPFSQSQ-KRRSASLKVVALIP-KARTGDRNGSVVMESTLQE  58

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V +   VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+RDPH+
Sbjct  59   VKDESSVVE--LKSTVHGGVQDVYGEDTATEDQFVTPWSVSVASGYTLIRDPHH  110



>ref|XP_010267160.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nelumbo 
nucifera]
Length=643

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            MISL   +F+ N+ +  S   + S SQR+ SAP VV A++SNGR G+R    +MES LKE
Sbjct  1    MISLKAGSFLQNNSTSFSGISSFSHSQRKVSAP-VVVALNSNGRGGERKFKALMESTLKE  59

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + E    ++ + K     GV D YGED ATEDQ +TPWT SVASGY+LLRDPH+
Sbjct  60   IREGASALDMDPKPNPGAGVEDVYGEDRATEDQPVTPWTTSVASGYSLLRDPHH  113



>gb|ADU20198.1| NADP-dependent malic enzyme [Pyrus pyrifolia]
Length=641

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N  ++G S   +QSQ +RR ++ KVVA V    R GDRN S+VME+AL+
Sbjct  1    MMSLNRSCFLGNPGIAGSSSPFSQSQ-KRRPASLKVVAVVPKV-RTGDRNGSVVMENALQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV     VVE   KSTV GGV D YGEDTATEDQ++TPW++SVASGYTL+R PH+
Sbjct  59   EVKAESEVVE--LKSTVHGGVQDVYGEDTATEDQLVTPWSISVASGYTLIRSPHH  111



>ref|XP_009342530.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N +++G S   +QSQ +RR ++ KVVA +    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAVAGSSSPFSQSQ-KRRPASLKVVALIP-KARTGDRNGSVVMESTLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV     VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+R PH+
Sbjct  59   EVKTESEVVE--LKSTVHGGVKDVYGEDTATEDQFVTPWSVSVASGYTLIRSPHH  111



>ref|XP_009353550.1| PREDICTED: NADP-dependent malic enzyme [Pyrus x bretschneideri]
Length=641

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N +++G S   +QSQ +RR ++ KVVA +   G  GDRN S+VMES L+
Sbjct  1    MMSLNRSFFLGNPAVAGSSSPFSQSQ-KRRPASLKVVALIPKAGT-GDRNGSVVMESTLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV     VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+R PH+
Sbjct  59   EVKTESEVVE--LKSTVHGGVKDVYGEDTATEDQFVTPWSVSVASGYTLIRSPHH  111



>ref|XP_009348545.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+ N  ++G S     SQSQ+R  A   V AV    R GDRN S+VME+AL+
Sbjct  1    MMSLNRSCFLGNPGIAGSSSPF--SQSQKRQPASLKVVAVVPKVRTGDRNGSVVMENALQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV     VVE   KSTV GGV D YGEDTATEDQ++TPW++SVASGYTL+R PH+
Sbjct  59   EVKAESEVVE--LKSTVHGGVQDVYGEDTATEDQLVTPWSISVASGYTLIRSPHH  111



>gb|AHA11552.1| NADP-malic enzyme [Malus domestica]
Length=641

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+    ++G S     SQSQ+R SA   V AV    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSASLKVVAVVPKVRTSDRNGSVVMENPLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV     VVE   KSTV GGV D YGEDTATEDQ++TPW+VSVASGYTL+R PH+
Sbjct  59   EVKAESEVVE--LKSTVHGGVQDVYGEDTATEDQLVTPWSVSVASGYTLIRSPHH  111



>ref|NP_001268030.1| malate dehydrogenase [Vitis vinifera]
 gb|AAB08874.1| malate dehydrogenase [Vitis vinifera]
Length=640

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  286  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  465
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  466  GDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             D  GED ATEDQ++TPWT++VASGY+LLR+PH+
Sbjct  77   RDVQGEDAATEDQIVTPWTITVASGYSLLRNPHH  110



>emb|CBI36068.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  286  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  465
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  466  GDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             D  GED ATEDQ++TPWT++VASGY+LLR+PH+
Sbjct  77   RDVQGEDAATEDQIVTPWTITVASGYSLLRNPHH  110



>emb|CAN69517.1| hypothetical protein VITISV_024155 [Vitis vinifera]
Length=657

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  286  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  465
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  466  GDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             D  GED ATEDQ++TPWT++VASGY+LLR+PH+
Sbjct  77   RDVQGEDAATEDQIVTPWTITVASGYSLLRNPHH  110



>ref|XP_007150609.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
 gb|ESW22603.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
Length=643

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP-KVVAAVSSNGRPGDRNASIVMESALK  402
            M S +  AF+NN+  G+  C +  +  R+ S+P  VV    S+ R  DRN+S+VME+ LK
Sbjct  1    MFSSTRCAFLNNA--GLGGCGSICEGARKRSSPMTVVCMTPSSSRSVDRNSSVVMETPLK  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ +   V + +  S  AGG  D YGED ATEDQ +TPW+VSVASGYTLLRDPH+
Sbjct  59   ELKKDSAVADVDGDSVSAGGPQDVYGEDRATEDQFVTPWSVSVASGYTLLRDPHF  113



>ref|XP_008353539.1| PREDICTED: NADP-dependent malic enzyme-like [Malus domestica]
Length=641

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+    ++G S   +QSQ +RR ++ KVVA V    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPFSQSQ-KRRSTSLKVVAVVPKV-RTSDRNGSVVMENXLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +V     V E   KSTV GGV D YGEDTATEDQ++TPW+VSVASGYTL+R PH+
Sbjct  59   DVKAESEVFE--LKSTVHGGVQDVYGEDTATEDQLVTPWSVSVASGYTLIRSPHH  111



>gb|ABB86962.1| cytosolic NADP-malic enzyme [Malus domestica]
Length=641

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M+SL+ + F+ N     S   +    +R+ ++ KVVA +    R GDRN S+VMES L+E
Sbjct  1    MMSLNRSCFLGNPAVAGSSSPSSQSQKRQPASLKVVALIP-KARTGDRNGSVVMESTLQE  59

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V     VVE   KSTV GGV D YGEDTATEDQ++TPW+VSVASGY L+R PH+
Sbjct  60   VKTESEVVE--LKSTVHGGVEDVYGEDTATEDQLVTPWSVSVASGYMLIRSPHH  111



>gb|KDP40863.1| hypothetical protein JCGZ_24862 [Jatropha curcas]
Length=644

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            MISL+ +   N S+SG     +  Q     +AP  +  V+ N    DRN S+VMES+L+E
Sbjct  1    MISLNSSFLSNTSISGSCSPFSGKQKGLVPTAPSTLKVVALNPN-RDRNGSVVMESSLQE  59

Query  406  VTESVPVVEKEA-KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + +   V++ ++ K+TV GGV D YGEDTATEDQ++TPW++SVASGY+LLRDPH+
Sbjct  60   IRDGASVLDFDSDKATVTGGVRDVYGEDTATEDQLVTPWSLSVASGYSLLRDPHH  114



>ref|XP_003546557.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=643

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP-KVVAAVSSNGRPGDRNASIVMESALK  402
            M S +  AF++NS  G+  C +   +QR+ S   +VV+   S+ R GDRN S+VME+ LK
Sbjct  1    MFSSTRCAFLSNS--GLGGCSSLCDAQRKRSTRFRVVSMTPSSSRSGDRNGSVVMETPLK  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ +   V + +     AGG  D YGED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  59   ELKKESTVADVDNNPISAGGPQDVYGEDRATEDHFVTPWSVSVASGYTLLRDPHF  113



>gb|KHM98720.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=643

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP-KVVAAVSSNGRPGDRNASIVMESALK  402
            M S +  AF++NS  G+  C +   +QR+ S   +VV+   S+ R GDRN S+VME+ LK
Sbjct  1    MFSSTRCAFLSNS--GLGGCSSLCDAQRKRSTRFRVVSMTPSSSRSGDRNGSVVMETPLK  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ +   V + +     AGG  D YGED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  59   ELKKESTVADVDNNPISAGGPQDVYGEDRATEDHFVTPWSVSVASGYTLLRDPHF  113



>ref|XP_004302862.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent malic enzyme [Fragaria 
vesca subsp. vesca]
Length=637

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 76/116 (66%), Gaps = 14/116 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQ-SQRRFSAPKVVAAVSSNG-RPGDRNASIVMESAL  399
            MISL+ + F+ N   GV  C   S  SQ+R SAP  V AV +N  R G+RN SIVME+A 
Sbjct  4    MISLNRSCFLGNP--GV--CGNGSPFSQKRRSAPLRVVAVGTNAARKGERNGSIVMETAA  59

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KEV E         KSTV GG  D YGEDTA+EDQ +TPW VSVASGY L+RDPH+
Sbjct  60   KEVVE--------LKSTVHGGDRDVYGEDTASEDQPVTPWCVSVASGYNLIRDPHH  107



>gb|KCW53678.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=548

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  384
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  385  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+ATEDQ++TPWTVSVASGY+LLR
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSATEDQLVTPWTVSVASGYSLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>gb|KCW53676.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=644

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  384
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  385  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+ATEDQ++TPWTVSVASGY+LLR
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSATEDQLVTPWTVSVASGYSLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>ref|XP_010033838.1| PREDICTED: NADP-dependent malic enzyme [Eucalyptus grandis]
 gb|KCW53677.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=649

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  384
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  385  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+ATEDQ++TPWTVSVASGY+LLR
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSATEDQLVTPWTVSVASGYSLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>gb|EYU21512.1| hypothetical protein MIMGU_mgv1a002703mg [Erythranthe guttata]
Length=645

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  MISLSGT-AFMNNSLSGVSKCLTQSQSQRRFSAPKV-VAAVSSNGRPGDRNASIVMESAL  399
            M SL G+ +++N+S+ GVSK L Q  +  R S P + V ++ SN R  D  A     ++ 
Sbjct  1    MFSLGGSCSYLNSSVYGVSKSLVQC-THSRVSPPSMAVVSLGSNNRQVDETAVSKQNASH  59

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               + S   VEK+ KS+V GGV D YGED+ATEDQ ITPWTV+VASGY LLRDPHY
Sbjct  60   IPSSSSSTAVEKDLKSSVCGGVEDVYGEDSATEDQYITPWTVTVASGYPLLRDPHY  115



>ref|XP_008352329.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Malus domestica]
Length=354

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+    ++G S     SQSQ+R S    V AV    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSTSLKVVAVVXKVRTSDRNGSVVMENXLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +V     V E   KSTV GGV D YG DTATEDQ++TPW+VSVASGYTL+R PH+
Sbjct  59   DVKAESEVFE--LKSTVHGGVQDVYGXDTATEDQLVTPWSVSVASGYTLIRSPHH  111



>ref|XP_010267163.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nelumbo 
nucifera]
Length=626

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +1

Query  307  RRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGED  486
            R+ SAP VV A++SNGR G+R    +MES LKE+ E    ++ + K     GV D YGED
Sbjct  11   RKVSAP-VVVALNSNGRGGERKFKALMESTLKEIREGASALDMDPKPNPGAGVEDVYGED  69

Query  487  TATEDQVITPWTVSVASGYTLLRDPHY  567
             ATEDQ +TPWT SVASGY+LLRDPH+
Sbjct  70   RATEDQPVTPWTTSVASGYSLLRDPHH  96



>gb|EPS63115.1| hypothetical protein M569_11673, partial [Genlisea aurea]
Length=260

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 5/118 (4%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK-  402
            M +L+G+ F+NNSL G  +  TQ   ++  + P++  + S NG+PGDR ASI++E+ +K 
Sbjct  3    MFALNGSTFLNNSLYGAFRSGTQLMQRKLSNPPEMAVSASKNGKPGDRTASILVENEIKP  62

Query  403  -EVTESVPVVEKEAKSTVAGGVGDFYGEDTATE--DQVITPWTVSVASGYTLLRDPHY  567
              ++ S P +E+ +KS VA  V +   ED A E  DQ ITPWTV+VASGY LLRDP Y
Sbjct  63   PPLSSSAPSIEEVSKSNVASNV-EIVDEDEAEEMGDQYITPWTVTVASGYPLLRDPQY  119



>gb|AAF73006.1|AF262997_1 NADP-dependent malic protein [Ricinus communis]
Length=641

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query  316  SAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTAT  495
            +AP  +  V+ N    +RN SI+MES L+E+ +   V++ + KSTVAGGV D YGEDTAT
Sbjct  29   TAPSSLKVVALNPN-RERNGSIMMESTLQEMRDGASVLDLDPKSTVAGGVRDVYGEDTAT  87

Query  496  EDQVITPWTVSVASGYTLLRDPHY  567
            EDQ +TPW++SVASGY+LLRDPH+
Sbjct  88   EDQFVTPWSLSVASGYSLLRDPHH  111



>ref|XP_002515967.1| malic enzyme, putative [Ricinus communis]
 gb|EEF46387.1| malic enzyme, putative [Ricinus communis]
Length=641

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query  316  SAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTAT  495
            +AP  +  V+ N    +RN SI+MES L+E+ +   V++ + KSTVAGGV D YGEDTAT
Sbjct  29   TAPSSLKVVALNPN-RERNGSIMMESTLQEMRDGASVLDLDPKSTVAGGVRDVYGEDTAT  87

