BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS124C01

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 140   1e-34   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                139   3e-34   
gb|AAB17186.1|  plasma membrane H+-ATPase                               139   3e-34   Solanum lycopersicum
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   138   8e-34   Citrus sinensis [apfelsine]
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 137   1e-33   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                136   3e-33   Sesamum indicum [beniseed]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           136   4e-33   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                136   5e-33   Nicotiana sylvestris
ref|XP_010094202.1|  Plasma membrane ATPase 4                           135   6e-33   Morus notabilis
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     135   8e-33   Pyrus x bretschneideri [bai li]
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         135   8e-33   Jatropha curcas
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     135   9e-33   Pyrus x bretschneideri [bai li]
ref|XP_010111939.1|  Plasma membrane ATPase 4                           135   1e-32   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              134   2e-32   Sesbania rostrata
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                134   2e-32   Nicotiana tomentosiformis
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           134   2e-32   Cicer arietinum [garbanzo]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           134   2e-32   Sesamum indicum [beniseed]
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                134   2e-32   Vitis vinifera
emb|CAN64375.1|  hypothetical protein VITISV_014422                     134   2e-32   Vitis vinifera
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    134   2e-32   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     134   3e-32   Populus euphratica
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                133   3e-32   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             133   3e-32   Citrus clementina [clementine]
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             133   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  133   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                133   4e-32   Vitis vinifera
gb|KHN22686.1|  Plasma membrane ATPase 4                                133   4e-32   Glycine soja [wild soybean]
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     133   4e-32   Populus euphratica
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          133   4e-32   Medicago truncatula
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             133   4e-32   Phaseolus vulgaris [French bean]
gb|KJB22048.1|  hypothetical protein B456_004G027300                    133   4e-32   Gossypium raimondii
emb|CBI20766.3|  unnamed protein product                                133   5e-32   Vitis vinifera
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          133   5e-32   
emb|CDP02997.1|  unnamed protein product                                133   5e-32   Coffea canephora [robusta coffee]
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      133   6e-32   Solanum tuberosum [potatoes]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    132   7e-32   Fragaria vesca subsp. vesca
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    132   7e-32   Fragaria vesca subsp. vesca
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    132   7e-32   Ricinus communis
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                132   8e-32   Phoenix dactylifera
dbj|BAA37150.1|  p-type H+-ATPase                                       132   8e-32   Vicia faba [broad bean]
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 132   1e-31   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           132   1e-31   Phoenix dactylifera
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             131   1e-31   Elaeis guineensis
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          131   2e-31   Amborella trichopoda
gb|KHN17608.1|  Plasma membrane ATPase 4                                131   2e-31   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    131   2e-31   Glycine max [soybeans]
ref|XP_002324397.1|  H+-ATPase family protein                           131   2e-31   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             131   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   130   2e-31   Citrus sinensis [apfelsine]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             131   2e-31   Prunus persica
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     130   3e-31   Eucalyptus grandis [rose gum]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                131   3e-31   Erythranthe guttata [common monkey flower]
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   130   3e-31   Citrus sinensis [apfelsine]
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   130   3e-31   Citrus sinensis [apfelsine]
gb|KHG26452.1|  Plasma membrane ATPase 4                                129   3e-31   Gossypium arboreum [tree cotton]
gb|AAB84202.2|  plasma membrane proton ATPase                           130   3e-31   Kosteletzkya pentacarpos [seashore mallow]
gb|KJB66333.1|  hypothetical protein B456_010G136300                    130   3e-31   Gossypium raimondii
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    130   3e-31   Glycine max [soybeans]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             130   3e-31   Citrus clementina [clementine]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             130   4e-31   Citrus sinensis [apfelsine]
dbj|BAD16687.1|  plasma membrane H+-ATPase                              130   4e-31   Daucus carota [carrots]
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   130   4e-31   Citrus sinensis [apfelsine]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    130   4e-31   Gossypium raimondii
gb|KJB55189.1|  hypothetical protein B456_009G068100                    130   4e-31   Gossypium raimondii
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                130   5e-31   Eucalyptus grandis [rose gum]
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                130   5e-31   Fragaria vesca subsp. vesca
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             130   5e-31   
emb|CAB69823.1|  plasma membrane H+ ATPase                              130   5e-31   Prunus persica
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             130   5e-31   Elaeis guineensis
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    130   5e-31   Prunus mume [ume]
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  130   6e-31   Phoenix dactylifera
dbj|BAO45902.1|  plasma membrane H+-ATPase                              130   7e-31   Acacia mangium
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                130   7e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             129   8e-31   Elaeis guineensis
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           129   1e-30   Glycine max [soybeans]
gb|KHN15309.1|  Plasma membrane ATPase 4                                129   1e-30   Glycine soja [wild soybean]
gb|AAY42949.1|  plasma membrane H+ ATPase                               129   1e-30   Lupinus albus
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         129   1e-30   Jatropha curcas
ref|XP_003594954.1|  Plasma membrane ATPase                             128   2e-30   Medicago truncatula
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    127   2e-30   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             128   2e-30   Phaseolus vulgaris [French bean]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                128   3e-30   Erythranthe guttata [common monkey flower]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                128   3e-30   Erythranthe guttata [common monkey flower]
gb|AFM52333.1|  plasma membrane H+-ATPase                               127   4e-30   Malus baccata var. xiaojinensis
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    127   4e-30   
gb|KGN62872.1|  hypothetical protein Csa_2G378540                       125   4e-30   
emb|CAA59799.1|  H(+)-transporting ATPase                               127   4e-30   Phaseolus vulgaris [French bean]
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           127   5e-30   Cucumis melo [Oriental melon]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             127   5e-30   Phaseolus vulgaris [French bean]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                127   5e-30   Prunus mume [ume]
gb|KHF98166.1|  Plasma membrane ATPase 4                                126   5e-30   Gossypium arboreum [tree cotton]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          127   5e-30   Medicago truncatula
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             127   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           127   6e-30   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             127   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBW30211.1|  Plasma membrane ATPase                                 127   6e-30   Musa balbisiana [starchy banana]
emb|CBW30173.1|  Plasma membrane ATPase 4                               127   6e-30   Musa balbisiana [starchy banana]
gb|KHG28536.1|  Plasma membrane ATPase 4                                125   8e-30   Gossypium arboreum [tree cotton]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           126   8e-30   Populus euphratica
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             126   9e-30   Phoenix dactylifera
ref|XP_006382164.1|  H+-ATPase family protein                           126   1e-29   
gb|AAY42950.1|  plasma membrane H+ ATPase                               126   1e-29   Lupinus albus
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           126   1e-29   Cicer arietinum [garbanzo]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           126   1e-29   Elaeis guineensis
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    125   1e-29   
gb|KEH39758.1|  plasma membrane H+-ATPase                               126   1e-29   Medicago truncatula
dbj|BAD16684.1|  plasma membrane H+-ATPase                              125   1e-29   Daucus carota [carrots]
gb|KJB54894.1|  hypothetical protein B456_009G053500                    125   2e-29   Gossypium raimondii
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  125   2e-29   Elaeis guineensis
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            124   2e-29   Gossypium arboreum [tree cotton]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    125   2e-29   Populus euphratica
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           125   2e-29   
gb|KJB65971.1|  hypothetical protein B456_010G123000                    125   2e-29   Gossypium raimondii
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    125   2e-29   Phoenix dactylifera
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    125   2e-29   Phoenix dactylifera
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           125   2e-29   Sesamum indicum [beniseed]
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           125   3e-29   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    125   3e-29   Glycine max [soybeans]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    125   3e-29   Gossypium raimondii
dbj|BAF03589.1|  P-type H+-ATPase                                       125   3e-29   Zostera marina
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           125   3e-29   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                125   3e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS65442.1|  hypothetical protein M569_09334                         125   3e-29   Genlisea aurea
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             124   4e-29   Phaseolus vulgaris [French bean]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           124   4e-29   Malus domestica [apple tree]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              124   4e-29   Daucus carota [carrots]
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             124   5e-29   Capsella rubella
gb|AAY42948.1|  plasma membrane H+ ATPase                               124   6e-29   Lupinus albus
gb|AAB41898.1|  H+-transporting ATPase                                  124   6e-29   Mesembryanthemum crystallinum
ref|NP_001190870.1|  H(+)-ATPase 2                                      124   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          124   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     124   7e-29   Eucalyptus grandis [rose gum]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           124   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           124   7e-29   Elaeis guineensis
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     124   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          124   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             124   8e-29   Eutrema salsugineum [saltwater cress]
ref|NP_194748.1|  H(+)-ATPase 2                                         124   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16462.1|  Plasma membrane ATPase 4                                124   8e-29   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      124   8e-29   Glycine max [soybeans]
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             124   9e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             123   9e-29   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     124   9e-29   Eucalyptus grandis [rose gum]
dbj|BAJ34124.1|  unnamed protein product                                124   9e-29   Eutrema halophilum
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    123   1e-28   Glycine max [soybeans]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           123   1e-28   Cicer arietinum [garbanzo]
dbj|BAC77530.1|  plasma membrane H+-ATPase                              123   1e-28   Sesbania rostrata
gb|AFW04239.1|  plasma membrane H+-ATPase                               123   1e-28   Sesuvium portulacastrum [sea-purslane]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     123   2e-28   Morus notabilis
