BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS124A05

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA71762.1|  Ubiquitin activating enzyme E1                       77.8    6e-14   Nicotiana tabacum [American tobacco]
ref|XP_009804780.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  77.8    6e-14   Nicotiana sylvestris
ref|XP_009621642.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  77.8    6e-14   Nicotiana tomentosiformis
dbj|BAD00984.1|  ubiquitin activating enzyme 2                        77.8    6e-14   Nicotiana tabacum [American tobacco]
dbj|BAD00983.1|  ubiquitin activating enzyme 1                        77.8    7e-14   Nicotiana tabacum [American tobacco]
ref|XP_003537305.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  63.2    6e-09   Glycine max [soybeans]
ref|XP_006602078.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  63.2    6e-09   Glycine max [soybeans]
ref|XP_010676802.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  62.8    8e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|AEK86562.1|  ubiquitin activating enzyme E1                        62.8    8e-09   Camellia sinensis [black tea]
ref|XP_006591250.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  62.8    9e-09   Glycine max [soybeans]
ref|XP_010685926.1|  PREDICTED: ubiquitin-activating enzyme E1 1      62.4    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004246264.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  62.0    1e-08   Solanum lycopersicum
ref|XP_006847418.1|  hypothetical protein AMTR_s00153p00065050        62.0    1e-08   
ref|XP_006359551.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  62.0    1e-08   Solanum tuberosum [potatoes]
emb|CBI18124.3|  unnamed protein product                              61.6    2e-08   Vitis vinifera
ref|XP_010653401.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  61.2    3e-08   Vitis vinifera
ref|XP_010653400.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  60.8    4e-08   Vitis vinifera
ref|XP_010257066.1|  PREDICTED: ubiquitin-activating enzyme E1 1      60.5    5e-08   
ref|XP_004500302.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  60.1    7e-08   
ref|XP_007146816.1|  hypothetical protein PHAVU_006G072200g           60.1    7e-08   Phaseolus vulgaris [French bean]
ref|XP_010907859.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  59.7    8e-08   
ref|XP_008804921.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  59.7    9e-08   
ref|XP_008804930.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  59.3    1e-07   Phoenix dactylifera
ref|XP_002275617.3|  PREDICTED: ubiquitin-activating enzyme E1 1      59.3    1e-07   Vitis vinifera
gb|KGN47054.1|  Ubiquitin-activating enzyme E1                        58.9    1e-07   Cucumis sativus [cucumbers]
ref|XP_004143167.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  58.9    1e-07   
ref|XP_009420363.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  58.9    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922601.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.9    2e-07   Elaeis guineensis
ref|XP_008677098.1|  PREDICTED: uncharacterized protein LOC100279...  58.9    2e-07   
ref|XP_010922602.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   Elaeis guineensis
ref|XP_008668365.1|  PREDICTED: hypothetical protein isoform X1       58.5    2e-07   Zea mays [maize]
gb|AFW64557.1|  hypothetical protein ZEAMMB73_373105                  58.5    2e-07   
ref|XP_010937921.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  58.5    2e-07   Elaeis guineensis
emb|CBI15908.3|  unnamed protein product                              58.5    2e-07   Vitis vinifera
ref|XP_010937922.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  58.5    2e-07   Elaeis guineensis
ref|XP_008465272.1|  PREDICTED: ubiquitin-activating enzyme E1 1      58.5    2e-07   Cucumis melo [Oriental melon]
ref|XP_008366783.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   
gb|AFW64560.1|  hypothetical protein ZEAMMB73_373105                  58.5    2e-07   
ref|XP_008662115.1|  PREDICTED: uncharacterized protein LOC100381...  58.5    2e-07   
ref|XP_002442655.1|  hypothetical protein SORBIDRAFT_08g000540        58.5    2e-07   Sorghum bicolor [broomcorn]