Query  496  EDQVITPWTVSVASGYTLLRDPHY  567
            EDQ +TPW++SVASGY+LLRDPH+
Sbjct  88   EDQFVTPWSLSVASGYSLLRDPHH  111



>ref|XP_008361292.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Malus domestica]
Length=354

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ + F+    ++G S     SQSQ+R S    V AV    R  DRN S+ ME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSTSLKVVAVVXKVRTSDRNGSVXMENXLQ  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +V     V E   KSTV GGV D YG DTATEDQ++TPW+VSVASGYTL+R PH+
Sbjct  59   DVKAESEVFE--LKSTVHGGVQDVYGXDTATEDQLVTPWSVSVASGYTLIRSPHH  111



>ref|XP_003543623.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=647

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQR--RFSAPKVVAAVSSNGRPGDRNASIVMESA  396
            M S +  AF++NS L G S     +Q +R  R     +  + SS+ R GDRN S+VME+ 
Sbjct  1    MFSSTRCAFLSNSGLGGCSSLCDAAQKKRSTRLRVVSMTPSSSSSSRSGDRNGSVVMETP  60

Query  397  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            LKE+ +   V + +  +  AGG  D YGED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  61   LKELKKESTVADVDDNAISAGGPQDVYGEDRATEDHFVTPWSVSVASGYTLLRDPHF  117



>ref|XP_010665912.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            MISL    F++N  S   +    +Q QRR  +   VA   S GR GD N  IV+   +KE
Sbjct  1    MISLHRANFLSNKPSVSGRSFGSTQLQRRGPSVVRVAVGPSKGRSGDENG-IVLTEEIKE  59

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V+  + + EK   ST  GGV D YGEDTATEDQ++TPW +SVASGY+LLRDP +
Sbjct  60   VSSVIDLNEKSTVST--GGVEDVYGEDTATEDQLVTPWALSVASGYSLLRDPRH  111



>gb|AAW56450.1| chloroplast NADP-dependent malic enzyme precursor [Flaveria bidentis]
Length=647

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            MISL+ +    +S++G S+  TQSQS R     P V + ++SN  P +RN ++ ++SA++
Sbjct  1    MISLNSSFLERSSVAGGSR--TQSQSLRLSVRRPVVASMLNSNSLP-ERNVNVSVDSAVR  57

Query  403  EVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +V   V V     V ++  + V GGV D YGEDTATEDQ ITPW+VSVASGY+LLRDPH+
Sbjct  58   DVNAPVAVEVDRSVGEKPFAVVGGGVEDMYGEDTATEDQYITPWSVSVASGYSLLRDPHH  117



>sp|P22178.1|MAOC_FLATR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria trinervia]
 emb|CAA40421.1| NADP-dependent malic enzyme [Flaveria trinervia]
Length=648

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSA--PKVVAAVSSNGRPGDRNASIVMESAL  399
            MISL+ +    +S++G S+  TQSQS  R SA  P V + ++SN  P +RN S+ ++SA+
Sbjct  1    MISLNSSFLERSSVTGGSR--TQSQS-LRLSARRPVVTSMLNSNSLP-ERNVSVSVDSAV  56

Query  400  KEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            ++V   V V     V ++  + V GGV D YGEDTATED  ITPW+VSVASGY+LLRDPH
Sbjct  57   RDVNAPVAVEVDRSVGEKPFAAVGGGVEDMYGEDTATEDHYITPWSVSVASGYSLLRDPH  116

Query  565  Y  567
            +
Sbjct  117  H  117



>prf||1701292A NADP dependent malic enzyme
Length=648

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSA--PKVVAAVSSNGRPGDRNASIVMESAL  399
            MISL+ +    +S++G S+  TQSQS  R SA  P V + ++SN  P +RN S+ ++SA+
Sbjct  1    MISLNSSFLERSSVTGGSR--TQSQS-LRLSARRPVVTSMLNSNSLP-ERNVSVSVDSAV  56

Query  400  KEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            ++V   V V     V ++  + V GGV D YGEDTATED  ITPW+VSVASGY+LLRDPH
Sbjct  57   RDVNAPVAVEVDRSVGEKPFAAVGGGVEDMYGEDTATEDHYITPWSVSVASGYSLLRDPH  116

Query  565  Y  567
            +
Sbjct  117  H  117



>ref|XP_008810493.1| PREDICTED: NADP-dependent malic enzyme [Phoenix dactylifera]
Length=641

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +1

Query  298  QSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVP-VVEKEAKSTVAGGVGDF  474
             SQRR SA  VV      GR   +   + MES LKE+    P V++ + +STV GGV D 
Sbjct  20   HSQRRSSAAGVVVRCCGRGRGDGKVRGVAMESTLKEIRGDKPSVLDMDPESTVGGGVEDV  79

Query  475  YGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            YGED ATE+Q++TPWT+SVASGY+LLRDPH
Sbjct  80   YGEDRATEEQLVTPWTLSVASGYSLLRDPH  109



>sp|P36444.1|MAOC_FLAPR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria pringlei]
 emb|CAA54986.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) [Flaveria 
pringlei]
Length=647

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 7/99 (7%)
 Frame = +1

Query  289  TQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTE--SVPVVEKEAK---ST  450
            TQSQS R     P VVA V+SNGRP +R+  + ++ A+K+V    +V V + E+K   + 
Sbjct  20   TQSQSVRLSVRRPMVVAMVNSNGRP-ERSVGVSVDGAVKDVNAPVAVEVADSESKKPTAV  78

Query  451  VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V GGV D YGED+ATED  ITPW+VSVASGY+LLRDPH+
Sbjct  79   VGGGVEDVYGEDSATEDHFITPWSVSVASGYSLLRDPHH  117



>gb|AFM08812.1| NADP-dependent malic protein [Dimocarpus longan]
Length=645

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 11/120 (9%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVME----  390
            M SL+ + F+NN S+SG S     S +QRR    KVVA  +SN      N S++ME    
Sbjct  1    MFSLNRSCFLNNTSISGRSSPF--SHNQRRRLPTKVVALSTSNRV--QSNVSVLMENHSG  56

Query  391  -SALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             +AL+E+ +    V  + KS V GGV D YGEDTATED  +TPW+VSVASGY+LLRDPH+
Sbjct  57   TTALQEMRDGYAEV-VDPKSAVTGGVQDVYGEDTATEDMPVTPWSVSVASGYSLLRDPHH  115



>gb|KFK42380.1| hypothetical protein AALP_AA2G248700 [Arabis alpina]
Length=638

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQ-RRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            MISLS ++F+N    G S  L+  Q + R  ++P +    SS G   D N S+++ES+L 
Sbjct  1    MISLSASSFLNKP--GCSTHLSLRQPRIRTRTSPALFRVFSSLGSTRDPNGSVLIESSLD  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
                    V+   KS+V+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  59   S-----SAVDILPKSSVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  108



>ref|XP_010325074.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Solanum 
lycopersicum]
Length=620

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  RNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYT  546
            R   +VMES LKE+T    V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+
Sbjct  24   RRRGVVMESTLKELTNGESVLDIKDKCGVAGGVEDIYGEDRATEDQTITPWTFSVASGYS  83

Query  547  LLRDPHY  567
            LLRDPHY
Sbjct  84   LLRDPHY  90



>ref|XP_006301745.1| hypothetical protein CARUB_v10022207mg [Capsella rubella]
 gb|EOA34643.1| hypothetical protein CARUB_v10022207mg [Capsella rubella]
Length=645

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQ-SQSQRRFSA-PKVVAAVSSNGRPGDRNASIVME-SA  396
            MISLS T+F+N +  GV  C T  S  Q R  A P      SS G   D N S+++E SA
Sbjct  1    MISLSPTSFLNKT--GVPGCSTHLSLRQPRIIAFPASFRVFSSLGSNRDPNGSVLIETSA  58

Query  397  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
                +      +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  59   TSSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  115



>sp|P34105.3|MAOX_POPTR RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME [Populus 
trichocarpa]
 emb|CAA39690.1| malic enzyme [Populus trichocarpa]
Length=591

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + KSTV GGV D YGED ATEDQ++TPWT+SVASGYTLLRDPH
Sbjct  1    MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGYTLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>prf||1803524A malic enzyme
Length=589

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + KSTV GGV D YGED ATEDQ++TPWT+SVASGYTLLRDPH
Sbjct  1    MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGYTLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_011007124.1| PREDICTED: NADP-dependent malic enzyme [Populus euphratica]
 ref|XP_011007125.1| PREDICTED: NADP-dependent malic enzyme [Populus euphratica]
Length=591

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + KSTV GGV D YGED ATEDQ++TPWT+SVASGYTLLRDPH
Sbjct  1    MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGYTLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_006853670.1| hypothetical protein AMTR_s00056p00119870 [Amborella trichopoda]
 gb|ERN15137.1| hypothetical protein AMTR_s00056p00119870 [Amborella trichopoda]
Length=652

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE+    P V++ +AKSTV GGV D YGED ATEDQ++TPWTV+VASGY+LLRDP
Sbjct  61   MESTLKEMRGDGPSVLDMDAKSTVGGGVEDMYGEDQATEDQLVTPWTVTVASGYSLLRDP  120

Query  562  HY  567
            HY
Sbjct  121  HY  122



>ref|XP_011010431.1| PREDICTED: NADP-dependent malic enzyme-like [Populus euphratica]
Length=648

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 14/123 (11%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKV-----VAAVSSNGRPGDRNASIVME  390
            M+SL+ + F++N+  G+S   +     +R S P V     V AV+SN    DRN S++ E
Sbjct  1    MMSLNRSIFLSNA--GISSSSSPFTGGQRGSVPSVPSSLRVVAVNSNR---DRNGSVLTE  55

Query  391  SALKEVTE---SVPVVEKEAKSTVA-GGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            +  K+V +   S  V++ ++KSTVA GG  D YGED ATE+QV+TPW VSVASGY+LLRD
Sbjct  56   ATRKDVRDGAASSSVIDADSKSTVAPGGPHDVYGEDAATEEQVVTPWFVSVASGYSLLRD  115

Query  559  PHY  567
            PH+
Sbjct  116  PHH  118



>gb|KDO51778.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=461

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSN--RDKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>ref|XP_002887860.1| NADP-malic enzyme 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64119.1| NADP-malic enzyme 4 [Arabidopsis lyrata subsp. lyrata]
Length=646

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSL-SGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES-AL  399
            MISLS ++F+N ++  G S  L   Q +   + P  +   SS G   D N S+++E+ A 
Sbjct  1    MISLSPSSFLNKTVVPGCSTHLFLRQPRTLITPPASLRVFSSLGSNRDPNGSLLIETTAT  60

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               +      +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  61   SSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  116



>gb|KDO51777.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=542

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSNR--DKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>gb|KDO51773.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=609

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSN--RDKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>gb|KDO51776.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=615

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSNR--DKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>gb|AAB17593.1| NADP-malic enzyme, partial [Flaveria bidentis]
Length=106

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M+SL+ ++ + +S+SGVS+  TQSQS R     P VVA V+SNGRP +R+  + ++ A+K
Sbjct  1    MMSLNTSSVVKSSISGVSR--TQSQSVRLSVRRPMVVAMVNSNGRP-ERSVGVSVDGAVK  57

Query  403  EVTE--SVPVVEKEAKST---VAGGVGDFYGEDTATEDQVITPWTVSVA  534
            +V    +V V + E+K T   V GGV D YGED+ATED  ITPW+VSVA
Sbjct  58   DVNAPVAVEVADSESKETTAVVGGGVEDVYGEDSATEDHFITPWSVSVA  106



>gb|KDO51774.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=644

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSNR--DKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>ref|XP_006426882.1| hypothetical protein CICLE_v10025125mg [Citrus clementina]
 ref|XP_006465687.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Citrus 
sinensis]
 gb|ESR40122.1| hypothetical protein CICLE_v10025125mg [Citrus clementina]
 gb|KDO51775.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=643

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 15/121 (12%)
 Frame = +1

Query  226  MISLSGTAFMNN--SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--  393
            M SL+ +AF+NN  S+SG     +     RR    +VV A SSN      N S++M +  
Sbjct  1    MFSLNRSAFLNNPASISG-----SFPDKHRRILPTRVVVAGSSNR--DKSNGSLLMATDE  53

Query  394  ---ALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
                LKE+ +    V  + KS V+GGV D YGEDTATEDQ +TPW+VSVASGY+LLRDPH
Sbjct  54   STATLKEMRDGYAEV-VDPKSGVSGGVQDVYGEDTATEDQPVTPWSVSVASGYSLLRDPH  112

Query  565  Y  567
            +
Sbjct  113  H  113



>gb|AEK25136.1| NADP-dependent malic enzyme [Hylocereus undatus]
Length=640

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 71/116 (61%), Gaps = 8/116 (7%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVS-SNGRPGDRNASIVMESALK  402
            MISL    F+NN+ S   +    +  QRR     V  AV  S GR  D   +++ E A +
Sbjct  1    MISLHTAHFLNNTPSISGRSFGSTHLQRRCPVGMVRVAVGPSFGRSTD---AVLTEEARE  57

Query  403  EVTESVPVVEKEAKSTVA-GGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             V   V  V+ + KSTV   GV D YGEDTATEDQ++TPW++SVASGY+LLRDPHY
Sbjct  58   GV---VGAVDLDDKSTVTDAGVEDMYGEDTATEDQLVTPWSLSVASGYSLLRDPHY  110