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                123   2e-28   Eucalyptus grandis [rose gum]
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             123   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    122   2e-28   Glycine max [soybeans]
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     122   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_007012006.1|  H(+)-ATPase 8                                      122   2e-28   
gb|EPS73574.1|  hypothetical protein M569_01174                         122   2e-28   Genlisea aurea
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     122   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     122   2e-28   Sesamum indicum [beniseed]
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    122   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             122   2e-28   Eutrema salsugineum [saltwater cress]
dbj|BAD16688.1|  plasma membrane H+-ATPase                              122   2e-28   Daucus carota [carrots]
gb|KEH39753.1|  plasma membrane H+-ATPase                               122   2e-28   Medicago truncatula
dbj|BAJ33915.1|  unnamed protein product                                122   2e-28   Eutrema halophilum
emb|CDY64741.1|  BnaCnng44750D                                          122   3e-28   Brassica napus [oilseed rape]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          122   3e-28   Amborella trichopoda
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          122   3e-28   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     122   3e-28   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          122   3e-28   Sesamum indicum [beniseed]
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             122   3e-28   Capsella rubella
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          122   3e-28   Brassica rapa
emb|CAC29436.1|  P-type H+-ATPase                                       122   3e-28   Vicia faba [broad bean]
gb|AAK31799.2|  plasma membrane H+ ATPase                               122   4e-28   Lilium longiflorum [Easter lily]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                121   5e-28   Cucumis melo [Oriental melon]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             121   5e-28   Oryza brachyantha
ref|XP_007023381.1|  H(+)-ATPase 9                                      121   5e-28   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     121   5e-28   Sesamum indicum [beniseed]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    121   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           121   5e-28   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                121   7e-28   Erythranthe guttata [common monkey flower]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    121   8e-28   Tarenaya hassleriana [spider flower]
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  120   8e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    120   9e-28   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     120   9e-28   Sesamum indicum [beniseed]
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   120   1e-27   Vicia faba [broad bean]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        120   1e-27   Lilium longiflorum [Easter lily]
gb|KJB82762.1|  hypothetical protein B456_013G212200                    120   1e-27   Gossypium raimondii
emb|CDX82608.1|  BnaC07g02580D                                          120   1e-27   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          120   1e-27   Brassica rapa
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     120   1e-27   Tarenaya hassleriana [spider flower]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       120   2e-27   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    120   2e-27   Arabis alpina [alpine rockcress]
gb|AHK23067.1|  plasma membrane ATPase 4                                120   2e-27   Fagopyrum tataricum [Kangra buckwheat]
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          119   2e-27   Cucumis melo [Oriental melon]
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    119   2e-27   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     119   2e-27   Cucumis sativus [cucumbers]
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         119   2e-27   Jatropha curcas
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     119   3e-27   Tarenaya hassleriana [spider flower]
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    119   3e-27   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           119   3e-27   Cicer arietinum [garbanzo]
emb|CDP14278.1|  unnamed protein product                                119   3e-27   Coffea canephora [robusta coffee]
gb|ACE77057.1|  plasma membrane proton pump                             119   4e-27   Cucumis sativus [cucumbers]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           119   4e-27   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    119   4e-27   
gb|KEH32174.1|  plasma membrane H+-ATPase                               119   4e-27   Medicago truncatula
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          119   4e-27   Prunus mume [ume]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    119   4e-27   Populus euphratica
gb|AEQ27822.1|  PM H+-ATPase R                                          119   4e-27   Eichhornia crassipes
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                119   5e-27   Erythranthe guttata [common monkey flower]
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             118   5e-27   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     118   6e-27   Sesamum indicum [beniseed]
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       118   6e-27   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          118   7e-27   Brassica rapa
emb|CDY47940.1|  BnaA02g08160D                                          118   7e-27   Brassica napus [oilseed rape]
emb|CDY38294.1|  BnaA10g11420D                                          118   7e-27   Brassica napus [oilseed rape]
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         118   7e-27   Jatropha curcas
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       118   7e-27   
emb|CDY25913.1|  BnaC09g32850D                                          118   8e-27   Brassica napus [oilseed rape]
gb|ABR18001.1|  unknown                                                 118   8e-27   Picea sitchensis
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          118   8e-27   Fragaria vesca subsp. vesca
gb|KJB70727.1|  hypothetical protein B456_011G089100                    118   9e-27   Gossypium raimondii
ref|XP_011468858.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    118   9e-27   Fragaria vesca subsp. vesca
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     118   9e-27   Eucalyptus grandis [rose gum]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          118   9e-27   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     117   1e-26   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    117   1e-26   
ref|NP_200545.1|  H(+)-ATPase 3                                         117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    117   1e-26   Fragaria vesca subsp. vesca
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    117   1e-26   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          117   1e-26   Vitis vinifera
emb|CDY50939.1|  BnaC03g74390D                                          117   1e-26   Brassica napus [oilseed rape]
gb|AAL09726.1|  AT5g57350/MJB24_16                                      117   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93092.1|  BnaA03g38140D                                          117   1e-26   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    117   1e-26   Sesamum indicum [beniseed]
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     117   1e-26   Brassica rapa
gb|KEH19962.1|  plasma membrane H+-ATPase                               117   1e-26   Medicago truncatula
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          117   1e-26   Cucumis melo [Oriental melon]
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     117   2e-26   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    117   2e-26   Sesamum indicum [beniseed]
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          117   2e-26   Glycine soja [wild soybean]
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             117   2e-26   Vitis vinifera
gb|KJB56561.1|  hypothetical protein B456_009G125200                    117   2e-26   Gossypium raimondii
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          117   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          117   2e-26   Nicotiana tomentosiformis
ref|NP_179486.1|  H(+)-ATPase 1                                         117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          117   2e-26   Sorghum bicolor [broomcorn]
gb|KFK29576.1|  h(+)-atpase 2                                           117   2e-26   Arabis alpina [alpine rockcress]
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    117   2e-26   Arabis alpina [alpine rockcress]
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             117   2e-26   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    116   3e-26   Cicer arietinum [garbanzo]
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    116   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    116   3e-26   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    116   3e-26   Glycine max [soybeans]
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     116   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          116   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    116   3e-26   Glycine max [soybeans]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             116   3e-26   Capsella rubella
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          116   3e-26   Glycine soja [wild soybean]
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     116   3e-26   Cucumis melo [Oriental melon]
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          116   3e-26   Brassica rapa
emb|CDY67153.1|  BnaAnng23670D                                          116   4e-26   Brassica napus [oilseed rape]
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          116   4e-26   Brassica rapa
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          116   4e-26   
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       115   5e-26   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     115   5e-26   
dbj|BAD19091.1|  putative H+-exporting ATPase                           115   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    115   6e-26   Brassica rapa
emb|CAD29312.1|  plasma membrane H+-ATPase                              115   6e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          115   6e-26   Glycine soja [wild soybean]
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             115   7e-26   Setaria italica
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     115   7e-26   Glycine max [soybeans]
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    115   7e-26   Brassica rapa
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    115   7e-26   Eucalyptus grandis [rose gum]
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          115   7e-26   Nicotiana sylvestris
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     115   7e-26   Brassica rapa
emb|CDX72218.1|  BnaC07g42400D                                          115   7e-26   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             115   8e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     115   8e-26   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       115   8e-26   
gb|AAR32129.2|  proton P-ATPase                                         115   8e-26   
ref|NP_001185450.1|  H(+)-ATPase 9                                      115   8e-26   
ref|NP_178181.1|  H(+)-ATPase 9                                         115   8e-26   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             115   9e-26   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             115   9e-26   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                115   9e-26   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           115   1e-25   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           115   1e-25   
gb|KFK27283.1|  h(+)-atpase 3                                           115   1e-25   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    115   1e-25   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     115   1e-25   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          114   1e-25   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             114   1e-25   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             114   1e-25   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     114   1e-25   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     114   1e-25   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     114   1e-25   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     114   1e-25   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          114   1e-25   
emb|CDY56511.1|  BnaCnng30540D                                          114   2e-25   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   114   2e-25   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     114   2e-25   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             114   2e-25   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     114   2e-25   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              114   2e-25   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          114   2e-25   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          114   2e-25   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     114   2e-25   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    114   2e-25   
gb|AEO22063.1|  plasma membrane H+-ATPase                               114   3e-25   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    113   3e-25   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                114   3e-25   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  114   3e-25   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           114   3e-25   