ref|XP_002450102.1|  hypothetical protein SORBIDRAFT_05g000520        58.5    2e-07   Sorghum bicolor [broomcorn]
ref|XP_011095062.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   Sesamum indicum [beniseed]
ref|XP_011095060.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   Sesamum indicum [beniseed]
gb|KDP22845.1|  hypothetical protein JCGZ_00432                       58.5    2e-07   Jatropha curcas
ref|XP_004978585.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  58.5    2e-07   Setaria italica
gb|EYU41943.1|  hypothetical protein MIMGU_mgv1a000559mg              58.5    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004302531.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   Fragaria vesca subsp. vesca
ref|XP_011095059.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.5    2e-07   
ref|XP_004977630.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  58.5    2e-07   Setaria italica
ref|XP_010089532.1|  Ubiquitin-activating enzyme E1 1                 58.2    3e-07   
ref|XP_007208126.1|  hypothetical protein PRUPE_ppa000563mg           58.2    3e-07   
ref|XP_004958792.1|  PREDICTED: ubiquitin-activating enzyme E1 3-...  58.2    3e-07   Setaria italica
ref|XP_008243126.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  58.2    3e-07   Prunus mume [ume]
gb|KHG10931.1|  Ubiquitin-activating enzyme E1 1 -like protein        58.2    3e-07   Gossypium arboreum [tree cotton]
ref|XP_002313232.2|  hypothetical protein POPTR_0009s07950g           58.2    3e-07   
gb|KJB20444.1|  hypothetical protein B456_003G148600                  58.2    3e-07   Gossypium raimondii
ref|XP_004958791.1|  PREDICTED: ubiquitin-activating enzyme E1 3-...  58.2    3e-07   Setaria italica
ref|XP_010491209.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  57.8    3e-07   Camelina sativa [gold-of-pleasure]
gb|KDP45776.1|  hypothetical protein JCGZ_17383                       57.8    3e-07   Jatropha curcas
ref|XP_009369576.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.8    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_011003646.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.8    4e-07   Populus euphratica
ref|XP_008235385.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.8    4e-07   Prunus mume [ume]
gb|KDO66997.1|  hypothetical protein CISIN_1g001074mg                 57.8    4e-07   Citrus sinensis [apfelsine]
ref|XP_011461461.1|  PREDICTED: ubiquitin-activating enzyme E1 1      57.4    4e-07   Fragaria vesca subsp. vesca
ref|XP_008811687.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.4    5e-07   Phoenix dactylifera
ref|XP_008345334.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.4    5e-07   
ref|XP_002313230.2|  ubiquitin activating enzyme 2 family protein     57.4    5e-07   
ref|XP_006425139.1|  hypothetical protein CICLE_v10027704mg           57.4    5e-07   Citrus clementina [clementine]
ref|XP_011003623.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.4    5e-07   Populus euphratica
ref|XP_010452577.1|  PREDICTED: ubiquitin-activating enzyme E1 2      57.4    5e-07   
ref|XP_010043403.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  57.4    5e-07   Eucalyptus grandis [rose gum]
ref|XP_007208384.1|  hypothetical protein PRUPE_ppa000549mg           57.4    5e-07   
gb|KDO66996.1|  hypothetical protein CISIN_1g001074mg                 57.4    5e-07   Citrus sinensis [apfelsine]
gb|KDO66999.1|  hypothetical protein CISIN_1g001074mg                 57.4    6e-07   Citrus sinensis [apfelsine]
ref|XP_002526617.1|  ubiquitin-activating enzyme E1, putative         57.4    6e-07   
ref|XP_011003628.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.4    6e-07   Populus euphratica
ref|XP_008235451.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.0    6e-07   Prunus mume [ume]
ref|XP_010043404.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  57.0    6e-07   Eucalyptus grandis [rose gum]
ref|XP_002313231.2|  hypothetical protein POPTR_0009s07960g           57.0    6e-07   
gb|KJB26263.1|  hypothetical protein B456_004G233800                  57.0    6e-07   Gossypium raimondii
ref|XP_006425138.1|  hypothetical protein CICLE_v10027704mg           57.0    7e-07   Citrus clementina [clementine]