>ref|XP_010473033.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Camelina sativa]
 ref|XP_010473034.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Camelina sativa]
Length=653

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQS--QSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  399
            MISLS ++F+N + +GV  C T    +  R  +AP      SS G   D N S+++E++ 
Sbjct  7    MISLSPSSFLNKT-TGVPGCSTHLSLRQPRLVTAPASFRVFSSLGSNRDPNGSVLIETSA  65

Query  400  KEVTESVPVVEKE--AKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               + S+     +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  66   TSSSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  123



>ref|XP_010325075.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Solanum 
lycopersicum]
Length=591

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+T    V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLRDPH
Sbjct  1    MESTLKELTNGESVLDIKDKCGVAGGVEDIYGEDRATEDQTITPWTFSVASGYSLLRDPH  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_007015740.1| NADP-malic enzyme 4 isoform 2 [Theobroma cacao]
 gb|EOY33359.1| NADP-malic enzyme 4 isoform 2 [Theobroma cacao]
Length=563

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 9/119 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESA--  396
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN S+V+E++  
Sbjct  1    MISLHKSCFLNNTGISGSSSPF----SYKLKKLPPASLKVAALGPNRDRNNSVVIENSNT  56

Query  397  LKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            LKE+ E  +  V +  + STV GG  D Y +D ATEDQ++TPW++SVASGY+LLRDPH+
Sbjct  57   LKEIREEGTSSVADVNSNSTVTGGDRDVYYDDAATEDQLVTPWSISVASGYSLLRDPHH  115



>ref|XP_004486781.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Cicer arietinum]
Length=641

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 7/116 (6%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIV--MESAL  399
            MIS +   F++NS  G+  C      Q++   P  V  +S      DRN S+V  ME+ L
Sbjct  1    MISSTRCNFLSNS--GLGGCGNFCGGQKKGYGPWRVTCMSPIN---DRNGSVVNVMETPL  55

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KE+ +   V + +      GG  D YGED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  56   KEIKKEAVVEDVDNNPISGGGPRDVYGEDKATEDHFVTPWSVSVASGYTLLRDPHF  111



>ref|XP_007015741.1| NADP-malic enzyme 4 isoform 3 [Theobroma cacao]
 gb|EOY33360.1| NADP-malic enzyme 4 isoform 3 [Theobroma cacao]
Length=563

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 9/119 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESA--  396
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN S+V+E++  
Sbjct  1    MISLHKSCFLNNTGISGSSSPF----SYKLKKLPPASLKVAALGPNRDRNNSVVIENSNT  56

Query  397  LKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            LKE+ E  +  V +  + STV GG  D Y +D ATEDQ++TPW++SVASGY+LLRDPH+
Sbjct  57   LKEIREEGTSSVADVNSNSTVTGGDRDVYYDDAATEDQLVTPWSISVASGYSLLRDPHH  115



>ref|XP_007015739.1| NADP-malic enzyme 4 isoform 1 [Theobroma cacao]
 gb|EOY33358.1| NADP-malic enzyme 4 isoform 1 [Theobroma cacao]
Length=645

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 9/119 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESA--  396
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN S+V+E++  
Sbjct  1    MISLHKSCFLNNTGISGSSSPF----SYKLKKLPPASLKVAALGPNRDRNNSVVIENSNT  56

Query  397  LKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            LKE+ E  +  V +  + STV GG  D Y +D ATEDQ++TPW++SVASGY+LLRDPH+
Sbjct  57   LKEIREEGTSSVADVNSNSTVTGGDRDVYYDDAATEDQLVTPWSISVASGYSLLRDPHH  115



>ref|XP_010417798.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Camelina 
sativa]
Length=654

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 6/119 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQS--QSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  399
            MISLS ++F+N + +GV  C T    +  R  +AP      SS G   D N S+++E++ 
Sbjct  7    MISLSPSSFLNKT-TGVPGCSTHLSLRQPRLVTAPASFRVFSSLGSNRDPNGSVLIETSA  65

Query  400  KEVTESVPVVEKE---AKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               + S           KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  66   TSSSSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  124



>ref|XP_007216983.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
 gb|EMJ18182.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
Length=589

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES L+EV +   VVE   KSTV GGV D YGEDTATEDQ +TPW+VSVASGYTL+RDPH
Sbjct  1    MESTLQEVKDESSVVE--LKSTVHGGVQDVYGEDTATEDQFVTPWSVSVASGYTLIRDPH  58

Query  565  Y  567
            +
Sbjct  59   H  59



>ref|XP_010249514.1| PREDICTED: NADP-dependent malic enzyme [Nelumbo nucifera]
Length=591

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + KSTV GGV D YGED ATED ++TPWT SVASGYTLLRDPH
Sbjct  1    MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDILVTPWTFSVASGYTLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_006364722.1| PREDICTED: NADP-dependent malic enzyme-like [Solanum tuberosum]
Length=591

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE++    V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLRDPH
Sbjct  1    MESTLKELSNGESVLDIKDKCGVAGGVEDMYGEDRATEDQTITPWTFSVASGYSLLRDPH  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|NP_178093.1| NADP-malic enzyme 4 [Arabidopsis thaliana]
 sp|Q9CA83.1|MAOP4_ARATH RecName: Full=NADP-dependent malic enzyme 4, chloroplastic; Short=AtNADP-ME4; 
Short=NADP-malic enzyme 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52235.1|AC011717_3 putative malate oxidoreductase; 93001-96525 [Arabidopsis thaliana]
 gb|AAL31209.1| At1g79750/F19K16_27 [Arabidopsis thaliana]
 gb|AAM98328.1| At1g79750/F19K16_27 [Arabidopsis thaliana]
 gb|AEE36294.1| NADP-malic enzyme 4 [Arabidopsis thaliana]
Length=646

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSL-SGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES-AL  399
            MISL+ + F+N ++  G S  L+  Q +   + P  +   SS G   D   S+++E+ A 
Sbjct  1    MISLTPSLFLNKTVVPGCSTRLSLRQPRTIITPPASLRVFSSLGSNQDPTGSVLIETTAT  60

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               +      +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  61   SSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  116



>ref|XP_004510309.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Cicer arietinum]
Length=634

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 12/115 (10%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            MIS   + F+ NS + G   C  + +   R      V   + + R GDR  SIVME+   
Sbjct  1    MISSKTSTFLCNSGIGGWFSCSNERKCYLR------VKCSAPSKRSGDRPISIVMET---  51

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
              + S  V + +   T+ GGV D YGED A+EDQ +TPW+VSVASGYTLLRDPH+
Sbjct  52   --SHSSTVADVDDNPTIGGGVRDVYGEDRASEDQSVTPWSVSVASGYTLLRDPHF  104



>gb|AAF68116.1|AC010793_11 F20B17.18 [Arabidopsis thaliana]
Length=663

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +1

Query  226  MISLSGTAFMNNSL-SGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES-AL  399
            MISL+ + F+N ++  G S  L+  Q +   + P  +   SS G   D   S+++E+ A 
Sbjct  1    MISLTPSLFLNKTVVPGCSTRLSLRQPRTIITPPASLRVFSSLGSNQDPTGSVLIETTAT  60

Query  400  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
               +      +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  61   SSSSLETSAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  116



>ref|XP_002324450.1| hypothetical protein POPTR_0018s09380g [Populus trichocarpa]
 gb|EEF03015.1| hypothetical protein POPTR_0018s09380g [Populus trichocarpa]
Length=591

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + KSTV GGV D YGED ATEDQ++TPWT+SVASG+TLLRDP 
Sbjct  1    MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGFTLLRDPQ  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_007018504.1| NADP-dependent malic enzyme [Theobroma cacao]
 gb|EOY15729.1| NADP-dependent malic enzyme [Theobroma cacao]
Length=591

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+     V++ + KSTV GGV D YGED ATEDQ++TPWT SVASGY+LLRDPH
Sbjct  1    MESTMKEMRGGASVLDMDPKSTVGGGVEDVYGEDCATEDQLVTPWTYSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_010915357.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Elaeis guineensis]
Length=640

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 69/115 (60%), Gaps = 6/115 (5%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            MISL  + F+     G        +SQ+  SA  VV      G    +   + MES LKE
Sbjct  1    MISLRASHFLRCEERG-----RLYRSQQGSSAVGVVVRCCVRGGTDGKVRGVAMESTLKE  55

Query  406  VTESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +    P V++ + KSTV GGV D YGED ATE+Q++TPWT+SVASGY+LLRDPH+
Sbjct  56   IRGDKPSVLDMDPKSTVGGGVEDVYGEDRATEEQLVTPWTLSVASGYSLLRDPHH  110



>gb|KDO66544.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
 gb|KDO66545.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=461

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>emb|CBI28009.3| unnamed protein product [Vitis vinifera]
Length=591

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK++ +   V++ + K+TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRDP 
Sbjct  1    MESTLKDIRDGASVLDLDPKATVGGGVEDLYGEDFATEDQLVTPWTVSVASGYSLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|NP_001268142.1| NADP-dependent malic enzyme [Vitis vinifera]
 sp|P51615.1|MAOX_VITVI RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME [Vitis 
vinifera]
 gb|AAA67087.1| malate dehydrogenase (NADP+) [Vitis vinifera]
Length=591

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK++ +   V++ + K+TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRDP 
Sbjct  1    MESTLKDIRDGASVLDLDPKATVGGGVEDLYGEDFATEDQLVTPWTVSVASGYSLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_006451274.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 gb|ESR64514.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 gb|KDO66543.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=477

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_004135668.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
 gb|KGN66170.1| Malic enzyme [Cucumis sativus]
Length=591

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + K+TV GGV D YGED ATE+Q++TPWT SVASGY+LLRDPH
Sbjct  1    MESTLKEIGDGGSVLDLDPKATVGGGVEDIYGEDCATEEQLVTPWTFSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_008450776.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=591

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+ +   V++ + K+TV GGV D YGED ATE+Q++TPWT SVASGY+LLRDPH
Sbjct  1    MESTLKEIGDGGSVLDLDPKATVGGGVEDIYGEDCATEEQLVTPWTFSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_009801542.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  379  IVMESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            +VMES LKE++ +   V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLR
Sbjct  31   VVMESTLKEISSNGDSVLDMKDKCGVAGGVEDMYGEDRATEDQPITPWTFSVASGYSLLR  90

Query  556  DPHY  567
            DPHY
Sbjct  91   DPHY  94



>gb|KDO66539.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
 gb|KDO66540.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=521

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_010915364.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Elaeis guineensis]
Length=592

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE+    P V++ + KSTV GGV D YGED ATE+Q++TPWT+SVASGY+LLRDP
Sbjct  1    MESTLKEIRGDKPSVLDMDPKSTVGGGVEDVYGEDRATEEQLVTPWTLSVASGYSLLRDP  60

Query  562  HY  567
            H+
Sbjct  61   HH  62



>gb|KDO66538.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=519

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>gb|KDO66541.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
 gb|KDO66542.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=516

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_004287468.2| PREDICTED: NADP-dependent malic enzyme [Fragaria vesca subsp. 
vesca]
Length=640

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            + M+S LKE+ + V  ++ ++KS V GGV D YGED ATEDQ++TPWT SVASGY+LLRD
Sbjct  48   VRMDSTLKEMRDGVSALDLDSKSAVGGGVEDIYGEDAATEDQLVTPWTYSVASGYSLLRD  107

Query  559  PHY  567
            P Y
Sbjct  108  PQY  110



>gb|KDO66536.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=590

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_006451273.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 ref|XP_006475558.1| PREDICTED: NADP-dependent malic enzyme-like [Citrus sinensis]
 gb|ESR64513.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 gb|KDO66533.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
 gb|KDO66534.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=591

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>gb|KDO66532.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=592

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>gb|KDO66535.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=559

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVASGY LLRDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVASGYCLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_009616523.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nicotiana 
tomentosiformis]
Length=624

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  379  IVMESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            +VMES LKE+T +   V++ + K  V GGV D YGED ATEDQ ITPWT SVASGY+LLR
Sbjct  31   VVMESTLKEITSNGDSVLDMKDKCGVGGGVEDMYGEDRATEDQPITPWTFSVASGYSLLR  90

Query  556  DPHY  567
            DPHY
Sbjct  91   DPHY  94



>ref|XP_009801541.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  379  IVMESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            +VMES LKE++ +   V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLR
Sbjct  47   VVMESTLKEISSNGDSVLDMKDKCGVAGGVEDMYGEDRATEDQPITPWTFSVASGYSLLR  106

Query  556  DPHY  567
            DPHY
Sbjct  107  DPHY  110



>gb|ABS32243.1| NADP-malic enzyme [Flaveria trinervia]
Length=612

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = +1

Query  340  VSSNGRPGDRNASIVMESALKEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQ  504
            ++SN  P +RN S+ ++SA+++V   V V     V ++  + V GGV D YGEDTATEDQ
Sbjct  3    LNSNSLP-ERNVSVSVDSAVRDVNAPVAVEVDRSVGEKPFAAVGGGVEDMYGEDTATEDQ  61