ref|XP_002324564.1|  ATPase 6 family protein                            114   3e-25   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    113   3e-25   
ref|NP_178762.1|  H(+)-ATPase 6                                         113   3e-25   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       113   3e-25   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       113   3e-25   
gb|EAZ06139.1|  hypothetical protein OsI_28373                          113   3e-25   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           113   3e-25   
gb|ABW25091.1|  plasma membrane proton pump                             113   3e-25   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     113   3e-25   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    113   4e-25   
emb|CDY62140.1|  BnaCnng39300D                                          112   4e-25   
dbj|BAD33363.1|  putative plasma membrane H+-ATPase                     113   4e-25   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       113   4e-25   
emb|CAD29311.1|  plasma membrane H+-ATPase                              113   4e-25   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             113   4e-25   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    113   4e-25   
gb|KEH37844.1|  plasma membrane H+-ATPase                               113   4e-25   
gb|ABA18090.1|  putative plasma membrane ATPase                         113   5e-25   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     113   5e-25   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          113   5e-25   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  112   5e-25   
gb|ACL54575.1|  unknown                                                 112   5e-25   
ref|XP_002307856.1|  ATPase 6 family protein                            112   5e-25   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     112   6e-25   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       112   6e-25   
emb|CBI35956.3|  unnamed protein product                                112   6e-25   
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     109   7e-25   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          112   7e-25   
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     109   7e-25   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          112   7e-25   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     112   8e-25   
gb|EMT26270.1|  Plasma membrane ATPase                                  112   8e-25   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    112   8e-25   
ref|XP_002297804.2|  H+-ATPase family protein                           112   8e-25   
gb|AAV71150.1|  plasma membrane H+-ATPase                               112   8e-25   
gb|EMS60594.1|  Plasma membrane ATPase                                  112   8e-25   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             112   9e-25   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     112   9e-25   
emb|CDY51650.1|  BnaAnng10900D                                          112   9e-25   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             112   9e-25   
emb|CDX72217.1|  BnaC07g42390D                                          112   9e-25   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           112   1e-24   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    112   1e-24   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     111   1e-24   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     112   1e-24   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          112   1e-24   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     111   1e-24   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     111   1e-24   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    111   1e-24   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    111   2e-24   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    111   2e-24   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           111   2e-24   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     111   2e-24   
gb|AAV49159.1|  plasma membrane proton ATPase 5                         111   2e-24   
emb|CDY67606.1|  BnaAnng24780D                                          109   2e-24   
dbj|BAK05828.1|  predicted protein                                      111   2e-24   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     111   2e-24   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          110   2e-24   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           111   2e-24   
ref|NP_001054118.1|  Os04g0656100                                       111   2e-24   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           110   2e-24   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610          110   3e-24   
emb|CDY69631.1|  BnaCnng64550D                                          108   3e-24   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    110   3e-24   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    110   3e-24   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             110   3e-24   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     110   3e-24   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          110   3e-24   
gb|KJB19306.1|  hypothetical protein B456_003G094300                    110   3e-24   
emb|CDO98206.1|  unnamed protein product                                110   4e-24   
ref|XP_002309321.1|  ATPase 6 family protein                            110   4e-24   
gb|KJB19305.1|  hypothetical protein B456_003G094300                    110   4e-24   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     110   4e-24   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     110   4e-24   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          110   5e-24   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             110   5e-24   
gb|KJB19302.1|  hypothetical protein B456_003G094300                    110   5e-24   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          110   6e-24   
emb|CDX76809.1|  BnaC08g33950D                                          103   6e-24   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     110   6e-24   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             109   6e-24   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    109   6e-24   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     109   6e-24   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    109   6e-24   
gb|ABA18112.1|  putative plasma membrane ATPase                         109   6e-24   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          109   6e-24   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             109   6e-24   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             109   6e-24   
gb|KJB19303.1|  hypothetical protein B456_003G094300                    109   6e-24   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            108   7e-24   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                109   7e-24   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           109   7e-24   
emb|CDY34767.1|  BnaA09g41340D                                          109   8e-24   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          109   8e-24   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     109   8e-24   
gb|KJB19307.1|  hypothetical protein B456_003G094300                    109   9e-24   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           109   9e-24   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    109   1e-23   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              108   1e-23   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     108   1e-23   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    108   1e-23   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             108   1e-23   
gb|KJB82864.1|  hypothetical protein B456_013G217900                    108   1e-23   
ref|XP_002304716.2|  H+-ATPase family protein                           108   1e-23   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             108   1e-23   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             108   1e-23   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    108   1e-23   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    108   2e-23   
gb|KEH39623.1|  plasma membrane H+-ATPase                               108   2e-23   
ref|NP_189850.1|  H(+)-ATPase 8                                         108   2e-23   
ref|NP_001048395.2|  Os02g0797300                                       108   2e-23   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       108   2e-23   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             108   2e-23   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    108   2e-23   
emb|CDX67957.1|  BnaA07g19970D                                          108   2e-23   
gb|KEH35952.1|  plasma membrane H+-ATPase                               108   2e-23   
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   107   2e-23   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    108   2e-23   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     108   2e-23   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       108   2e-23   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             108   3e-23   
ref|NP_201073.1|  H(+)-ATPase 11                                        108   3e-23   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    107   3e-23   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    107   3e-23   
gb|EPS57651.1|  hypothetical protein M569_17165                         107   3e-23   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    107   3e-23   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             107   3e-23   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         107   3e-23   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   107   3e-23   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       107   3e-23   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           107   4e-23   
gb|EMS59303.1|  Plasma membrane ATPase                                  107   4e-23   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                          107   4e-23   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    107   4e-23   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             107   4e-23   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    107   4e-23   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     107   5e-23   
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           107   5e-23   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         107   5e-23   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     107   5e-23   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    107   5e-23   
ref|NP_001059093.1|  Os07g0191200                                       107   6e-23   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           107   6e-23   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    107   6e-23   
gb|EEC81667.1|  hypothetical protein OsI_25220                          107   6e-23   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          107   6e-23   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              107   6e-23   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    106   6e-23   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    107   6e-23   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               106   7e-23   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    106   7e-23   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    106   7e-23   
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    107   7e-23   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    106   8e-23   
ref|XP_009386906.1|  PREDICTED: ATPase 3, plasma membrane-type-like     100   8e-23   
gb|EMT09250.1|  ATPase 8, plasma membrane-type                          105   8e-23   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         106   8e-23   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    106   8e-23   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              106   8e-23   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          106   9e-23   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             106   9e-23   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    106   9e-23   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           106   1e-22   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    106   1e-22   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    106   1e-22   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    106   1e-22   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    106   1e-22   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         105   1e-22   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           105   1e-22   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          105   1e-22   
gb|EEC69747.1|  hypothetical protein OsI_39279                          105   1e-22   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          105   2e-22   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           105   2e-22   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           105   2e-22   
ref|NP_001067382.1|  Os12g0638700                                       105   2e-22   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    105   2e-22   
gb|EYU19268.1|  hypothetical protein MIMGU_mgv1a024366mg                105   2e-22   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           105   2e-22   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             105   2e-22   
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    105   2e-22   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    105   2e-22   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                105   2e-22   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             105   2e-22   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              105   2e-22   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    105   2e-22   