gb|KDO66998.1|  hypothetical protein CISIN_1g001074mg                 57.0    7e-07   Citrus sinensis [apfelsine]
ref|XP_006429468.1|  hypothetical protein CICLE_v10010950mg           57.0    7e-07   Citrus clementina [clementine]
ref|XP_006488575.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.0    7e-07   
gb|KDO63225.1|  hypothetical protein CISIN_1g0013011mg                57.0    7e-07   Citrus sinensis [apfelsine]
gb|KDO63224.1|  hypothetical protein CISIN_1g0013011mg                57.0    7e-07   Citrus sinensis [apfelsine]
ref|XP_009590106.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  57.0    7e-07   Nicotiana tomentosiformis
gb|KJB26261.1|  hypothetical protein B456_004G233800                  57.0    7e-07   Gossypium raimondii
ref|XP_009802174.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  56.6    8e-07   Nicotiana sylvestris
ref|XP_006481094.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  56.6    8e-07   Citrus sinensis [apfelsine]
ref|XP_006286939.1|  hypothetical protein CARUB_v10000084mg           56.6    9e-07   Capsella rubella
ref|XP_002300000.2|  ubiquitin activating enzyme 2 family protein     56.6    1e-06   
ref|XP_008789164.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  56.6    1e-06   Phoenix dactylifera
gb|ABA95612.2|  Ubiquitin-activating enzyme E1 2, putative, expre...  56.6    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412523.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  56.6    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662651.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  56.2    1e-06   Oryza brachyantha
ref|XP_008789165.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  56.2    1e-06   Phoenix dactylifera
ref|XP_011080780.1|  PREDICTED: ubiquitin-activating enzyme E1 1      56.2    1e-06   Sesamum indicum [beniseed]
ref|XP_010089531.1|  Ubiquitin-activating enzyme E1 2                 56.2    1e-06   Morus notabilis
emb|CDP09233.1|  unnamed protein product                              56.2    1e-06   Coffea canephora [robusta coffee]
gb|EEE52605.1|  hypothetical protein OsJ_34931                        56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004240416.1|  PREDICTED: ubiquitin-activating enzyme E1 1      56.2    1e-06   Solanum lycopersicum
gb|EPS70237.1|  hypothetical protein M569_04521                       56.2    1e-06   Genlisea aurea
ref|NP_001065539.1|  Os11g0106400                                     56.2    1e-06   
ref|XP_006664269.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  56.2    1e-06   Oryza brachyantha
ref|XP_009337737.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  56.2    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_006344068.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  56.2    1e-06   Solanum tuberosum [potatoes]
ref|XP_008370185.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  56.2    1e-06   
ref|XP_009376402.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  56.2    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_009802175.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  56.2    1e-06   Nicotiana sylvestris
ref|XP_009590107.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.8    1e-06   Nicotiana tomentosiformis
ref|XP_010033002.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.8    1e-06   
ref|XP_010032999.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.8    2e-06   Eucalyptus grandis [rose gum]
ref|XP_011024908.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.8    2e-06   Populus euphratica
gb|EEC67514.1|  hypothetical protein OsI_34806                        55.8    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010033000.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.5    2e-06   
ref|XP_002862736.1|  hypothetical protein ARALYDRAFT_359413           55.1    2e-06   
gb|KHG05202.1|  Ubiquitin-activating enzyme E1 1 -like protein        55.5    2e-06   Gossypium arboreum [tree cotton]
gb|KJB83907.1|  hypothetical protein B456_013G270300                  55.5    2e-06   Gossypium raimondii
gb|KCW52518.1|  hypothetical protein EUGRSUZ_J01907                   55.5    2e-06   Eucalyptus grandis [rose gum]