Query  505  VITPWTVSVASGYTLLRDPHY  567
             ITPW+VSVASGY+LLRDPH+
Sbjct  62   YITPWSVSVASGYSLLRDPHH  82



>ref|XP_006389736.1| hypothetical protein EUTSA_v10018247mg [Eutrema salsugineum]
 gb|ESQ27022.1| hypothetical protein EUTSA_v10018247mg [Eutrema salsugineum]
Length=644

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 12/120 (10%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP----KVVAAVSSNGRPGDRNASIVMES  393
            MISLS ++F+N      S   +  Q + R S+P    +V +A+ SN  P   N S+++E+
Sbjct  1    MISLSASSFLNKP---GSTHFSLRQPRTRISSPPAFFRVFSALGSNRDP---NGSVLIET  54

Query  394  ALKEVTESVPVVEKE--AKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
                 +        +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH+
Sbjct  55   TASSSSSLETSAAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPHH  114



>ref|XP_002298241.2| malate oxidoreductase family protein [Populus trichocarpa]
 gb|EEE83046.2| malate oxidoreductase family protein [Populus trichocarpa]
Length=649

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKV-----VAAVSSNGRPGDRNASIVME  390
            M+SL+ + F++N+  G+S   +     +R S P V     V AV+SN    DRN S++ E
Sbjct  1    MMSLNRSIFLSNA--GISSSSSPFTGGKRGSVPSVPSSLRVVAVNSNR---DRNGSVLTE  55

Query  391  SALKEVTESVPVVEKEA----KSTVA-GGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            +  K+V +             KSTVA GG  D YGED ATE+QV+TPW VSVASGY+LLR
Sbjct  56   TTRKDVRDGAASSSSVIDVDSKSTVAPGGPHDVYGEDAATEEQVVTPWFVSVASGYSLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>ref|XP_010095359.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB59778.1| NADP-dependent malic enzyme [Morus notabilis]
Length=1017

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK++ +   V++ + KSTV GGV D YGED ATEDQ++TPWT SVASG++LLRDP 
Sbjct  456  MESTLKDIRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTSSVASGFSLLRDPQ  515

Query  565  Y  567
            Y
Sbjct  516  Y  516



>ref|XP_008242501.1| PREDICTED: NADP-dependent malic enzyme [Prunus mume]
Length=668

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKS-TVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MESA KE+ E   V++   KS  V GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP
Sbjct  77   MESAFKELGEKASVLDFVPKSAVVGGGVEDIYGEDTATEDQLVTPWTYSVASGYSLLRDP  136

Query  562  HY  567
             Y
Sbjct  137  QY  138



>ref|XP_003597680.1| Malic enzyme, partial [Medicago truncatula]
Length=543

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  304  QRRFSAPKVVAAVSSNGRPGDRNASIV--MESALKEVTESVPVVEKEAKSTVAGGVGDFY  477
            QRR   P  V  +S      DRN S+V  ME+ LKE+ +   V + +      GG  D Y
Sbjct  59   QRRGYGPWRVTCMSP---INDRNGSVVNVMETPLKEIKKEAVVEDVDDNPISGGGPRDVY  115

Query  478  GEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            GED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  116  GEDKATEDHFVTPWSVSVASGYTLLRDPHF  145



>ref|XP_002514230.1| malic enzyme, putative [Ricinus communis]
 gb|EEF48184.1| malic enzyme, putative [Ricinus communis]
Length=591

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+     V++ + KSTV GGV D YGED ATEDQ++TPWT SVASGY+LLRDP 
Sbjct  1    MESTMKEMRGGASVLDMDPKSTVGGGVEDVYGEDCATEDQLVTPWTTSVASGYSLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_002303310.2| malate oxidoreductase family protein, partial [Populus trichocarpa]
 gb|EEE78289.2| malate oxidoreductase family protein, partial [Populus trichocarpa]
Length=590

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 5/73 (7%)
 Frame = +1

Query  364  DRNASIVMESALKEVTESVPVVEKEA----KSTVA-GGVGDFYGEDTATEDQVITPWTVS  528
            DRN+S++MES  K+V +             KS +A GG  D YGEDTATEDQV+TPW VS
Sbjct  1    DRNSSVLMESTFKDVRDGAVSSSSVIDVDSKSNIAPGGPADVYGEDTATEDQVVTPWFVS  60

Query  529  VASGYTLLRDPHY  567
            VASGY+LLRDPH+
Sbjct  61   VASGYSLLRDPHH  73



>ref|XP_008447551.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
 ref|XP_008447552.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=647

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVS-KCLTQSQS-QRRFSAPKVVAAVSSNGRPGDRNASIVME-SA  396
            MISL+ T F+     GVS  C T S +  RR  A KVV+ + SNGR G+R+ S+++E S 
Sbjct  1    MISLNRTTFLTQM--GVSGACSTPSGTGNRRPMALKVVS-MDSNGRAGERSGSVLVENST  57

Query  397  LKEVTES-VPVVEKEAKSTVAGGVGDFYGEDTAT--EDQVITPWTVSVASGYTLLRDPHY  567
            +KE+ +   PVVE E KST      D Y ED+A   ++Q++TPW+VSVASGY LLRDP +
Sbjct  58   VKEIAKPPSPVVEVEPKSTAGSWAQDAYVEDSAAAMDEQIMTPWSVSVASGYNLLRDPRH  117



>gb|KEH39548.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=653

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  304  QRRFSAPKVVAAVSSNGRPGDRNASIV--MESALKEVTESVPVVEKEAKSTVAGGVGDFY  477
            QRR   P  V  +S      DRN S+V  ME+ LKE+ +   V + +      GG  D Y
Sbjct  25   QRRGYGPWRVTCMSP---INDRNGSVVNVMETPLKEIKKEAVVEDVDDNPISGGGPRDVY  81

Query  478  GEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            GED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  82   GEDKATEDHFVTPWSVSVASGYTLLRDPHF  111



>gb|AES67931.2| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=665

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  304  QRRFSAPKVVAAVSSNGRPGDRNASIV--MESALKEVTESVPVVEKEAKSTVAGGVGDFY  477
            QRR   P  V  +S      DRN S+V  ME+ LKE+ +   V + +      GG  D Y
Sbjct  25   QRRGYGPWRVTCMSP---INDRNGSVVNVMETPLKEIKKEAVVEDVDDNPISGGGPRDVY  81

Query  478  GEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            GED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  82   GEDKATEDHFVTPWSVSVASGYTLLRDPHF  111



>dbj|BAJ51944.1| NADP-dependent malic enzyme [Nicotiana benthamiana]
Length=532

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTES-VPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE++ +   V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLRDP
Sbjct  1    MESTLKEISSNGDSVLDMKDKCGVAGGVEDMYGEDRATEDQPITPWTFSVASGYSLLRDP  60

Query  562  HY  567
            HY
Sbjct  61   HY  62



>gb|AAK83073.1|AF288920_1 putative cytosolic NADP-malic enzyme [Flaveria pringlei]
Length=589

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK++ E   VV+    S V GGV D YGED A+EDQ+ITPWTVSVASGYTLLRDPH
Sbjct  1    MESILKQMKEGESVVD--PSSAVGGGVDDVYGEDRASEDQLITPWTVSVASGYTLLRDPH  58

Query  565  Y  567
            +
Sbjct  59   H  59



>ref|XP_007160295.1| hypothetical protein PHAVU_002G309600g [Phaseolus vulgaris]
 gb|ESW32289.1| hypothetical protein PHAVU_002G309600g [Phaseolus vulgaris]
Length=650

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPWT SVASGY+LLRDP 
Sbjct  60   MESTLKSLRDGESVLDLSPRSTVSGGVEDVYGEDRATEDQLVTPWTFSVASGYSLLRDPQ  119

Query  565  Y  567
            Y
Sbjct  120  Y  120



>gb|KEH39546.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=675

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  304  QRRFSAPKVVAAVSSNGRPGDRNASIV--MESALKEVTESVPVVEKEAKSTVAGGVGDFY  477
            QRR   P  V  +S      DRN S+V  ME+ LKE+ +   V + +      GG  D Y
Sbjct  59   QRRGYGPWRVTCMSPIN---DRNGSVVNVMETPLKEIKKEAVVEDVDDNPISGGGPRDVY  115

Query  478  GEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            GED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  116  GEDKATEDHFVTPWSVSVASGYTLLRDPHF  145



>ref|XP_009373433.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=273

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  421  PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            P V+ + KSTV GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP Y
Sbjct  80   PTVKIDPKSTVGGGVEDVYGEDTATEDQLVTPWTYSVASGYSLLRDPQY  128



>gb|KEH39547.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=669

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  304  QRRFSAPKVVAAVSSNGRPGDRNASIV--MESALKEVTESVPVVEKEAKSTVAGGVGDFY  477
            QRR   P  V  +S      DRN S+V  ME+ LKE+ +   V + +      GG  D Y
Sbjct  25   QRRGYGPWRVTCMSPIN---DRNGSVVNVMETPLKEIKKEAVVEDVDDNPISGGGPRDVY  81

Query  478  GEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            GED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  82   GEDKATEDHFVTPWSVSVASGYTLLRDPHF  111



>ref|XP_004503480.1| PREDICTED: NADP-dependent malic enzyme-like [Cicer arietinum]
Length=591

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPWT SVASGY+LLRDP 
Sbjct  1    MESTLKSLRDGESVLDLSPRSTVSGGVEDVYGEDRATEDQLVTPWTFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_009801543.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009801544.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009801545.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
Length=592

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE++ +   V++ + K  VAGGV D YGED ATEDQ ITPWT SVASGY+LLRDP
Sbjct  1    MESTLKEISSNGDSVLDMKDKCGVAGGVEDMYGEDRATEDQPITPWTFSVASGYSLLRDP  60

Query  562  HY  567
            HY
Sbjct  61   HY  62



>gb|KDP33810.1| hypothetical protein JCGZ_07381 [Jatropha curcas]
Length=589

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+     V+E   KSTV GGV D YGED ATEDQ++TPWT+SVASGY+LLRDP 
Sbjct  1    MESTLKEIRGGASVLE--PKSTVGGGVEDVYGEDHATEDQLVTPWTISVASGYSLLRDPR  58

Query  565  Y  567
            +
Sbjct  59   H  59



>ref|XP_009616524.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009616525.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009616526.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
Length=592

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE+T +   V++ + K  V GGV D YGED ATEDQ ITPWT SVASGY+LLRDP
Sbjct  1    MESTLKEITSNGDSVLDMKDKCGVGGGVEDMYGEDRATEDQPITPWTFSVASGYSLLRDP  60

Query  562  HY  567
            HY
Sbjct  61   HY  62



>ref|XP_010430068.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Camelina sativa]
Length=653

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = +1

Query  226  MISLS-GTAFMNNSLSGVSKCLTQS--QSQRRFSAPKVVAAVSSNGRPG---DRNASIVM  387
            MISLS  ++F+N S +GV  C T    +  R  +AP   ++       G   D + S+++
Sbjct  7    MISLSPSSSFLNKS-TGVPGCSTHLSLRQPRLVTAPASSSSFRVFSSLGSNRDPHGSVLI  65

Query  388  ESALKEV-TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            E++   + T +  VV    KSTV+GGV D YGED ATED  ITPW++SVASGYTLLRDPH
Sbjct  66   ETSATPLDTSAADVV---PKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLLRDPH  122

Query  565  Y  567
            +
Sbjct  123  H  123



>ref|XP_011092518.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Sesamum 
indicum]
Length=620

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +1

Query  325  KVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQ  504
            + +  V   GR  +R   +VMES  KE+     V++ E K+ V GGV D YGED A+EDQ
Sbjct  12   QAIGVVGLYGRR-ERKIRVVMESTFKEMNGE-SVLDLEDKAGVGGGVEDVYGEDRASEDQ  69

Query  505  VITPWTVSVASGYTLLRDPHY  567
             ITPWTVSVASGYTLLRDP +
Sbjct  70   AITPWTVSVASGYTLLRDPRH  90



>gb|KJB06731.1| hypothetical protein B456_001G008900 [Gossypium raimondii]
Length=591

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+     V++   K+TV GGV D YGED ATE+Q++TPWT SVASGY+LLRDPH
Sbjct  1    MESTLKEMRGGESVLDLSPKATVGGGVEDVYGEDFATEEQLVTPWTYSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_010648278.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Vitis vinifera]
Length=619

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 58/94 (62%), Gaps = 8/94 (9%)
 Frame = +1

Query  286  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  465
            L +  SQ    A K +A + S G  G+R   + M S        V  ++ E KS   GGV
Sbjct  4    LHRPNSQLLSLAGKSLALLVSGG--GERKVRVAMAS------NGVSGLDMEKKSGGGGGV  55

Query  466  GDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             D YGED+ATEDQ++TPWTVSVASGYTLLRDPH+
Sbjct  56   EDIYGEDSATEDQLVTPWTVSVASGYTLLRDPHH  89



>ref|XP_004150784.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58034.1| Malic enzyme [Cucumis sativus]
Length=647

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVS-KCLTQSQS-QRRFSAPKVVAAVSSNGRPGDRNASIVMES-A  396
            MISL+ T+F+     GVS  C T S +  RR  A KVV+ + SNGR GDR+ S+++E+  
Sbjct  1    MISLNRTSFLTQM--GVSGPCSTPSGTGNRRPMALKVVS-MDSNGRAGDRSGSVLVENNT  57