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   140 bits (354),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME+AAIMAIALANGDGKP
Sbjct  63   ILKFLGFMWNPLSWVMESAAIMAIALANGDGKP  95



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   139 bits (351),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 86/91 (95%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME AAIMAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEMAAIMAIALANGDGKP  93



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   139 bits (351),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 86/91 (95%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME AAIMAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEMAAIMAIALANGDGKP  93



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   138 bits (347),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 84/94 (89%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGDK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKES
Sbjct  1    MGDKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKP
Sbjct  61   KILKFLGFMWNPLSWVMEAAAVMAIALANGEGKP  94



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME+AAIMAIALANGDGKP
Sbjct  63   ILKFLGFMWNPLSWVMESAAIMAIALANGDGKP  95



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   136 bits (343),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAA+MAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEAAAVMAIALANGGGKP  95



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   136 bits (342),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 82/91 (90%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEAAAVMAIALANGDGKP  93



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGLTS+EGA+RLQIFGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANGDGKP
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGKP  95



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   135 bits (340),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   135 bits (340),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 84/91 (92%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KSITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGKP  93



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   135 bits (340),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 81/93 (87%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK ITLE+IKNE+VDLE+IP+EEVFEQLKC+R+GLTS+EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKGITLEEIKNESVDLERIPMEEVFEQLKCTRQGLTSEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIALANGDGRP  95



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 83/90 (92%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SITLE+IKNETVDLE+IP+EEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LK
Sbjct  6    SITLEEIKNETVDLERIPVEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILK  65

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  66   FLGFMWNPLSWVMEAAAIMAIALANGDGKP  95



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 83/91 (91%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESKLL
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGNGKP  93



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             +KSI+LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    ANKSISLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAA+MAI LANGDGKP
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIGLANGDGKP  95



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MG  +I+LEQIKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANR+QIFGPNKLEEKKES
Sbjct  1    MGGDAISLEQIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+P
Sbjct  61   KLLKFLGFMWNPLSWVMEAAALMAIVLANGSGQP  94



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3    GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQP  95



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3    GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQP  95



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 81/91 (89%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGA+RLQIFGPNKLEEK ESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEAAAVMAIALANGDGKP  93



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   134 bits (336),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   133 bits (335),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 93/95 (98%), Gaps = 1/95 (1%)
 Frame = +1

Query  274  MGDKS-ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  450
            MGDK+ I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKE
Sbjct  1    MGDKTAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKE  60

Query  451  skllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            SK+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKP
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAVMAIALANGEGKP  95



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   133 bits (335),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLE+IP++EVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AA+MAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEMAAVMAIALANGGGKP  95



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+I+LE+IKNE VDLE++PIEEVFEQLKC+REGLTS EGANRLQIFGPNKLEEKKESK
Sbjct  3    GNKAISLEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AA+MAIALANG GKP
Sbjct  63   VLKFLGFMWNPLSWVMEMAAVMAIALANGGGKP  95



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             DKSI LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQP  95



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAA+MAIALANGDGKP
Sbjct  67   FLGFMWNPLSWVMEAAAVMAIALANGDGKP  96



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 79/91 (87%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5    KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAI LANG+GKP
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIGLANGNGKP  95



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +ITL+QIKNETVDLE+IPIEEVF+QLKCSREGL+ DEGANRLQIFGPNKLEEKKESKLLK
Sbjct  7    AITLDQIKNETVDLERIPIEEVFQQLKCSREGLSGDEGANRLQIFGPNKLEEKKESKLLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGDGRP  96



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   133 bits (334),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSDEGVNRLQIFGPNKLEEKKESKILKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGDGKP  92



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   133 bits (334),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             DKSI LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQP  95



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   133 bits (334),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 79/91 (87%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5    KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAI LANG+GKP
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIGLANGNGKP  95



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   133 bits (334),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGQ  94



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGNGKP  93



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4    GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKP
Sbjct  64   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKP  96



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4    GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKP
Sbjct  64   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKP  96



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   132 bits (333),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 82/91 (90%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LE+IKNETVDLE+IPI+EVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+L
Sbjct  3    KSISLEEIKNETVDLERIPIDEVFEQLKCTREGLSSDEGTNRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGEP  93



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GGSTISLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME+AA+MAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMESAAVMAIALANGSGKP  95



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +KSITLE+IKNETVDLE IP+EEVFEQLKC++EGL+ +EGANRLQIFGPNKLEEKKESKL
Sbjct  4    NKSITLEEIKNETVDLEHIPVEEVFEQLKCTKEGLSLEEGANRLQIFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANGDGKP
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIGLANGDGKP  95



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   132 bits (332),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+L++IKNE+VDLE+IPIEEVFEQLKC+R GLT++EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKGISLDEIKNESVDLERIPIEEVFEQLKCTRAGLTTEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRP  95



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVF+QLKC+REGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    GGTAISLEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP  95



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGDK I+LE+IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKES
Sbjct  1    MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  61   KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKP  94



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   131 bits (330),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNE VDLE IPIEEVFEQLKCS+EGLTSDEGANRLQIFGPNKLEEKKESK+LKF
Sbjct  3    ISLEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AA+MAI LANG GKP
Sbjct  63   LGFMWNPLSWVMEMAALMAIVLANGQGKP  91



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   131 bits (330),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGNGKP  96



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   131 bits (330),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 81/90 (90%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGNGKP  96



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   131 bits (330),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   131 bits (329),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+L++IKNETVDLE+IPIEEVFEQLKC+REGL+  EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLDEIKNETVDLERIPIEEVFEQLKCTREGLSLTEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGSGKP  95



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   130 bits (326),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   131 bits (329),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL  +EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  96



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4    NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGGGRP  95



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   131 bits (329),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+++LE IKNETVDLEK+PIEEVFEQLKC+REGL+SDEGANRL++FGPNKLEEKKESK+
Sbjct  2    DKALSLEGIKNETVDLEKVPIEEVFEQLKCNREGLSSDEGANRLELFGPNKLEEKKESKV  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKP  93



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLEKIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEKKESK+LK
Sbjct  3    AISLEEIKNETVDLEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKKESKILK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGDGKP  92



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 81/91 (89%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+I+NETVDLEKIPIEEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  5    KGISLEEIRNETVDLEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  65   KFLGFMWNPLSWVMEAAAIMAIALANGEGKP  95



>gb|KJB66333.1| hypothetical protein B456_010G136300 [Gossypium raimondii]
Length=949

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M DKSI+LE+IKNETVDLE+IP+EEVF+QLKC+R GLTS+EG  RLQIFGPNKLEEKKE+
Sbjct  1    MADKSISLEEIKNETVDLERIPVEEVFQQLKCTRNGLTSEEGQKRLQIFGPNKLEEKKEN  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  61   KLLKFLGFMWNPLSWVMEFAAIMAIALANGGGKP  94



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKP  96



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 82/87 (94%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVFEQLKC+REGL+ DEGANRLQIFGPNKLEEKKESKLLKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFEQLKCTREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAI LANGDGKP
Sbjct  64   FMWNPLSWVMEAAAIMAIVLANGDGKP  90



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4    DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRP  95



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4    DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRP  95



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   130 bits (327),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4    NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGGGRP  95



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   130 bits (327),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFAQLKCSREGLSSAEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  96



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRP  95



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRP  95



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   130 bits (326),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G++ I+LE+IKNETVDLE+IP+EEVFEQLKC+REGL+++EGANRLQIFGPNKLEEKKESK
Sbjct  3    GEQGISLEEIKNETVDLERIPVEEVFEQLKCTREGLSAEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKP  95



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGRP  95



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+L++IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKPISLDEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   LLKFLGFMWNPLSWVMEMAAIMAIALANGDGRP  95



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE VDLE+IP++EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNEAVDLERIPVDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRP  95