gb|KCW52517.1|  hypothetical protein EUGRSUZ_J01907                   55.5    2e-06   Eucalyptus grandis [rose gum]
gb|KHG29820.1|  Ubiquitin-activating enzyme E1 2 -like protein        55.5    2e-06   Gossypium arboreum [tree cotton]
gb|KJB20437.1|  hypothetical protein B456_003G148200                  55.5    2e-06   Gossypium raimondii
ref|XP_006293588.1|  hypothetical protein CARUB_v10022535mg           55.5    3e-06   
ref|XP_002982764.1|  hypothetical protein SELMODRAFT_179776           55.1    3e-06   
gb|EMS68322.1|  Ubiquitin-activating enzyme E1 2                      55.1    3e-06   Triticum urartu
ref|XP_006410077.1|  hypothetical protein EUTSA_v10016166mg           55.1    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008653532.1|  PREDICTED: ubiquitin-activating enzyme E1 3 ...  55.1    3e-06   Zea mays [maize]
ref|XP_008653531.1|  PREDICTED: ubiquitin-activating enzyme E1 3 ...  55.1    3e-06   Zea mays [maize]
ref|XP_009122253.1|  PREDICTED: ubiquitin-activating enzyme E1 2      55.1    3e-06   Brassica rapa
gb|EMT16594.1|  Ubiquitin-activating enzyme E1 1                      55.1    3e-06   
ref|XP_003579050.1|  PREDICTED: ubiquitin-activating enzyme E1 2      55.1    3e-06   Brachypodium distachyon [annual false brome]
emb|CDY29699.1|  BnaA04g17280D                                        55.1    3e-06   Brassica napus [oilseed rape]
emb|CDX84858.1|  BnaA03g13720D                                        55.1    3e-06   
ref|XP_009141040.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.1    3e-06   Brassica rapa
ref|XP_006399119.1|  hypothetical protein EUTSA_v10012525mg           55.1    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009133152.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.1    3e-06   Brassica rapa
emb|CDY24028.1|  BnaC03g16630D                                        55.1    3e-06   Brassica napus [oilseed rape]
sp|P20973.1|UBE11_WHEAT  RecName: Full=Ubiquitin-activating enzym...  55.1    3e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002990914.1|  hypothetical protein SELMODRAFT_161306           55.1    3e-06   
ref|XP_003576371.2|  PREDICTED: ubiquitin-activating enzyme E1 2-...  55.1    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_010557978.1|  PREDICTED: ubiquitin-activating enzyme E1 2      55.1    3e-06   Tarenaya hassleriana [spider flower]
emb|CDX97850.1|  BnaC04g40890D                                        55.1    3e-06   
emb|CDY10711.1|  BnaA05g12250D                                        55.1    3e-06   Brassica napus [oilseed rape]
ref|XP_009144330.1|  PREDICTED: ubiquitin-activating enzyme E1 1      55.1    3e-06   Brassica rapa
ref|XP_002881085.1|  hypothetical protein ARALYDRAFT_481921           55.1    3e-06   Arabidopsis lyrata subsp. lyrata
gb|AAL90910.1|  At2g30110/T27E13.15                                   55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565693.1|  ubiquitin-activating enzyme E1 1                    55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469894.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  55.1    3e-06   
ref|XP_010414311.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  54.7    3e-06   Camelina sativa [gold-of-pleasure]
emb|CDY02037.1|  BnaC04g14640D                                        54.7    3e-06   
ref|XP_007016954.1|  Ubiquitin activating enzyme 2, 2 isoform 1       54.7    4e-06   
ref|XP_002526660.1|  ubiquitin-activating enzyme E1, putative         54.7    4e-06   Ricinus communis
ref|XP_010510409.1|  PREDICTED: ubiquitin-activating enzyme E1 1      54.7    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010521968.1|  PREDICTED: ubiquitin-activating enzyme E1 1 ...  54.7    4e-06   
ref|NP_001060725.1|  Os07g0692900                                     54.7    4e-06   
gb|EEC82734.1|  hypothetical protein OsI_27435                        54.7    4e-06   Oryza sativa Indica Group [Indian rice]
gb|EEE67868.1|  hypothetical protein OsJ_25682                        54.7    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461268.1|  hypothetical protein SORBIDRAFT_02g043880        54.3    5e-06   Sorghum bicolor [broomcorn]
emb|CDX98925.1|  BnaC09g49100D                                        54.3    5e-06   