Query  397  LKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTA--TEDQVITPWTVSVASGYTLLRDPHY  567
            +KE+ +   PVVE E KST      D Y ED+A    +Q++TPW++SVASGY LLRDP +
Sbjct  58   VKEIAKPPSPVVEVEPKSTAGAWPQDAYVEDSAPAMNEQIMTPWSLSVASGYNLLRDPRH  117



>gb|ABS32242.1| NADP-malic enzyme [Flaveria floridana]
Length=604

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 5/73 (7%)
 Frame = +1

Query  364  DRNASIVMESALKEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVS  528
            +RN ++ ++SA+++V   V V     V ++  + V GGV D YGEDTATEDQ ITPW+VS
Sbjct  2    ERNVNVSVDSAVRDVNAPVAVEVDRSVGEKPFAVVGGGVEDMYGEDTATEDQYITPWSVS  61

Query  529  VASGYTLLRDPHY  567
            VASGY+LLRDPH+
Sbjct  62   VASGYSLLRDPHH  74



>ref|XP_008362959.1| PREDICTED: NADP-dependent malic enzyme [Malus domestica]
Length=586

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  421  PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            P V+ + KSTV GGV D YGEDTATEDQ+ITPWT SVASGY+LLRDP Y
Sbjct  8    PTVKIDPKSTVGGGVEDVYGEDTATEDQLITPWTYSVASGYSLLRDPQY  56



>ref|XP_007222062.1| hypothetical protein PRUPE_ppa003210mg [Prunus persica]
 gb|EMJ23261.1| hypothetical protein PRUPE_ppa003210mg [Prunus persica]
Length=592

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTES-VPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            M S LKE+      V + E+K+ + GGV D YGED ATEDQV+TPWT SVASGYTLLRDP
Sbjct  1    MGSLLKEIRNGGHSVADTESKAGLGGGVEDVYGEDCATEDQVLTPWTASVASGYTLLRDP  60

Query  562  HY  567
            HY
Sbjct  61   HY  62



>ref|XP_011093633.1| PREDICTED: NADP-dependent malic enzyme [Sesamum indicum]
Length=591

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE      V++   +STV GGV D YGED A+EDQ++TPWT+SVASGY LLRDPH
Sbjct  1    MESFLKEQRGGECVLDLSPRSTVGGGVEDVYGEDRASEDQLVTPWTISVASGYNLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_006580482.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Glycine 
max]
Length=600

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (59%), Gaps = 5/99 (5%)
 Frame = +1

Query  271  GVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKST  450
            G S C   + S+R+ S  +       N     +     MES LK + +   V++   +ST
Sbjct  10   GFSGCCGTNSSKRKISKDQ-----HYNTGEDKKVIGREMESTLKALRDGESVLDLSPRST  64

Query  451  VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V+GGV D YGED ATEDQ++TPW  SVASGY+LLRDP Y
Sbjct  65   VSGGVEDIYGEDRATEDQLVTPWIFSVASGYSLLRDPQY  103



>ref|XP_003533042.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=641

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = +1

Query  226  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRF--SAPKVVAAVSSNGRPGDRNASIVMESA  396
            M S +  +FM    + G S C   S SQR+   S+ ++     +N +    +  +VME+ 
Sbjct  1    MFSSNAYSFMCKPGIGGWSSCSNLSASQRKLLGSSSRITCCAPTNSK---SHGGVVMEN-  56

Query  397  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
              E   S  V + +     +GGV D YGED ATEDQ +TPW++SVASGY+LLRDPHY
Sbjct  57   --ETNGSSTVDDFDVNPIPSGGVRDVYGEDKATEDQFVTPWSISVASGYSLLRDPHY  111



>gb|ABK94851.1| unknown [Populus trichocarpa]
Length=649

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 74/124 (60%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKV-----VAAVSSNGRPGDRNASIVME  390
            M+SL+ + F++N+  G+S   +     +R S P V     V AV+SN    DRN S++ E
Sbjct  1    MMSLNRSIFLSNA--GISSSSSPFTGGQRGSVPSVPSSLRVVAVNSNR---DRNGSVLTE  55

Query  391  SALKEVTESVPVVEKEA----KSTVA-GGVGDFYGEDTATEDQVITPWTVSVASGYTLLR  555
            +  K+V +             KSTVA GG  D Y ED ATE+QV+TPW VSVASGY+LLR
Sbjct  56   TTRKDVRDGAASSSSVIDVDSKSTVAPGGPHDVYSEDAATEEQVVTPWFVSVASGYSLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>ref|XP_003525285.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Glycine 
max]
Length=633

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (59%), Gaps = 5/99 (5%)
 Frame = +1

Query  271  GVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKST  450
            G S C   + S+R+ S  +       N     +     MES LK + +   V++   +ST
Sbjct  10   GFSGCCGTNSSKRKISKDQ-----HYNTGEDKKVIGREMESTLKALRDGESVLDLSPRST  64

Query  451  VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V+GGV D YGED ATEDQ++TPW  SVASGY+LLRDP Y
Sbjct  65   VSGGVEDIYGEDRATEDQLVTPWIFSVASGYSLLRDPQY  103



>gb|KHN41665.1| NADP-dependent malic enzyme [Glycine soja]
Length=591

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPW  SVASGY+LLRDP 
Sbjct  1    MESTLKALRDGESVLDLSPRSTVSGGVEDIYGEDRATEDQLVTPWIFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>emb|CDP08185.1| unnamed protein product [Coffea canephora]
Length=622

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  364  DRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGY  543
            +R  S VMES LKE+     V++   +  V GGVGD YGED ATEDQ++TPW+ ++ASG+
Sbjct  25   ERKISGVMESTLKEMRNGESVLDMTDERGVGGGVGDIYGEDRATEDQLLTPWSFTIASGH  84

Query  544  TLLRDPHY  567
            +LLRDP Y
Sbjct  85   SLLRDPRY  92



>ref|XP_004969796.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Setaria 
italica]
Length=652

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +   ++  V++ +  +TVAGGVGD YGED ATEDQ++TPWTVSVASGY L+RD
Sbjct  60   MESTLKGIRGCDAPSVLDMDDAATVAGGVGDTYGEDCATEDQLVTPWTVSVASGYNLMRD  119

Query  559  PHY  567
            P Y
Sbjct  120  PRY  122



>ref|XP_007152912.1| hypothetical protein PHAVU_004G170800g [Phaseolus vulgaris]
 gb|ESW24906.1| hypothetical protein PHAVU_004G170800g [Phaseolus vulgaris]
Length=591

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ+ITPW  SVASGY+LLRDP 
Sbjct  1    MESILKPLRDGESVLDLSPRSTVSGGVEDVYGEDHATEDQLITPWNFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>gb|AAK83074.1|AF288921_1 putative cytosolic NADP-malic enzyme [Flaveria pringlei]
Length=589

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            M S LK++ E   VV+    S V GGV D YGED A+EDQ+ITPWTVSVASGYTLLRDPH
Sbjct  1    MASTLKQMKEGESVVDH--SSAVGGGVDDVYGEDRASEDQLITPWTVSVASGYTLLRDPH  58

Query  565  Y  567
            +
Sbjct  59   H  59



>ref|XP_009779848.1| PREDICTED: NADP-dependent malic enzyme [Nicotiana sylvestris]
Length=591

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALKE      V++   ++T AGGV D YGED ATEDQ+ITPWT++V+SGY LLRDP 
Sbjct  1    MESALKEQRGGESVLDLSPRATPAGGVEDVYGEDCATEDQLITPWTIAVSSGYNLLRDPR  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>gb|KHN16969.1| NADP-dependent malic enzyme [Glycine soja]
Length=600

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPW  SVASGY+LLRDP 
Sbjct  1    MESTLKALRDGESVLDLSPRSTVSGGVEDVYGEDHATEDQLVTPWNFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_003547744.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max]
Length=591

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPW  SVASGY+LLRDP 
Sbjct  1    MESTLKALRDGESVLDLSPRSTVSGGVEDVYGEDHATEDQLVTPWNFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>gb|ABI98681.2| cytosolic NADP-malic enzyme [Nicotiana tabacum]
Length=591

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALKE      V++   ++T AGGV D YGED ATEDQ+ITPWT++V+SGY LLRDP 
Sbjct  1    MESALKEQRGGESVLDLSPRATPAGGVEDVYGEDCATEDQLITPWTIAVSSGYNLLRDPR  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_009614468.1| PREDICTED: NADP-dependent malic enzyme-like [Nicotiana tomentosiformis]
Length=591

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALKE      V++   ++T AGGV D YGED ATEDQ+ITPWT++V+SGY LLRDP 
Sbjct  1    MESALKEQRGGESVLDLSPRATPAGGVEDVYGEDCATEDQLITPWTIAVSSGYNLLRDPR  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_011078255.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=591

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK       V++   + TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRDPH
Sbjct  1    MESVLKAHRGGESVLDLSPRWTVGGGVEDVYGEDCATEDQLVTPWTVSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_010915394.1| PREDICTED: NADP-dependent malic enzyme-like [Elaeis guineensis]
Length=637

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNA-SIVMESALK  402
            M+SL+   F+     G     +++   R  +A + V     + R G+ N   + MESA +
Sbjct  1    MLSLNRCCFLKCRGDGTR---SRASQWRGAAAGRPVVVRCGSRRIGEGNGRGMAMESAHE  57

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV      V  + KSTV GGV D YGED A+EDQ++TPWTVSVASGY+LLRDP +
Sbjct  58   EVE-----VLMDPKSTVGGGVEDTYGEDRASEDQLVTPWTVSVASGYSLLRDPRH  107



>gb|KHN40389.1| NADP-dependent malic enzyme [Glycine soja]
Length=578

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPW  SVASGY LLRDP 
Sbjct  1    MESTLKALRDGESVLDLSPRSTVSGGVEDVYGEDHATEDQLVTPWNFSVASGYCLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_006389737.1| hypothetical protein EUTSA_v10018247mg [Eutrema salsugineum]
 gb|ESQ27023.1| hypothetical protein EUTSA_v10018247mg [Eutrema salsugineum]
Length=652

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 14/125 (11%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGV-----SKCLTQSQSQRRFSAP----KVVAAVSSNGRPGDRNAS  378
            MISLS ++F+   L        S   +  Q + R S+P    +V +A+ SN  P   N S
Sbjct  1    MISLSASSFLFALLRFSQNKPGSTHFSLRQPRTRISSPPAFFRVFSALGSNRDP---NGS  57

Query  379  IVMESALKEVTESVPVVEKE--AKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLL  552
            +++E+     +        +   KSTV+GGV D YGED ATED  ITPW++SVASGYTLL
Sbjct  58   VLIETTASSSSSLETSAAADIVPKSTVSGGVQDVYGEDAATEDMPITPWSLSVASGYTLL  117

Query  553  RDPHY  567
            RDPH+
Sbjct  118  RDPHH  122



>ref|XP_009352546.1| PREDICTED: NADP-dependent malic enzyme [Pyrus x bretschneideri]
Length=642

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +VT+S   VE + KSTV GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP Y
Sbjct  60   KVTDST--VEIDPKSTVGGGVEDVYGEDTATEDQLVTPWTYSVASGYSLLRDPQY  112



>ref|XP_003516804.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max]
Length=591

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK + +   V++   +STV+GGV D YGED ATEDQ++TPW  SVASGY LLRDP 
Sbjct  1    MESTLKALRDGESVLDLSPRSTVSGGVEDVYGEDHATEDQLVTPWNFSVASGYCLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>gb|EYU27276.1| hypothetical protein MIMGU_mgv1a003339mg [Erythranthe guttata]
Length=591

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK       V++   +STV GGV D YGED A+EDQ++TPWTVSVASGYT+LRDPH
Sbjct  1    MESFLKMQRGGECVLDLSPRSTVGGGVEDVYGEDRASEDQLVTPWTVSVASGYTMLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_011081064.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=591

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK       V++   + TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRDPH
Sbjct  1    MESVLKAHRGGESVLDLSPRWTVGGGVEDVYGEDRATEDQLVTPWTVSVASGYSLLRDPH  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_003630727.1| Malic enzyme [Medicago truncatula]
 gb|AET05203.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=591

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK   +   V++   +S V GGV D YGED ATEDQ++TPWT SVASGY+LLRDP 
Sbjct  1    MESTLKSFRDGESVLDLSPRSAVGGGVEDVYGEDCATEDQLVTPWTFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_008337596.1| PREDICTED: NADP-dependent malic enzyme [Malus domestica]
Length=586

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +VT+S   VE + KSTV GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP Y
Sbjct  4    KVTDST--VEIDPKSTVGGGVEDVYGEDTATEDQLVTPWTYSVASGYSLLRDPQY  56



>gb|AGJ76631.1| NADP-malic enzyme 1 [Echinochloa crus-galli var. crus-galli]
Length=593

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TV GGVGD YGED ATEDQ++TPWTVSVASGY L+RD
Sbjct  1    MESTLKGIRASDAPCVLDLDDAATVGGGVGDTYGEDCATEDQLVTPWTVSVASGYNLMRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>ref|XP_007204216.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05415.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=522

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKST-VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES   E+ +   V++ + KS  V GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP
Sbjct  1    MESTFNELGDKASVLDFDPKSADVGGGVEDIYGEDTATEDQLVTPWTYSVASGYSLLRDP  60