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG GKP
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGKP  95



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   129 bits (325),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE IPIEEVF+QLKC+REGLTSDEGA+RLQ+FGPNKLEEKKESK
Sbjct  3    GGTAISLEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVME+AAIMAIALANG GKP
Sbjct  63   FLKFLGFMWNPLSWVMESAAIMAIALANGGGKP  95



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKP  96



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKP  96



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP++EVFEQLKCSREGLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLERIPVDEVFEQLKCSREGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGDGRP  92



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+S+EGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCTREGLSSEEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRP  95



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK SI+L+QIKNETVDLE+IPIEEVFEQLKC+REGL+S EG NR+QIFGPNKLEEKKES
Sbjct  4    GDKGSISLDQIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRIQIFGPNKLEEKKES  63

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAA+MAIALANG+G+P
Sbjct  64   KFLKFLGFMWNPLSWVMEAAALMAIALANGEGQP  97



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGL+S+EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLSSEEGTNRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAAIMAIALANGDGRP  95



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+I+NETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIRNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKP  96



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   128 bits (321),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 77/91 (85%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K +TLE+IKNE VDLE+IP+EEVFEQLKC+REGLTS+EG NRLQIFGPNKLEEKKESK+L
Sbjct  5    KGLTLEEIKNEAVDLERIPVEEVFEQLKCTREGLTSEEGQNRLQIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAI LANGD +P
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIVLANGDNRP  95



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL++DEG +RLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSADEGESRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP  95



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGRP  95



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   127 bits (320),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3    GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+P
Sbjct  63   KLLKFLGFMWNPLSWVMEAAALMAIVLANGGGRP  96



>gb|KGN62872.1| hypothetical protein Csa_2G378540 [Cucumis sativus]
Length=546

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESKLL
Sbjct  6    KAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLL  65

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAA+MAI LANG G+P
Sbjct  66   KFLGFMWNPLSWVMEAAALMAIVLANGGGRP  96



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   127 bits (319),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 80/94 (85%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = +1

Query  277  GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3    GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K+LKFLGFMWNPLSWVMEAAA+MAI LANG G+P
Sbjct  63   KILKFLGFMWNPLSWVMEAAALMAIVLANGGGRP  96



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   127 bits (319),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL+ +EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  96



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGL+++EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GEKGISLEEIKNESVDLERIPIEEVFEQLKCSREGLSTEEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGDGRP  95



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   127 bits (319),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRP  92



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   127 bits (319),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+ +LE++KNETVDLEKIPIEEVFEQLKC++EGLTS EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GDKASSLEELKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
             LKFLGFMWNPLSWVME AAIMAIALANG G+
Sbjct  63   FLKFLGFMWNPLSWVMEMAAIMAIALANGGGR  94



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   127 bits (319),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 78/94 (83%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            +G    +LE+IKNE VDLEKIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEK ES
Sbjct  2    VGGGPSSLEEIKNENVDLEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKSES  61

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAA+MAI LANGD +P
Sbjct  62   KFLKFLGFMWNPLSWVMEAAALMAIVLANGDHRP  95



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVME AA+MAIALANGD K
Sbjct  63   ILKFLGFMWNPLSWVMEMAAVMAIALANGDNK  94



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVME AAIMAIALANGD K
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGDNK  94



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            +LKFLGFMWNPLSWVME AAIMAIALANGD K
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGDNK  94



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+SDEG NR+QIFGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSDEGVNRIQIFGPNKLEEKKESKILKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGEGKP  92



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   126 bits (317),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 76/89 (85%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRP  95



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   126 bits (317),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GD +I+L++IKNE VDLE+IP+EEVFEQLKC+REGL++ EG NRLQIFGPNKLEEKKESK
Sbjct  3    GDNAISLDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   FLKFLGFMWNPLSWVMEMAAIMAIALANGGGKP  95



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 76/89 (85%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRP  95



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 75/91 (82%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+IKNETVDLE++PIEEVF+QLKC++EGL+S EGANRL+IFGPNKLEEKK+SK L
Sbjct  5    KGISLEEIKNETVDLERVPIEEVFQQLKCTKEGLSSGEGANRLEIFGPNKLEEKKDSKFL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME AAIMA+ALANG+GKP
Sbjct  65   KFLGFMWNPLSWVMELAAIMAVALANGEGKP  95



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 77/89 (87%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSREGLTS+EG+NRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSREGLTSEEGSNRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAALMAIALANGSGRP  92



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKESKLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKP  92



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 78/94 (83%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  KS +LE+IKNETVDLE+IP+EEVF+QL C+REGL+SDEG  RLQIFGPNKLEEKKES
Sbjct  1    MAAKSFSLEEIKNETVDLERIPVEEVFQQLNCTREGLSSDEGQKRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAIALANGGGKP  94



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNESVDLERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRP  92



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESKLLKF
Sbjct  3    LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKLLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGNGKP  91



>gb|KJB54894.1| hypothetical protein B456_009G053500 [Gossypium raimondii]
Length=952

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE+IP+EEVF+QLKC+REGLTS+EG  RLQIFGPNKLEEK+ESK LKF
Sbjct  7    ISLEQIKNETVDLERIPVEEVFQQLKCTREGLTSEEGEKRLQIFGPNKLEEKEESKFLKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANG GKP
Sbjct  67   LGFMWNPLSWVMEAAAIMAIVLANGGGKP  95



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GGSAISLEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKP  95



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EG NRLQ+FGPNKLEEKKESK 
Sbjct  4    DKGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGTNRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRP  95



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK+
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKI  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKP  93



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK 
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKF  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKP  93



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+++EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GEKGISLEEIKNESVDLERIPIEEVFEQLKCTREGLSTEEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGDGRP  95



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKP  92



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKP  92



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   125 bits (314),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GD SI+LEQIKNE+VDLE+IP+EEVF QLKCSREGL+S EG  RLQIFGPNKLEEK ESK
Sbjct  6    GDGSISLEQIKNESVDLERIPVEEVFAQLKCSREGLSSPEGEQRLQIFGPNKLEEKTESK  65

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVME AAIMAIAL NG G+P
Sbjct  66   FLKFLGFMWNPLSWVMEIAAIMAIALDNGGGEP  98



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K ITLE+IKNE VDLE+IP+EEVFEQLKC++EGLTS+EG NRL+IFGPNKLEEKKESK+
Sbjct  4    NKGITLEEIKNEAVDLERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+P
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRP  95



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   125 bits (313),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+I+LE+IKNE VDLE+IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3    GNKNISLEEIKNENVDLERIPVEEVFEQLKCTRQGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AA+MAI LANG G+P
Sbjct  63   ILKFLGFMWNPLSWVMEIAALMAIGLANGGGEP  95



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   125 bits (313),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   125 bits (313),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRP  95



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M +K I LE+IKNETVDLE+IP+EEVFEQLKCSREGL+ +EGA+RLQIFGPNKLEEKKES
Sbjct  1    MENKGINLEEIKNETVDLERIPVEEVFEQLKCSREGLSGEEGASRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  61   KFLKFLGFMWNPLSWVMEMAAIMAIALANGDGRP  94



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVMEAAA+MAIALANG GKP
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGKP  95



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTS EGA+RLQIFGPNKLEEK E+K L
Sbjct  3    KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSQEGADRLQIFGPNKLEEKTENKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGKP  93



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   125 bits (313),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 1/95 (1%)
 Frame = +1

Query  274  MGDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  450
            M +K SI+LE+IKNETVDLEKIPIEEVFE L+C+REGL+S+EG  RLQIFGPNKLEEKKE
Sbjct  1    MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  451  skllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            SK+LKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKP  95



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   124 bits (312),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKVLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S+EG  RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFGQLKCSREGLSSEEGGQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  96



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRL+IFGPNKLEEKKESK LKF
Sbjct  3    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSTDEGANRLEIFGPNKLEEKKESKFLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGSGKP  91



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   124 bits (312),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGDDRLQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   124 bits (311),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 76/91 (84%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I LE+IKNE VDLE+IP+EEVFEQLKC++EGL++ EGA+RL+IFGPNKLEEKKESK L
Sbjct  5    KGIPLEEIKNENVDLERIPVEEVFEQLKCTKEGLSTQEGASRLEIFGPNKLEEKKESKFL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME+AAIMAIALANGDGKP
Sbjct  65   KFLGFMWNPLSWVMESAAIMAIALANGDGKP  95