emb|CDY67833.1|  BnaA10g30270D                                        54.3    5e-06   Brassica napus [oilseed rape]
ref|NP_568168.1|  ubiquitin-activating enzyme E1 2                    54.3    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871219.1|  ATUBA2                                           54.3    6e-06   
ref|XP_007016956.1|  Ubiquitin-activating enzyme 1 isoform 1          53.9    6e-06   
ref|XP_007016957.1|  Ubiquitin-activating enzyme E1 1 isoform 2       53.9    7e-06   
ref|NP_001049821.1|  Os03g0294900                                     53.9    7e-06   
ref|XP_003615801.1|  Ubiquitin-activating enzyme E1                   53.9    7e-06   
ref|XP_003615802.1|  Ubiquitin-activating enzyme E1                   53.9    7e-06   
ref|XP_009381381.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  53.5    8e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003615800.1|  Ubiquitin-activating enzyme E1                   53.9    8e-06   
ref|XP_006658172.1|  PREDICTED: ubiquitin-activating enzyme E1 3-...  53.5    9e-06   
ref|XP_009381382.1|  PREDICTED: ubiquitin-activating enzyme E1 2-...  53.5    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE58872.1|  hypothetical protein OsJ_10472                        53.5    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490630.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  53.1    1e-05   
gb|EMT09352.1|  Ubiquitin-activating enzyme E1 2                      53.1    1e-05   
ref|XP_004490631.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  53.1    1e-05   Cicer arietinum [garbanzo]
gb|EMS68144.1|  Ubiquitin-activating enzyme E1 2                      53.1    1e-05   Triticum urartu
ref|XP_001765171.1|  predicted protein                                52.8    1e-05   
ref|XP_010542669.1|  PREDICTED: ubiquitin-activating enzyme E1 1-...  52.8    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_001752631.1|  predicted protein                                52.8    2e-05   
ref|XP_002465413.1|  hypothetical protein SORBIDRAFT_01g038300        52.4    2e-05   
ref|XP_003562406.2|  PREDICTED: ubiquitin-activating enzyme E1 3 ...  52.4    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_010233609.1|  PREDICTED: ubiquitin-activating enzyme E1 3 ...  52.4    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_008654582.1|  PREDICTED: ubiquitin-activating enzyme E1 3-...  52.4    2e-05   Zea mays [maize]
dbj|BAK05907.1|  predicted protein                                    52.0    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P31252.1|UBE13_WHEAT  RecName: Full=Ubiquitin-activating enzym...  52.0    3e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007142173.1|  hypothetical protein PHAVU_008G258500g           52.0    3e-05   Phaseolus vulgaris [French bean]
sp|P31251.1|UBE12_WHEAT  RecName: Full=Ubiquitin-activating enzym...  52.0    3e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003544897.2|  PREDICTED: ubiquitin-activating enzyme E1 1-...  51.6    4e-05   Glycine max [soybeans]
ref|XP_003055551.1|  predicted protein                                51.6    5e-05   Micromonas pusilla CCMP1545
gb|KHN46129.1|  Ubiquitin-activating enzyme E1 2                      51.2    5e-05   Glycine soja [wild soybean]
gb|EMS51846.1|  Ubiquitin-activating enzyme E1 3                      51.2    5e-05   Triticum urartu
ref|XP_003518319.2|  PREDICTED: ubiquitin-activating enzyme E1 1-...  50.8    6e-05   Glycine max [soybeans]
ref|XP_005647121.1|  ubiquitin-activating enzyme E1                   50.8    8e-05   Coccomyxa subellipsoidea C-169
ref|XP_002503580.1|  predicted protein                                49.7    2e-04   Micromonas commoda
gb|KJB83908.1|  hypothetical protein B456_013G270400                  49.7    2e-04   Gossypium raimondii
ref|XP_007508781.1|  predicted protein                                49.3    3e-04   Bathycoccus prasinos
ref|XP_011398027.1|  Ubiquitin-activating enzyme E1 2                 48.9    3e-04   Auxenochlorella protothecoides
emb|CEF98884.1|  Ubiquitin/SUMO-activating enzyme E1                  48.1    6e-04   Ostreococcus tauri
ref|XP_003080559.1|  ubiquitin activating enzyme (ISS)                48.1    6e-04   