Query  562  HY  567
             Y
Sbjct  61   QY  62



>ref|XP_010062528.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Eucalyptus 
grandis]
Length=652

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 14/125 (11%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSK-CLTQSQSQRRFSAPKVVAAVSSNGR---PGDRNASIVMES  393
            M+SL+G++F+      V K C T   ++R   A   V +  S GR     D N  ++++ 
Sbjct  1    MMSLNGSSFLRQQHPSVCKSCRTFDAARRSPVAFVRVRSGPSGGRCRVASDGNGRVLVDG  60

Query  394  ALKE------VTESVPVVEKEAKSTVAGGVG-DFYGEDTATEDQVITPWTVSVASGYTLL  552
            AL E       + S  V+E ++KS   GG G D YGED ATEDQ++TPW VSVASGY LL
Sbjct  61   ALDEDGSSSSSSSSPSVLEMDSKS---GGPGPDLYGEDRATEDQLVTPWAVSVASGYNLL  117

Query  553  RDPHY  567
            RDPH+
Sbjct  118  RDPHH  122



>gb|AFK40116.1| unknown [Medicago truncatula]
Length=591

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK   +   V++   +S V GGV D YGED ATEDQ++TPWT SVASGY+LLRDP 
Sbjct  1    MESTLKSFRDGESVLDLSPRSAVGGGVEDVYGEDCATEDQLVTPWTFSVASGYSLLRDPQ  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>ref|XP_007135635.1| hypothetical protein PHAVU_010G145500g [Phaseolus vulgaris]
 gb|ESW07629.1| hypothetical protein PHAVU_010G145500g [Phaseolus vulgaris]
Length=642

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 52/92 (57%), Gaps = 13/92 (14%)
 Frame = +1

Query  295  SQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGG-VGD  471
            S SQRR SAP  V   +S    G  +   +ME             E    ST+AGG V D
Sbjct  33   SASQRRRSAPSRVTCCASTSSSGKTHGGFLMEE------------EASGTSTIAGGGVRD  80

Query  472  FYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             YGED ATEDQ +TPW VSV+ GYTLLRDPH+
Sbjct  81   VYGEDRATEDQGVTPWNVSVSCGYTLLRDPHF  112



>ref|XP_007204214.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05413.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=494

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKST-VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES   E+ +   V++ + KS  V GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP
Sbjct  1    MESTFNELGDKASVLDFDPKSADVGGGVEDIYGEDTATEDQLVTPWTYSVASGYSLLRDP  60

Query  562  HY  567
             Y
Sbjct  61   QY  62



>gb|ABV72704.1| non-C4 NADP-dependent malic enzyme, partial [Flaveria trinervia]
Length=605

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +1

Query  355  RPGDRNASIVMESALKEVTE--SVPVVEKEAKST---VAGGVGDFYGEDTATEDQVITPW  519
            RP +R+  + ++ A+K+V    +V VV+ E+K T   V GGV D YGED+ATED  ITPW
Sbjct  1    RP-ERSVGVSVDGAVKDVNAPVAVEVVDSESKETTAVVGGGVEDVYGEDSATEDHFITPW  59

Query  520  TVSVASGYTLLRDPHY  567
            +VSVASGY+LLRDPH+
Sbjct  60   SVSVASGYSLLRDPHH  75



>ref|XP_007204217.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05416.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=592

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKST-VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES   E+ +   V++ + KS  V GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP
Sbjct  1    MESTFNELGDKASVLDFDPKSADVGGGVEDIYGEDTATEDQLVTPWTYSVASGYSLLRDP  60

Query  562  HY  567
             Y
Sbjct  61   QY  62



>ref|XP_007204218.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05417.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=599

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKST-VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES   E+ +   V++ + KS  V GGV D YGEDTATEDQ++TPWT SVASGY+LLRDP
Sbjct  1    MESTFNELGDKASVLDFDPKSADVGGGVEDIYGEDTATEDQLVTPWTYSVASGYSLLRDP  60

Query  562  HY  567
             Y
Sbjct  61   QY  62



>gb|KJB18587.1| hypothetical protein B456_003G061800 [Gossypium raimondii]
Length=581

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--AL  399
            MISL  + F+NNS    S  L   +  +    P      ++ G   D NAS+++E+  A 
Sbjct  1    MISLHRSCFLNNSGISGSSSLFSYKLNK---LPPASVKATALGPNSDTNASVLIENNNAF  57

Query  400  KEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KE+T+  +    + +   TVAGG  + Y +D ATEDQ++TPW+VSVASGY+LLRDPH+
Sbjct  58   KEITQDGTSSAADVDINLTVAGGDREVYYDDAATEDQLVTPWSVSVASGYSLLRDPHH  115



>gb|AIR93779.1| chloroplast NADP-malic enzyme [Kalanchoe fedtschenkoi]
Length=658

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 20/129 (16%)
 Frame = +1

Query  229  ISLSGTAFMNNSLSGVSKC-----LTQSQSQRRFSAPKVVAAVSSNGR--PGDRNASIVM  387
             SL+ ++F+  S SGVS C      +   ++R   A KVV+ VS+ GR    +RNA +V 
Sbjct  4    FSLNQSSFL--SCSGVSGCGKRRSFSNLDARRAGLALKVVS-VSTTGRVVTEERNA-VVE  59

Query  388  ESALKEVTESVPV--------VEKEAKS-TVAGGVGDFYGEDTATEDQVITPWTVSVASG  540
               LKE+ E+           ++KE +  TV GGV D YGED ATEDQ++TPW+V+VASG
Sbjct  60   SKKLKEMGENATAAAASTSEAIKKEGEVLTVGGGVRDVYGEDCATEDQLVTPWSVTVASG  119

Query  541  YTLLRDPHY  567
            Y+LLRDP +
Sbjct  120  YSLLRDPLH  128



>gb|KJB18586.1| hypothetical protein B456_003G061800 [Gossypium raimondii]
Length=645

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES--AL  399
            MISL  + F+NNS    S  L   +  +    P      ++ G   D NAS+++E+  A 
Sbjct  1    MISLHRSCFLNNSGISGSSSLFSYKLNK---LPPASVKATALGPNSDTNASVLIENNNAF  57

Query  400  KEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KE+T+  +    + +   TVAGG  + Y +D ATEDQ++TPW+VSVASGY+LLRDPH+
Sbjct  58   KEITQDGTSSAADVDINLTVAGGDREVYYDDAATEDQLVTPWSVSVASGYSLLRDPHH  115



>ref|XP_009367432.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Pyrus x bretschneideri]
Length=621

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            VV+ E+K+   GG+ D YGED ATEDQV+TPWT SVASGYTLLRDPHY
Sbjct  44   VVDVESKAGFGGGIEDVYGEDCATEDQVLTPWTSSVASGYTLLRDPHY  91



>ref|XP_009367431.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Pyrus x bretschneideri]
Length=652

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            VV+ E+K+   GG+ D YGED ATEDQV+TPWT SVASGYTLLRDPHY
Sbjct  44   VVDVESKAGFGGGIEDVYGEDCATEDQVLTPWTSSVASGYTLLRDPHY  91



>ref|XP_010062530.1| PREDICTED: NADP-dependent malic enzyme isoform X3 [Eucalyptus 
grandis]
 gb|KCW69674.1| hypothetical protein EUGRSUZ_F03074 [Eucalyptus grandis]
Length=649

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 74/124 (60%), Gaps = 15/124 (12%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGR---PGDRNASIVMESA  396
            M+SL+G++F++ S+     C T   ++R   A   V +  S GR     D N  ++++ A
Sbjct  1    MMSLNGSSFLHPSVC--KSCRTFDAARRSPVAFVRVRSGPSGGRCRVASDGNGRVLVDGA  58

Query  397  LKE------VTESVPVVEKEAKSTVAGGVG-DFYGEDTATEDQVITPWTVSVASGYTLLR  555
            L E       + S  V+E ++KS   GG G D YGED ATEDQ++TPW VSVASGY LLR
Sbjct  59   LDEDGSSSSSSSSPSVLEMDSKS---GGPGPDLYGEDRATEDQLVTPWAVSVASGYNLLR  115

Query  556  DPHY  567
            DPH+
Sbjct  116  DPHH  119



>ref|XP_008361018.1| PREDICTED: NADP-dependent malic enzyme-like [Malus domestica]
Length=593

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            VV+ E+K    GG+ D YGED ATEDQV+TPWT SVASGYTLLRDPHY
Sbjct  16   VVDVESKXGFGGGIEDVYGEDCATEDQVLTPWTASVASGYTLLRDPHY  63



>gb|KHN32646.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=643

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            M S +  AF++NS L G S     +Q +R  S    V +++ +     R  S+VME+ LK
Sbjct  1    MFSSTRCAFLSNSGLGGCSSLCDAAQKKR--STRLRVVSMTPSSSSSSRYGSVVMETPLK  58

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E+ +   V + +  +  AGG  D YGED ATED  +TPW+VSVASGYTLLRDPH+
Sbjct  59   ELKKESTVADVDDNAISAGGPQDVYGEDRATEDHFVTPWSVSVASGYTLLRDPHF  113



>ref|XP_008791442.1| PREDICTED: NADP-dependent malic enzyme-like [Phoenix dactylifera]
Length=637

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 66/114 (58%), Gaps = 7/114 (6%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  405
            M+SL+G++F+     GV      SQ +   +A  V+       R       + MES  +E
Sbjct  1    MLSLNGSSFLK--CRGVGTRSRGSQWRGAAAARPVLVRCGGGRRGEGNGRGMAMESTHEE  58

Query  406  VTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V E +       K+TV GGV D YGED ATEDQ++TPWTVSVASGY++LRDP +
Sbjct  59   VEELM-----NPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYSMLRDPRH  107



>ref|XP_010688309.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=584

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KSTV GGV D YGED ATEDQ++TPWTVSVASGY+LLRDPH+
Sbjct  13   KSTVGGGVRDVYGEDFATEDQLVTPWTVSVASGYSLLRDPHF  54



>ref|XP_008220114.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Prunus mume]
Length=614

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  364  DRNASIVMESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASG  540
            ++    +M S LKE+      V + E+K+   GGV D YGED ATEDQV+TPWT SVASG
Sbjct  16   EQKVGALMGSLLKEIRNGGHSVADTESKAGFGGGVEDVYGEDCATEDQVLTPWTASVASG  75

Query  541  YTLLRDPHY  567
            YTLLRDP Y
Sbjct  76   YTLLRDPRY  84



>ref|XP_010062529.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Eucalyptus 
grandis]
 gb|KCW69673.1| hypothetical protein EUGRSUZ_F03074 [Eucalyptus grandis]
Length=650

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGR---PGDRNASIVMESA  396
            M+SL+G++F+ +  S    C T   ++R   A   V +  S GR     D N  ++++ A
Sbjct  1    MMSLNGSSFLQHP-SVCKSCRTFDAARRSPVAFVRVRSGPSGGRCRVASDGNGRVLVDGA  59

Query  397  LKE------VTESVPVVEKEAKSTVAGGVG-DFYGEDTATEDQVITPWTVSVASGYTLLR  555
            L E       + S  V+E ++KS   GG G D YGED ATEDQ++TPW VSVASGY LLR
Sbjct  60   LDEDGSSSSSSSSPSVLEMDSKS---GGPGPDLYGEDRATEDQLVTPWAVSVASGYNLLR  116

Query  556  DPHY  567
            DPH+
Sbjct  117  DPHH  120



>gb|AAB17591.1| NADP-malic enzyme, partial [Flaveria bidentis]
Length=106

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNSLSGVSKCLTQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            MISL+ +    +S++G S+  TQSQS R     P V + ++SN  P +RN ++ ++SA++
Sbjct  1    MISLNSSFLERSSVAGGSR--TQSQSLRLSVRRPVVASMLNSNSLP-ERNVNVSVDSAVR  57

Query  403  EVTESVPV-----VEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVA  534
            +V   V V     V ++  + V GGV D YGEDTATEDQ ITPW+VSVA
Sbjct  58   DVNAPVAVEVDRSVGEKPFAVVGGGVEDMYGEDTATEDQYITPWSVSVA  106



>dbj|BAA74735.1| NADP-malic enzyme [Aloe arborescens]
Length=585

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  409  TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            ++S  V++ + K+TV GGV D YGED ATE+Q++TPWT+SVASGY+LLRDPH+
Sbjct  3    SDSASVLDLDTKTTVGGGVEDAYGEDQATEEQLVTPWTISVASGYSLLRDPHH  55



>gb|KJB70391.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
 gb|KJB70394.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
Length=646

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 10/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES---  393
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN+S+++E+   
Sbjct  1    MISLHRSCFLNNTGISGSSSPF----SYKLKKLPPASVKVTALGPNRDRNSSVLIENNNN  56

Query  394  ALKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             LKE+ E  +  V + +   TV G   D Y +  AT+DQ++TPW++SVASGY+LLRDPH+
Sbjct  57   PLKEIKEDGTSSVADVDPNPTVTGEDRDLYYDAAATDDQLVTPWSLSVASGYSLLRDPHH  116



>ref|XP_008220115.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Prunus mume]
Length=592