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   124 bits (311),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+ S++L++IK+E VDLEKIPIEEVF+ LKCSREGL+S EGANRLQIFGPNKLEEKK+SK
Sbjct  4    GNSSMSLQEIKDEKVDLEKIPIEEVFDSLKCSREGLSSAEGANRLQIFGPNKLEEKKDSK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAA+MAI LANGD KP
Sbjct  64   FLKFLGFMWNPLSWVMEAAALMAIVLANGDHKP  96



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   124 bits (311),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   124 bits (310),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGL+S EG  RLQIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLSSREGEERLQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGKP  90



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   124 bits (311),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3    GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  95



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IP+EEVFEQLKCS+EGL+S+EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAIALANG+G+P
Sbjct  65   LKFLGFMWNPLSWVMEAAAVMAIALANGEGQP  96



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   124 bits (310),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP++EVFEQLKCSREGLTS +G  RLQIFGPNKLEEKKESKLLKF
Sbjct  4    ISLEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKP  92



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   124 bits (310),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   124 bits (310),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   124 bits (310),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   124 bits (310),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   124 bits (310),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   124 bits (310),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   124 bits (310),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+ +I+LEQIKNE VDLE+IP+EEVF QLKC+REGLT  EG  RLQIFGPNKLEEK+ESK
Sbjct  6    GNGTISLEQIKNEAVDLERIPVEEVFAQLKCTREGLTDAEGEQRLQIFGPNKLEEKQESK  65

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LLKFLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  66   LLKFLGFMWNPLSWVMEIAAIMAIVLANGGGKP  98



>ref|XP_006401213.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
 gb|ESQ42666.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
Length=917

 Score =   123 bits (309),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF++LKCSREGL+  EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  6    SLEDIKNETVDLEKIPIEEVFQELKCSREGLSGAEGENRLQIFGPNKLEEKKESKILKFL  65

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  66   GFMWNPLSWVMEAAAIMAIALANGDGRP  93



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   124 bits (310),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3    GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKP
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKP  95



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   124 bits (310),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 78/89 (88%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNESVDLERIPIEEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRP  92



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GL+SDEGA+RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLSSDEGASRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTSDEGANRL +FGPNKLEEKKESK L
Sbjct  3    KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSDEGANRLNLFGPNKLEEKKESKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGGGKP  93



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 76/89 (85%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE +KNE VDLE+IPIEEVFEQLKC+REGLT DEG  RLQIFGPNKLEEKKESK LKF
Sbjct  4    ISLEDVKNENVDLERIPIEEVFEQLKCTREGLTKDEGEKRLQIFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMECAAIMAIVLANGGGKP  92



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK I+LEQIKNETVDLEKIPIEEVFEQLKC+  GLT+ EG +RLQIFGPNKLEEKKESK 
Sbjct  4    DKGISLEQIKNETVDLEKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAA+MAI LANG+GKP
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGEGKP  95



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+ +LE ++NE VDLE+IPIEEVFEQL+C++EGLTS+EGANR+QIFG NKLEEKKESK
Sbjct  3    GDKASSLEDLRNEAVDLERIPIEEVFEQLQCTKEGLTSEEGANRIQIFGQNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   VLKFLGFMWNPLSWVMEMAAIMAIALANGGGKP  95



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 79/89 (89%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCS  GLTSDEGANRLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSTAGLTSDEGANRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRP  92



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D   +LEQIKNETVDLE+IP+EEVFEQLKC+REGLT+ EG  RL+IFGPNKLEEKKE K 
Sbjct  4    DGDTSLEQIKNETVDLERIPVEEVFEQLKCTREGLTTAEGEKRLEIFGPNKLEEKKECKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LKFLGFMWNPLSWVMEAAAIMAI LANG GKP
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIVLANGGGKP  95



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   122 bits (306),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/91 (85%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            +SI+LE+IKNETVDLEK+PIEEVFE+L+C+REGL+S+EG  RL IFGPNKLEEKKESK+L
Sbjct  5    ESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   KFLGFMWNPLSWVMEAAAIMAIALANGGGKP  95



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLTS EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGGGKP  90



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/90 (86%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            S++LE IKNETVDLE IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LK
Sbjct  4    SLSLEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMELAAIMAIVLANGGGKP  93



>ref|XP_010414912.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=980

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_006409094.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
 gb|ESQ50547.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
Length=949

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEG NRL+IFGPNKLEEKKESKLLKF
Sbjct  3    LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG+GKP
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGNGKP  91



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   122 bits (307),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI LEQ+KNE V+LE++PIEEVF+ LKCSR+GLTS+EGA+RLQ+FGPNKLEEK E+K LK
Sbjct  3    SINLEQMKNEDVNLERVPIEEVFDHLKCSRQGLTSEEGASRLQVFGPNKLEEKSENKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGDGRP  92



>dbj|BAJ33915.1| unnamed protein product [Thellungiella halophila]
Length=949

 Score =   122 bits (306),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>emb|CDY64741.1| BnaCnng44750D [Brassica napus]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNE +DLE+IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+L
Sbjct  5    KAISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME AA+MAI LANG GKP
Sbjct  65   KFLGFMWNPLSWVMEVAALMAIVLANGGGKP  95



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_010467735.1| PREDICTED: ATPase 1, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/90 (86%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE IKNETVDLE IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LK
Sbjct  4    NISLEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMELAAIMAIVLANGGGKP  93



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_009112568.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
 emb|CDY30294.1| BnaA09g09830D [Brassica napus]
Length=949

 Score =   122 bits (306),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCS+EGL+SDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSKEGLSSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRP  92



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   122 bits (305),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 75/90 (83%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE+IKNETVDLE+IP+EEVF QLKC++EGLT+ EG  RLQIFGPNKLEEKKESK LK
Sbjct  4    SISLEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMEIAAIMAIVLANGGGKP  93



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            LKFLGFMWNPLSWVMEAAAIMAIALANG G+
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGR  94



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   121 bits (304),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IPIEEVFEQLKC+REGLTSDEGA R+++FGPNKLEEKKESK+LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLTSDEGARRIEVFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AAIMAIALANG GKP
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKP  90



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   121 bits (304),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M DK  +L++IK+E VDLE+IPIEEVFEQLKC++EGLTS+EG  RLQIFGPNKLEEKKES
Sbjct  1    MVDKENSLQEIKSENVDLERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAICLANGGGKP  94



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   121 bits (304),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 76/90 (84%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE I+NETVDLE IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LK
Sbjct  4    NISLEDIRNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMELAAIMAIVLANGGGKP  93



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   121 bits (304),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4    SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEA AIMAIALANG G+P
Sbjct  64   GFMWNPLSWVMEAPAIMAIALANGGGRP  91



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   121 bits (304),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            +G KS++LE IKNE+VDLEK+P+ EVFE LKC++EGLT++EG +RLQIFGPNKLEEK ES
Sbjct  8    VGTKSVSLEDIKNESVDLEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTES  67

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME AAIMAI LANG G+P
Sbjct  68   KFLKFLGFMWNPLSWVMEIAAIMAIVLANGGGEP  101



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   121 bits (303),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I+NETVDLE IPIEEVF QLKCS+EGLTSDEGA RL+IFGPNKLEEKKESK LKFLG
Sbjct  5    LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME+AAIMAI LANG GKP
Sbjct  65   FMWNPLSWVMESAAIMAIVLANGGGKP  91



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   121 bits (303),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4    SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  64   GFMWNPLSWVMEAAAIMAIALANGGGRP  91



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+KSI+LE+IKNE VDLE+IP++EVFEQLKC++EGLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3    GNKSISLEEIKNENVDLERIPVQEVFEQLKCTKEGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            +LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  63   ILKFLGFMWNPLSWVMEIAAIMAIALANGGGKP  95



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   120 bits (301),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNET+DLEKIPIEEVF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE K LKF
Sbjct  4    ISLEEIKNETIDLEKIPIEEVFQQLKCTKEGLTTAEGEKRLEIFGPNKLEEKKECKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME+AAIMAI LANG GKP
Sbjct  64   LGFMWNPLSWVMESAAIMAIVLANGGGKP  92



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            S++LE I+NETVDLE IPIEEVF++LKC+R+GLTSDEGA RLQIFGPNKLEEKKESK LK
Sbjct  4    SMSLEDIRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGPNKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMELAAIMAIVLANGGGKP  93



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 76/90 (84%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LEQIKNE+VDLEKIPIEEVF QLKC+REGL+S EG +R+QIFGPNKLEEKKESK LK
Sbjct  3    AISLEQIKNESVDLEKIPIEEVFAQLKCTREGLSSTEGESRIQIFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAA+MAIALANG G+P
Sbjct  63   FLGFMWNPLSWVMEAAAVMAIALANGGGQP  92



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE+IKNETVDLE+IP++EVF QLKC++EGLT+ EG  RLQIFGPNKLEEK ESK LK
Sbjct  7    SISLEEIKNETVDLERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI +ANG GKP
Sbjct  67   FLGFMWNPLSWVMEIAAIMAIVMANGGGKP  96



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
             LKFLGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRP  95



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_009102205.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
Length=949

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK LKFL
Sbjct  3    SLEDIKNENVDLEKIPIEEVFQQLKCSREGLTTREGEDRLQIFGPNKLEEKKESKFLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGGGKP  90



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQP  92



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ ++IKNE VDLEKIP+EEVF+QLKCSREGL+S+EG NRLQIFGPNKLEEK+E+K+LKF
Sbjct  5    ISWDEIKNENVDLEKIPVEEVFQQLKCSREGLSSEEGRNRLQIFGPNKLEEKEENKILKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANGDG+P
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRP  93



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  K + LE IKNE VDLE IPIEEVFEQLKCSREGL+++EG +RL IFGPNKLEEKKES
Sbjct  1    MAAKGLNLEDIKNEAVDLEHIPIEEVFEQLKCSREGLSAEEGDSRLAIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K+LKFLGFMWNPLSWVMEAAAIMAIALANGD KP
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGDNKP  94



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQP  92



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQP  92



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANG G+P
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQP  92



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  I++EQIKNE VDLE+IP+E+VF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE+
Sbjct  1    MGD--ISMEQIKNENVDLERIPVEQVFQQLKCTKEGLTTAEGEKRLKIFGPNKLEEKKEN  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVME+AAIMAI LANG GKP
Sbjct  59   KFLKFLGFMWNPLSWVMESAAIMAIVLANGGGKP  92



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   119 bits (299),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE I+NETVDLEKIP+EEVF+QLKC++EGLT+ EG NRLQIFGPNKLEEKKESK LKFL
Sbjct  11   SLEDIRNETVDLEKIPVEEVFQQLKCTKEGLTTAEGENRLQIFGPNKLEEKKESKFLKFL  70

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  71   GFMWNPLSWVMEAAAIMAIALANGGGRP  98



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVME AAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRP  90



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   119 bits (298),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            S++L+ IKNETVDLE+IPI+EVFEQLKC+REGL++ EG NR+QIFGPNKLEEKKESK LK
Sbjct  8    SLSLDNIKNETVDLERIPIDEVFEQLKCTREGLSTAEGENRIQIFGPNKLEEKKESKFLK  67

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAA+MAIALANGD +P
Sbjct  68   FLGFMWNPLSWVMEAAAVMAIALANGDRQP  97



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   119 bits (299),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNE VDLE IPIEEVF+QLKCSREGL+ +EGA RLQIFGPNKLEEKKESKLLKF
Sbjct  5    LSLEEIKNEHVDLENIPIEEVFKQLKCSREGLSEEEGAKRLQIFGPNKLEEKKESKLLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AA+MAI LANG GKP
Sbjct  65   LGFMWNPLSWVMECAAVMAIVLANGGGKP  93



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            LKFLGFMWNPLSWVMEAAAIMAIALANG  +
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGNR  94



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGK  552
            LKFLGFMWNPLSWVMEAAAIMAIALANG  +
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGNR  94



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 75/94 (80%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M    I+LEQIKNE++DLE+IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKES
Sbjct  1    MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K LKFLGFMWNPLSWVMEAAA+MAIALANG GKP
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKP  94



>gb|KEH32174.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=948

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
             E++KNE VDLE IPIEEVF+QLKC+REGLTS EG NRLQIFGPNKLEEK ESKLLKFLG
Sbjct  7    FEELKNENVDLENIPIEEVFKQLKCTREGLTSAEGENRLQIFGPNKLEEKTESKLLKFLG  66

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AA+MAI LANG GKP
Sbjct  67   FMWNPLSWVMEVAALMAIGLANGGGKP  93



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE +KNE VDLE+IP+EEVFEQLKC++ GLTS+EG  RLQIFGPNKLEEKKE+K+LKF
Sbjct  4    ISLEDVKNENVDLERIPVEEVFEQLKCTKRGLTSEEGQKRLQIFGPNKLEEKKENKILKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMA+ LANG GKP
Sbjct  64   LGFMWNPLSWVMECAAIMALVLANGGGKP  92



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   119 bits (297),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE I N+ +DLEKI +EEVFEQLKC++ GLTSDEGANRLQIFGPNK+EEKKESK L
Sbjct  3    KAISLEDITNKNIDLEKILVEEVFEQLKCTKXGLTSDEGANRLQIFGPNKVEEKKESKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANGD +P
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDRRP  93



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFL 
Sbjct  5    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLL  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEMAAIMAIALANGQGKP  91



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   119 bits (297),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE IKNET+DLE +PIEEVF +LKC+REGLTS+EGA RL IFGPNKLEEK+ESK LKF
Sbjct  5    ISLEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME+AAIMAI LANG GKP
Sbjct  65   LGFMWNPLSWVMESAAIMAIVLANGGGKP  93



>ref|XP_002886251.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62510.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
Length=949

 Score =   118 bits (296),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+ LKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQSLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   118 bits (296),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +++LE ++NETVDLE IPIEEVF++LKC+R+GLTSDEGA RLQIFG NKLEEKKESK LK
Sbjct  4    NMSLEDVRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGANKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMELAAIMAIVLANGGGKP  93



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   118 bits (296),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AA+MAIALANG GKP
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKP  90



>ref|XP_009120261.1| PREDICTED: ATPase 3, plasma membrane-type [Brassica rapa]
Length=952

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRP  94



>emb|CDY47940.1| BnaA02g08160D [Brassica napus]
 emb|CDY42259.1| BnaC02g11560D [Brassica napus]
Length=951

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  6    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  65

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  66   GFMWNPLSWVMEAAAIMAIALANGDGRP  93



>emb|CDY38294.1| BnaA10g11420D [Brassica napus]
Length=952

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRP  94



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  K+I+LE+IKNE VDLE+IP+EEVF+QL+C+REGL+S+EG  RLQIFGPNKLEEKKE+
Sbjct  1    MATKNISLEEIKNENVDLERIPVEEVFQQLQCTREGLSSEEGQKRLQIFGPNKLEEKKEN  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP  94



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AA+MAIALANG GKP
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKP  90



>emb|CDY25913.1| BnaC09g32850D [Brassica napus]
Length=952

 Score =   118 bits (295),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRP  94



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   118 bits (295),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNE+VDLE+IPIEEVFEQL+C+REGLTS+EG NRLQIFG NKLEEKKESK LKFLG
Sbjct  11   LEGIKNESVDLERIPIEEVFEQLRCTREGLTSNEGENRLQIFGFNKLEEKKESKFLKFLG  70

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AAIMAIALANGD KP
Sbjct  71   FMWNPLSWVMEIAAIMAIALANGDNKP  97



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   118 bits (295),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 71/91 (78%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+IK E VDLE+IP++EVFEQL+C++EGL+SDEG  RLQ+FGPNKLEEKKE+K+L
Sbjct  5    KGISLEEIKKENVDLERIPVQEVFEQLQCTKEGLSSDEGQKRLQVFGPNKLEEKKENKVL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVME AAIMAIALANG G+P
Sbjct  65   KFLGFMWNPLSWVMEIAAIMAIALANGGGRP  95