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            M S LKE+      V + E+K+   GGV D YGED ATEDQV+TPWT SVASGYTLLRDP
Sbjct  1    MGSLLKEIRNGGHSVADTESKAGFGGGVEDVYGEDCATEDQVLTPWTASVASGYTLLRDP  60

Query  562  HY  567
             Y
Sbjct  61   RY  62



>gb|EEC71406.1| hypothetical protein OsI_03572 [Oryza sativa Indica Group]
 gb|EEE55314.1| hypothetical protein OsJ_03305 [Oryza sativa Japonica Group]
Length=593

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEVT-ESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +K +  ++ P V++ +  +TV GGVGD YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTMKGIRGDNAPCVLDLDDAATVGGGVGDTYGEDCATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>gb|KJB70393.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
Length=645

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 10/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES---  393
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN+S+++E+   
Sbjct  1    MISLHRSCFLNNTGISGSSSPF----SYKLKKLPPASVKVTALGPNRDRNSSVLIENNNN  56

Query  394  ALKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             LKE+ E  +  V + +   TV G   D Y +  AT+DQ++TPW++SVASGY+LLRDPH+
Sbjct  57   PLKEIKEDGTSSVADVDPNPTVTGEDRDLYYDAAATDDQLVTPWSLSVASGYSLLRDPHH  116



>ref|XP_003631773.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Vitis vinifera]
 ref|XP_010648279.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Vitis vinifera]
Length=585

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  409  TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +  V  ++ E KS   GGV D YGED+ATEDQ++TPWTVSVASGYTLLRDPH+
Sbjct  3    SNGVSGLDMEKKSGGGGGVEDIYGEDSATEDQLVTPWTVSVASGYTLLRDPHH  55



>ref|XP_011092589.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092663.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092721.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092791.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
Length=590

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES  KE+     V++ E K+ V GGV D YGED A+EDQ ITPWTVSVASGYTLLRDP 
Sbjct  1    MESTFKEMNGE-SVLDLEDKAGVGGGVEDVYGEDRASEDQAITPWTVSVASGYTLLRDPR  59

Query  565  Y  567
            +
Sbjct  60   H  60



>ref|XP_006644644.1| PREDICTED: NADP-dependent malic enzyme-like [Oryza brachyantha]
Length=593

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEVT-ESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +K +  ++ P V++ +  +TV GGVGD YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESIMKGIRGDNAPCVLDLDDSATVGGGVGDTYGEDCATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>dbj|BAB20887.2| NADP dependent malic enzyme [Oryza sativa Japonica Group]
Length=593

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEVT-ESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +K +  ++ P V++ +  +TV GGVGD YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTMKGIRGDNAPCVLDLDDAATVGGGVGDTYGEDCATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>gb|KHG23103.1| NADP-dependent malic enzyme [Gossypium arboreum]
Length=606

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (61%), Gaps = 10/120 (8%)
 Frame = +1

Query  226  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMES---  393
            MISL  + F+NN+ +SG S       S +    P     V++ G   DRN+S+++E+   
Sbjct  1    MISLHRSCFLNNTGISGSSSPF----SYKLKKLPPASVKVTALGPNRDRNSSVLIENNNN  56

Query  394  ALKEVTE--SVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +LKE+ E  +  V + +   TV G   D Y +  A++DQ++TPW++SVASGY+LLRDPH+
Sbjct  57   SLKEIKEDGTSSVADVDPNPTVTGEDRDLYYDAAASDDQLVTPWSLSVASGYSLLRDPHH  116



>emb|CBI20568.3| unnamed protein product [Vitis vinifera]
Length=575

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  436  EAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E KS   GGV D YGED+ATEDQ++TPWTVSVASGYTLLRDPH+
Sbjct  2    EKKSGGGGGVEDIYGEDSATEDQLVTPWTVSVASGYTLLRDPHH  45



>gb|AHA11551.1| NADP-malic enzyme [Malus domestica]
Length=593

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            VV+ ++K    GG+ D YGED ATEDQV+TPWT SVASGYTLLRDPHY
Sbjct  16   VVDVDSKVGFGGGIEDVYGEDCATEDQVLTPWTASVASGYTLLRDPHY  63



>gb|ACX50497.1| NADP-dependent malic enzyme [Zea mays]
Length=608

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>emb|CDP03266.1| unnamed protein product [Coffea canephora]
Length=591

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +K++     V++   ++TV GGV D YGED ATE+Q++TPW  SVASGY LLRDP 
Sbjct  1    MESTMKDLRGGESVLDMSPRATVGGGVEDVYGEDRATEEQLVTPWVTSVASGYNLLRDPR  60

Query  565  Y  567
            Y
Sbjct  61   Y  61



>tpg|DAA57814.1| TPA: malic enzyme [Zea mays]
Length=593

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>ref|XP_009387625.1| PREDICTED: NADP-dependent malic enzyme [Musa acuminata subsp. 
malaccensis]
Length=590

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE+      V K  + TVAGGV D YGED ATE+Q++TPWTVSVASGY+LLRDP 
Sbjct  1    MESTLKELRAEGESVMK-PRCTVAGGVEDAYGEDRATEEQLVTPWTVSVASGYSLLRDPR  59

Query  565  Y  567
            +
Sbjct  60   F  60



>gb|EPS58449.1| malic enzyme [Genlisea aurea]
Length=590

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LKE+ +   V++ E K+ V GGV D YGED A+EDQ+ITPWTV+VASGY LLRDP
Sbjct  1    MESTLKEL-DGESVLDLEDKTGVGGGVRDVYGEDKASEDQLITPWTVTVASGYALLRDP  58



>ref|NP_001152396.1| LOC100286036 [Zea mays]
 gb|ACG47397.1| NADP-dependent malic enzyme [Zea mays]
Length=593

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>gb|ACL54508.1| unknown [Zea mays]
Length=593

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>tpg|DAA57813.1| TPA: malic enzyme [Zea mays]
Length=571

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>gb|EYU20414.1| hypothetical protein MIMGU_mgv1a003353mg [Erythranthe guttata]
Length=590

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  MESALKEVT-ESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES +KE+T ESV  ++ E K+ VAGGV D YGED ATEDQ ITPWTVSVA G TLLRDP
Sbjct  1    MESTMKELTGESV--LDLEDKAGVAGGVEDVYGEDRATEDQPITPWTVSVACGNTLLRDP  58

Query  562  HY  567
             +
Sbjct  59   RH  60



>tpg|DAA57815.1| TPA: malic enzyme [Zea mays]
Length=664

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES LK +  +++  V++ +  +TVAGGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  72   MESTLKGIRGSDAPCVLDLDDAATVAGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  131

Query  559  PHY  567
            P Y
Sbjct  132  PRY  134



>ref|XP_010102421.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB93406.1| NADP-dependent malic enzyme [Morus notabilis]
Length=736

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            I+ E  +    +SVP +         GGV D YGEDTAT DQ++TPWTVSVASGYTLLRD
Sbjct  144  IIQEEKMMNGGDSVPEILDSKSGGYGGGVEDVYGEDTATVDQLVTPWTVSVASGYTLLRD  203

Query  559  PHY  567
            PH+
Sbjct  204  PHH  206



>ref|XP_010925546.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Elaeis 
guineensis]
Length=623

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 5/63 (8%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            +VMES  +EV   +     + K+TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRD
Sbjct  36   VVMESTHEEVEALM-----DPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYSLLRD  90

Query  559  PHY  567
            P +
Sbjct  91   PRH  93



>ref|XP_010925545.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Elaeis 
guineensis]
Length=636

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 5/63 (8%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            +VMES  +EV   +     + K+TV GGV D YGED ATEDQ++TPWTVSVASGY+LLRD
Sbjct  49   VVMESTHEEVEALM-----DPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYSLLRD  103

Query  559  PHY  567
            P +
Sbjct  104  PRH  106



>gb|EMS62941.1| NADP-dependent malic enzyme [Triticum urartu]
Length=576

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEVTES-VP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +KE+     P V++ +  +TV GGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  1    MESTMKEIRGGGAPCVLDMDDAATVGGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>emb|CDM84157.1| unnamed protein product [Triticum aestivum]
Length=593

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEV--TESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +KE+    +  V++ +  +TV GGV D YGED ATE+Q +TPWTVSVASGY LLRD
Sbjct  1    MESTMKEIRGVGAPCVLDMDDAATVGGGVEDTYGEDRATEEQFVTPWTVSVASGYNLLRD  60

Query  559  PHY  567
            P Y
Sbjct  61   PRY  63



>ref|XP_003627038.1| Malic enzyme [Medicago truncatula]
Length=604

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V + +   T+AGGV D YGED ATEDQ +TPW+V+VASGYTLLRDPH+
Sbjct  11   VADIDDNPTIAGGVRDVYGEDRATEDQFVTPWSVTVASGYTLLRDPHF  58



>ref|XP_006353488.1| PREDICTED: NADP-dependent malic enzyme-like [Solanum tuberosum]
Length=589

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            M+S ++E +E+V  ++    STV GGV D YGED ATEDQ+ITPWT  V+SGY LLRDP 
Sbjct  1    MDSKMEEKSEAV--LDMSPTSTVGGGVEDIYGEDRATEDQLITPWTFVVSSGYNLLRDPR  58

Query  565  Y  567
            Y
Sbjct  59   Y  59



>gb|AET01514.2| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=588

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            V + +   T+AGGV D YGED ATEDQ +TPW+V+VASGYTLLRDPH+
Sbjct  11   VADIDDNPTIAGGVRDVYGEDRATEDQFVTPWSVTVASGYTLLRDPHF  58



>ref|XP_004251632.1| PREDICTED: NADP-dependent malic enzyme [Solanum lycopersicum]
Length=589

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            M+S +KE +E+V  ++   KSTV GGV D YGED ATE+Q+ITPW   V+SGY LLRDP 
Sbjct  1    MDSKMKEKSEAV--LDMSPKSTVEGGVEDIYGEDCATENQLITPWAFVVSSGYNLLRDPR  58

Query  565  Y  567
            Y
Sbjct  59   Y  59



>ref|XP_010526435.1| PREDICTED: NADP-dependent malic enzyme 1 isoform X1 [Tarenaya 
hassleriana]
Length=485

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES  KEV      +  ++ S+V GGVGDFYGED+A+ +  +TPWT+SVASGYTLLRDP 
Sbjct  1    MESTAKEVKGRESELHVDSGSSVNGGVGDFYGEDSASVEHSVTPWTLSVASGYTLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>sp|P37222.1|MAOC_SOLLC RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME, 
partial [Solanum lycopersicum]
 gb|AAA34174.1| malate dehydrogenase, partial [Solanum lycopersicum]
Length=573

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +STV GGV D YGED+ATEDQ ITPWT+SVASG++LLR+PHY
Sbjct  4    ESTVTGGVQDVYGEDSATEDQSITPWTLSVASGFSLLRNPHY  45



>ref|XP_010526436.1| PREDICTED: NADP-dependent malic enzyme 1 isoform X2 [Tarenaya 
hassleriana]
Length=596

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES  KEV      +  ++ S+V GGVGDFYGED+A+ +  +TPWT+SVASGYTLLRDP 
Sbjct  1    MESTAKEVKGRESELHVDSGSSVNGGVGDFYGEDSASVEHSVTPWTLSVASGYTLLRDPR  60

Query  565  Y  567
            +
Sbjct  61   H  61



>ref|XP_010668641.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 8/62 (13%)
 Frame = +1

Query  382  VMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            VM S L E+T           + VAGGV D YGED ATEDQ ITPWTVSVASGY+LLRDP
Sbjct  32   VMGSTLDEMTV--------GSNGVAGGVRDVYGEDFATEDQHITPWTVSVASGYSLLRDP  83

Query  562  HY  567
            H+
Sbjct  84   HH  85



>ref|XP_004173611.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like, 
partial [Cucumis sativus]
Length=394

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +1

Query  331  VAAVSSNGRPGDRNASIVMES-ALKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTA--TE  498
            V ++ SNGR GDR+ S+++E+  +KE+ +   PVVE E KST      D Y ED+A    
Sbjct  14   VVSMDSNGRAGDRSGSVLVENNTVKEIAKPPSPVVEVEPKSTAGAWPQDAYVEDSAPAMN  73

Query  499  DQVITPWTVSVASGYTLLRDPHY  567
            +Q++TPW++SVASGY LLRDP +
Sbjct  74   EQIMTPWSLSVASGYNLLRDPRH  96



>ref|XP_008794109.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Phoenix 
dactylifera]
Length=595

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            + MES  +EV   +     + K+TV GGV D YGED ATEDQ++TPWTVSVASGY LLRD
Sbjct  36   VAMESTHEEVEALM-----DPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYWLLRD  90

Query  559  PHY  567
            P +
Sbjct  91   PRH  93



>ref|XP_008794107.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794108.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Phoenix 
dactylifera]
Length=623

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +1

Query  379  IVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            + MES  +EV   +     + K+TV GGV D YGED ATEDQ++TPWTVSVASGY LLRD
Sbjct  36   VAMESTHEEVEALM-----DPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYWLLRD  90

Query  559  PHY  567
            P +
Sbjct  91   PRH  93



>gb|EYU30716.1| hypothetical protein MIMGU_mgv1a0033651mg, partial [Erythranthe 
guttata]
Length=518