>gb|KJB70727.1| hypothetical protein B456_011G089100 [Gossypium raimondii]
Length=953

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 71/94 (76%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M + S+ LE IKNET+DLE+IP+ EVF++LKC+R+GL+S+EG  RL IFGPNKLEEK+ES
Sbjct  1    MAETSVGLEDIKNETIDLERIPVHEVFQKLKCTRDGLSSEEGQKRLHIFGPNKLEEKQES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K+LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  61   KVLKFLGFMWNPLSWVMEIAAIMAIALANGGGKP  94



>ref|XP_011468858.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=976

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE +KNE VDLEKIP+EEVFEQLKCS++GL++DEG  RLQ+FG NKLEEKKESK+LKF
Sbjct  4    ISLEDVKNENVDLEKIPVEEVFEQLKCSKQGLSTDEGTKRLQVFGKNKLEEKKESKVLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  64   LGFMWNPLSWVMELAAIMAIALANGGGKP  92



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M    I+LE++KNE VDLE+IP++EVFEQLKC+++GL+++EG  RLQIFGPNKLEEKKES
Sbjct  1    MATTDISLEELKNENVDLERIPVDEVFEQLKCTKDGLSNEEGVKRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVME+AAIMAIALANG GKP
Sbjct  61   KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKP  94



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 72/91 (79%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IK E VDLE+IP++EVFEQL C++EGL+SDEG  RLQIFGPNKLEEKK++K+L
Sbjct  5    KAISLEEIKKENVDLERIPVQEVFEQLNCTKEGLSSDEGQKRLQIFGPNKLEEKKDNKVL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KFLGFMWNPLSWVMEAAAIMAIALANG G+P
Sbjct  65   KFLGFMWNPLSWVMEAAAIMAIALANGGGRP  95



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  14   LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVME AA+MAIALANG GKP
Sbjct  74   FMWNPLSWVMEMAAVMAIALANGGGKP  100



>ref|XP_008677658.1| PREDICTED: uncharacterized protein LOC100383904 isoform X1 [Zea 
mays]
 gb|AFW64135.1| hypothetical protein ZEAMMB73_387587 [Zea mays]
Length=951

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE ++NETVDLE +P++EVF+ LKCS+EGL+S EG NRL+IFGPNKLEEK ESKLLK
Sbjct  3    SISLEDVRNETVDLETVPVQEVFQHLKCSKEGLSSAEGDNRLKIFGPNKLEEKSESKLLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAI LANG GKP
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIVLANGGGKP  92



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 78/87 (90%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKP  91



>ref|XP_004287218.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=948

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE +KNE VDLEKIP+EEVFEQLKCS++GL++DEG  RLQ+FG NKLEEKKESK+LKF
Sbjct  4    ISLEDVKNENVDLEKIPVEEVFEQLKCSKQGLSTDEGTKRLQVFGKNKLEEKKESKVLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  64   LGFMWNPLSWVMELAAIMAIALANGGGKP  92



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANGDG+P
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRP  93



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 73/90 (81%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +++LE+IKNE+VDLE+IPIEEVFEQLKC+++GLTS+EG +RLQIFG NKLEEKKESK+LK
Sbjct  4    TMSLEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMECAAIMAIVLANGGGKP  93



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANGDG+P
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRP  93



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 78/87 (90%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKP  91



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVMEAAAIMAI LANGDG+P
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRP  93



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE IKNETVDLE +PIEEVF +LKCS++GLTS EGA RL+IFGPNKLEEKKE+KLLKF
Sbjct  5    ISLEAIKNETVDLEHVPIEEVFNELKCSKDGLTSAEGAKRLEIFGPNKLEEKKENKLLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  65   LGFMWNPLSWVMEIAAIMAIALANGGGKP  93



>ref|XP_009150710.1| PREDICTED: ATPase 1, plasma membrane-type-like [Brassica rapa]
Length=949

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNE VDLEKIPIEEVF+QLKC+ EGLT+ EG +R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LENIKNENVDLEKIPIEEVFQQLKCTSEGLTTQEGEDRIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRP  90



>gb|KEH19962.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/90 (79%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI LEQ+KNE VDL+++P+EEVF+ LKCSR+GLTS+EGA+RL++FG NKLEEK E+K LK
Sbjct  3    SINLEQLKNENVDLDRVPLEEVFDHLKCSRQGLTSEEGASRLEVFGHNKLEEKTENKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGDGRP  92



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKP  91



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  I+LE +KNE +DLE+IPIEEVFEQLKC++EGLT+ EG  RLQIFGPNKLEEKKES
Sbjct  1    MGD--ISLEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKES  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            KLLKFLGFMWNPLSWVME+AAIMAI LANG GKP
Sbjct  59   KLLKFLGFMWNPLSWVMESAAIMAIVLANGGGKP  92



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LENIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKP  91



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE IKNETVDLE +PIEEVF +LKCS++GLTS EGA RL+IFGPNKLEEKKE+KLLKF
Sbjct  5    ISLEAIKNETVDLEHVPIEEVFNELKCSKDGLTSAEGAKRLEIFGPNKLEEKKENKLLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  65   LGFMWNPLSWVMEIAAIMAIALANGGGKP  93



>gb|KHN22097.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=1183

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E +KNE VDLE IPIEEVF+QLKC+REGLTS EG  RLQ+FGPNKLEEK +SKLLKF
Sbjct  5    ISFEDLKNENVDLEHIPIEEVFKQLKCTREGLTSAEGEKRLQVFGPNKLEEKTDSKLLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKP  555
            LGFMWNPLSWVME AAIMAI LANG GKP
Sbjct  65   LGFMWNPLSWVMEVAAIMAIVLANGGGKP  93



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAA+MAIALANGD +P
Sbjct  64   FMWNPLSWVMEAAALMAIALANGDNRP  90



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNETVDLE+IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEK+ESKLLKFLG
Sbjct  5    LEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGK  552
            FMWNPLSWVMEAAAIMAI LANG G+
Sbjct  65   FMWNPLSWVMEAAAIMAIVLANGGGE  90



>gb|KJB56561.1| hypothetical protein B456_009G125200 [Gossypium raimondii]
Length=953

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M D   TL++IKNE VDLE+IP+EEVF QLKC++EGLT++EG  RLQIFGPNKLEEK ES
Sbjct  1    MVDIDDTLQEIKNENVDLERIPVEEVFLQLKCTKEGLTTEEGLKRLQIFGPNKLEEKSES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            K+LKFLGFMWNPLSWVME AAIMAIALANG GKP
Sbjct  61   KVLKFLGFMWNPLSWVMEIAAIMAIALANGGGKP  94



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 77/87 (89%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAIALANG GKP
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKP  91



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +++LE IKNE VDLE IP+EEVF+QLKCS+EGL+S+EG  R+QIFGPNKLEEKKE+KLLK
Sbjct  4    NLSLEDIKNEQVDLENIPVEEVFQQLKCSKEGLSSEEGQKRIQIFGPNKLEEKKENKLLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVME+AAIMAI LANG GKP
Sbjct  64   FLGFMWNPLSWVMESAAIMAIVLANGGGKP  93



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAA+MAIALANGD +P
Sbjct  64   FMWNPLSWVMEAAALMAIALANGDNRP  90



>ref|XP_002452983.1| hypothetical protein SORBIDRAFT_04g036040 [Sorghum bicolor]
 gb|EES05959.1| hypothetical protein SORBIDRAFT_04g036040 [Sorghum bicolor]
Length=951

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE ++NETVDLE +P++EVF+ LKCS++GL+S EG NRL+IFGPNKLEEK ESKLLK
Sbjct  3    SISLEDVRNETVDLETVPVQEVFQHLKCSKQGLSSAEGENRLKIFGPNKLEEKSESKLLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKP  555
            FLGFMWNPLSWVMEAAAIMAI LANG GKP
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIVLANGGGKP  92



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+ IFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIVIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKP  555
            GFMWNPLSWVMEAAAIMAIALANGDG+P
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRP  90



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   117 bits (292),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIVIFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKP  555
            FMWNPLSWVMEAAAIMAI LANGD +P
Sbjct  64   FMWNPLSWVMEAAAIMAIVLANGDNRP  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985