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            ME  LKE  +     E   + TV GGV D YGED ATEDQ++TPWTVSVASGY LLRDP 
Sbjct  1    MERVLKE-EQRRGGEELSGRWTVGGGVADVYGEDRATEDQLVTPWTVSVASGYNLLRDPR  59

Query  565  Y  567
            +
Sbjct  60   H  60



>gb|EPS63619.1| malic enzyme, partial [Genlisea aurea]
Length=439

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LK       V++   +STV GGV D Y ED A+EDQ++TPWT+SVASGY++LRDP 
Sbjct  2    MESFLKNHRGGESVLDLSPRSTVGGGVEDVYCEDRASEDQLVTPWTISVASGYSMLRDPK  61

Query  565  Y  567
            +
Sbjct  62   H  62



>ref|XP_011081758.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
 ref|XP_011081759.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=590

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = +1

Query  385  MESALKEVT-ESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES  KE++ ESV  ++ + K+ + GGV D YGED A++DQ ITPWTVSVASGY+LLRDP
Sbjct  1    MESTFKELSGESV--LDLKDKTGIGGGVEDVYGEDRASQDQPITPWTVSVASGYSLLRDP  58

Query  562  HY  567
             +
Sbjct  59   RH  60



>emb|CDX85926.1| BnaC06g22080D [Brassica napus]
Length=627

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = +1

Query  340  VSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPW  519
            +SS G   D N S+++E      T + P    E    V GGV D YGED ATED  ITPW
Sbjct  51   LSSLGSKVDPNGSVLIE------TTTPP----EPSPDVTGGVQDVYGEDAATEDMPITPW  100

Query  520  TVSVASGYTLLRDPHY  567
            ++SVASGYTLLRDPH+
Sbjct  101  SLSVASGYTLLRDPHH  116



>ref|XP_009409372.1| PREDICTED: NADP-dependent malic enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=627

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  436  EAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + K+TV GGV D YGED ATE+Q++TPWT SVASGY LLRDPH+
Sbjct  54   DPKATVGGGVEDAYGEDRATEEQLVTPWTFSVASGYNLLRDPHH  97



>gb|ABS32241.1| NADP-malic enzyme [Flaveria palmeri]
Length=580

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  433  KEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            K+  + V GGV D YGED+ATED  ITPW+VSVASGY+LLRDPH+
Sbjct  6    KKPTAVVGGGVEDVYGEDSATEDHFITPWSVSVASGYSLLRDPHH  50



>ref|XP_010521509.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Tarenaya 
hassleriana]
Length=630

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 16/115 (14%)
 Frame = +1

Query  226  MISLS-GTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  402
            MISLS  +  +  S  G     +  Q++    AP  +  ++  G     N  ++ ++A  
Sbjct  1    MISLSLSSCLIKTSFPGSCTLFSSRQAK---PAPAFLRVIAGEGP----NQVLMEKTASS  53

Query  403  EVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            EV+          ++TV+GGV D YGED ATED  +TPW++SVASGYTLLRDPH+
Sbjct  54   EVSV--------GETTVSGGVQDVYGEDAATEDFPVTPWSLSVASGYTLLRDPHH  100



>ref|XP_003569705.1| PREDICTED: NADP-dependent malic enzyme-like [Brachypodium distachyon]
Length=659

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MESALKEVTES-VP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRD  558
            MES +K +     P V++ +  +TV GGV D YGED ATE+Q++TPWTVSVASGY LLRD
Sbjct  67   MESTMKGIRGGGAPCVLDMDDAATVGGGVEDTYGEDRATEEQLVTPWTVSVASGYNLLRD  126

Query  559  PHY  567
            P Y
Sbjct  127  PRY  129



>ref|XP_008794110.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Phoenix 
dactylifera]
Length=586

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES  +EV   +     + K+TV GGV D YGED ATEDQ++TPWTVSVASGY LLRDP 
Sbjct  1    MESTHEEVEALM-----DPKNTVGGGVEDTYGEDRATEDQLVTPWTVSVASGYWLLRDPR  55

Query  565  Y  567
            +
Sbjct  56   H  56



>ref|XP_006345575.1| PREDICTED: NADP-dependent malic enzyme-like [Solanum tuberosum]
Length=579

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 12/61 (20%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALK++            ST  GGV D YGED ATEDQ ITPWT++V+SGY LLRDP 
Sbjct  1    MESALKDL------------STPTGGVEDVYGEDCATEDQCITPWTIAVSSGYNLLRDPR  48

Query  565  Y  567
            Y
Sbjct  49   Y  49



>gb|AAA83963.1| malate dehydrogenase [Solanum lycopersicum]
Length=189

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 41/61 (67%), Gaps = 13/61 (21%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALK++            ST  GGV D YGED ATEDQVITPWT++V SGY LLRDP 
Sbjct  1    MESALKDL------------STPTGGVEDVYGEDCATEDQVITPWTIAV-SGYNLLRDPR  47

Query  565  Y  567
            Y
Sbjct  48   Y  48



>ref|NP_001233951.1| cytosolic NADP-malic enzyme [Solanum lycopersicum]
 gb|AAB58728.1| cytosolic NADP-malic enzyme [Solanum lycopersicum]
Length=579

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 12/61 (20%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALK++            ST  GGV D YGED ATEDQ ITPWT++V+SGY LLRDP 
Sbjct  1    MESALKDL------------STPTGGVEDVYGEDCATEDQCITPWTIAVSSGYNLLRDPR  48

Query  565  Y  567
            Y
Sbjct  49   Y  49



>gb|AGH32501.1| malic enzyme [Stylosanthes guianensis]
Length=585

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  433  KEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +EA +TV GGV DFYGE+ ATEDQ+ITPW  SV+SG TLLRDP Y
Sbjct  11   EEASATVDGGVRDFYGEERATEDQLITPWNFSVSSGSTLLRDPRY  55



>gb|KJB54773.1| hypothetical protein B456_009G048600 [Gossypium raimondii]
 gb|KJB54776.1| hypothetical protein B456_009G048600 [Gossypium raimondii]
Length=459

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS + GGVGD Y ED+AT DQ ITPWT+SVASGY+L+RDP Y
Sbjct  11   KSAIVGGVGDMYSEDSATLDQPITPWTISVASGYSLMRDPRY  52



>gb|KHG14917.1| NADP-dependent malic enzyme [Gossypium arboreum]
Length=589

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS + GGVGD Y ED+AT DQ ITPWT+SVASGY+L+RDP Y
Sbjct  11   KSAIVGGVGDMYSEDSATLDQPITPWTISVASGYSLMRDPRY  52



>gb|KHN05334.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=588

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  454  AGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +GGV D YGED ATEDQ +TPW++SVASGY+LLRDPHY
Sbjct  21   SGGVRDVYGEDKATEDQFVTPWSISVASGYSLLRDPHY  58



>gb|KDP34170.1| hypothetical protein JCGZ_07741 [Jatropha curcas]
Length=576

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  451  VAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            + GGV D YGED+ATEDQ+ITPWTVSVASGYTLLRDP +
Sbjct  8    LGGGVEDVYGEDSATEDQLITPWTVSVASGYTLLRDPRH  46



>ref|XP_009380466.1| PREDICTED: NADP-dependent malic enzyme [Musa acuminata subsp. 
malaccensis]
Length=585

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  436  EAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +  +TV GGV D YGED ATE+Q++TPWT SVASGY+LLRDPH+
Sbjct  12   DPTATVGGGVEDAYGEDRATEEQLVTPWTFSVASGYSLLRDPHH  55



>gb|AEJ33773.1| putative NADP-dependent malic enzyme [Solanum habrochaites]
Length=579

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 12/61 (20%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MESALK++            ST  GGV D YGED ATEDQ ITPW+++V+SGY LLRDP 
Sbjct  1    MESALKDL------------STPTGGVEDVYGEDCATEDQCITPWSIAVSSGYNLLRDPR  48

Query  565  Y  567
            Y
Sbjct  49   Y  49



>gb|KJB54772.1| hypothetical protein B456_009G048600 [Gossypium raimondii]
Length=582

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS + GGVGD Y ED+AT DQ ITPWT+SVASGY+L+RDP Y
Sbjct  11   KSAIVGGVGDMYSEDSATLDQPITPWTISVASGYSLMRDPRY  52



>gb|KJB54774.1| hypothetical protein B456_009G048600 [Gossypium raimondii]
Length=583

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS + GGVGD Y ED+AT DQ ITPWT+SVASGY+L+RDP Y
Sbjct  11   KSAIVGGVGDMYSEDSATLDQPITPWTISVASGYSLMRDPRY  52



>emb|CDX68115.1| BnaA07g21550D [Brassica napus]
Length=653

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = +1

Query  340  VSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPW  519
            +SS G   D N S+++E+     T   P         V GGV D YGED ATED  ITPW
Sbjct  51   LSSLGSKVDPNGSVLIETT----TPPSP------SPDVTGGVQDVYGEDAATEDMPITPW  100

Query  520  TVSVASGYTLLRDPHY  567
            ++SVASGYTLLRDPH+
Sbjct  101  SLSVASGYTLLRDPHH  116



>ref|XP_009104694.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Brassica 
rapa]
Length=647

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = +1

Query  340  VSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPW  519
            +SS G   D N S+++E+     T   P         V GGV D YGED ATED  ITPW
Sbjct  51   LSSLGSKVDPNGSVLIETT----TPPSP------SPDVTGGVQDVYGEDAATEDMPITPW  100

Query  520  TVSVASGYTLLRDPHY  567
            ++SVASGYTLLRDPH+
Sbjct  101  SLSVASGYTLLRDPHH  116



>ref|XP_010539482.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Tarenaya hassleriana]
Length=632

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  445  STVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            +TV+GGV D YGED ATED  +TPW++SVASGYTLLRDPH+
Sbjct  62   TTVSGGVQDVYGEDAATEDFPVTPWSLSVASGYTLLRDPHH  102



>ref|XP_002989806.1| hypothetical protein SELMODRAFT_130484 [Selaginella moellendorffii]
 gb|EFJ09073.1| hypothetical protein SELMODRAFT_130484 [Selaginella moellendorffii]
Length=592

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  385  MESALKEVTESVP-VVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDP  561
            MES LK++    P V+EK+  +T+AGGV D YGED AT ++++TPW  +VASG  LLRDP
Sbjct  1    MESQLKDMRGDGPSVLEKDPGATIAGGVHDTYGEDAATVERIVTPWARTVASGVELLRDP  60

Query  562  HY  567
             Y
Sbjct  61   RY  62



>dbj|BAG16517.1| putative NADP-dependent malic enzyme [Capsicum chinense]
Length=578

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 40/61 (66%), Gaps = 13/61 (21%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES LKE    +P          AGGV D YGED ATEDQ ITPWT++V+SGY LLRDP 
Sbjct  1    MESTLKE---QIP----------AGGVEDVYGEDCATEDQCITPWTIAVSSGYNLLRDPR  47

Query  565  Y  567
            Y
Sbjct  48   Y  48



>ref|XP_002872183.1| hypothetical protein ARALYDRAFT_489440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48442.1| hypothetical protein ARALYDRAFT_489440 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS V GG+ D YGED+AT DQ++TPW  SVASGYTL+RDP Y
Sbjct  17   KSGVGGGISDVYGEDSATLDQLVTPWVTSVASGYTLMRDPRY  58



>ref|XP_007012167.1| NADP-malic enzyme 4 [Theobroma cacao]
 gb|EOY29786.1| NADP-malic enzyme 4 [Theobroma cacao]
Length=724

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  442  KSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            KS V GGV D YGED+AT DQ +TPWTVSVASGY+L+RDP +
Sbjct  153  KSAVGGGVEDMYGEDSATMDQPVTPWTVSVASGYSLMRDPRH  194



>gb|AFW82002.1| hypothetical protein ZEAMMB73_408175 [Zea mays]
Length=268

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  454  AGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             GGVGD YGED ATE+Q+ITPW  SVASGYTLLRDP +
Sbjct  3    GGGVGDAYGEDRATEEQLITPWAFSVASGYTLLRDPRH  40



>gb|KDO66537.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=585

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = +1

Query  385  MESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPH  564
            MES +KE+ +   V++ ++KSTV GGV D YGED ATEDQ++TPWT+SVA      RDP 
Sbjct  1    MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRATEDQLVTPWTISVA------RDPR  54

Query  565  Y  567
            +
Sbjct  55   H  55



>gb|KCW79169.1| hypothetical protein EUGRSUZ_C00609 [Eucalyptus grandis]
Length=537

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  439  AKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
             K+   GG GD YGED ATEDQ+ITPW VSVASGY LLRDP +
Sbjct  15   GKAGPVGGTGDVYGEDRATEDQLITPWAVSVASGYNLLRDPRH  57



>ref|XP_009151107.1| PREDICTED: NADP-dependent malic enzyme 3 [Brassica rapa]
 emb|CDX88203.1| BnaA06g27940D [Brassica napus]
Length=588

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  436  EAKSTVAGGVGDFYGEDTATEDQVITPWTVSVASGYTLLRDPHY  567
            E +S V GG+ D YGED AT DQ++TPW  SVASGYTL+RDP Y
Sbjct  15   ENRSGVGGGISDVYGEDLATLDQLVTPWVTSVASGYTLMRDPRY  58



Lambda      K        H        a         alpha
   0.317    0.130    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960