>emb|CAA71762.1| Ubiquitin activating enzyme E1 [Nicotiana tabacum]
Length=1080

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  51   DVNANGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNV  98



>ref|XP_009804780.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Nicotiana sylvestris]
Length=1080

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  51   DVNANGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNV  98



>ref|XP_009621642.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Nicotiana tomentosiformis]
Length=1080

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  51   DVNTNGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNV  98



>dbj|BAD00984.1| ubiquitin activating enzyme 2 [Nicotiana tabacum]
Length=1080

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  51   DVNTNGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNV  98



>dbj|BAD00983.1| ubiquitin activating enzyme 1 [Nicotiana tabacum]
Length=1080

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  51   DVNANGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNV  98



>ref|XP_003537305.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Glycine 
max]
Length=1154

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  143  NPPDIDEDLHSRQLAVYGRETMRRLFGSNV  172



>ref|XP_006602078.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max]
Length=1112

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  101  NQPDIDEDLHSRQLAVYGRETMRRLFGSNV  130



>ref|XP_010676802.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Beta vulgaris 
subsp. vulgaris]
Length=1090

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 7/53 (13%)
 Frame = +2

Query  182  NGRRTENGKS--PI----DCSRNSP-DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NG+ + NGKS  PI    D + N+P DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  56   NGKDSGNGKSERPIMGLGDGNINNPNDIDEDLHSRQLAVYGRETMRRLFASNV  108



>gb|AEK86562.1| ubiquitin activating enzyme E1 [Camellia sinensis]
Length=1094

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = +2

Query  200  NGKSPI-DCSR-NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NGK+P+ D     SPDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  71   NGKAPMMDLGEGKSPDIDEDLHSRQLAVYGRETMRRLFASNV  112



>ref|XP_006591250.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Glycine 
max]
Length=1094

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  83   NPPDIDEDLHSRQLAVYGRETMRRLFGSNV  112



>ref|XP_010685926.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Beta vulgaris subsp. 
vulgaris]
Length=1083

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  72   NPPDIDEDLHSRQLAVYGRETMRRLFGSNV  101



>ref|XP_004246264.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Solanum lycopersicum]
Length=1084

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 4/53 (8%)
 Frame = +2

Query  170  DAVSNGRRTEN---GKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T     G SP+D  RN  DIDEDLHSRQLAVYGRETMR+L  +NV
Sbjct  53   DVSANGNATNGRTGGVSPVDL-RNLSDIDEDLHSRQLAVYGRETMRKLFAANV  104



>ref|XP_006847418.1| hypothetical protein AMTR_s00153p00065050 [Amborella trichopoda]
 gb|ERN08999.1| hypothetical protein AMTR_s00153p00065050 [Amborella trichopoda]
Length=1121

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL G+NV
Sbjct  110  NPPDIDEDLHSRQLAVYGRETMRRLFGANV  139



>ref|XP_006359551.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Solanum tuberosum]
Length=1085

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 4/53 (8%)
 Frame = +2

Query  170  DAVSNGRRTEN---GKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D  +NG  T     G SP+D  RN  DIDEDLHSRQLAVYGRETMR+L  +NV
Sbjct  54   DVSANGNATNGRTGGISPVDL-RNLSDIDEDLHSRQLAVYGRETMRKLFAANV  105



>emb|CBI18124.3| unnamed protein product [Vitis vinifera]
Length=1066

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  7    NPPDIDEDLHSRQLAVYGRETMRRLFASNV  36



>ref|XP_010653401.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Vitis 
vinifera]
Length=1018

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  7    NPPDIDEDLHSRQLAVYGRETMRRLFASNV  36



>ref|XP_010653400.1| PREDICTED: ubiquitin-activating enzyme E1 2-like isoform X1 [Vitis 
vinifera]
Length=1090

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  79   NPPDIDEDLHSRQLAVYGRETMRRLFASNV  108



>ref|XP_010257066.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Nelumbo nucifera]
Length=1153

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  142  NPPDIDEDLHSRQLAVYGRETMRRLFASNI  171



>ref|XP_004500302.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Cicer arietinum]
Length=1141

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL G++V
Sbjct  130  NPPDIDEDLHSRQLAVYGRETMRRLFGASV  159



>ref|XP_007146816.1| hypothetical protein PHAVU_006G072200g [Phaseolus vulgaris]
 ref|XP_007146817.1| hypothetical protein PHAVU_006G072200g [Phaseolus vulgaris]
 gb|ESW18810.1| hypothetical protein PHAVU_006G072200g [Phaseolus vulgaris]
 gb|ESW18811.1| hypothetical protein PHAVU_006G072200g [Phaseolus vulgaris]
Length=1087

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMRRL GS+V
Sbjct  76   NPPDIDEDLHSRQLAVYGRETMRRLFGSSV  105



>ref|XP_010907859.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Elaeis guineensis]
Length=1073

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 4/49 (8%)
 Frame = +2

Query  182  NGRRTENGKSPIDCS---RNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N   T NG   +DC     N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  44   NHSGTANGMD-MDCDANGSNPAEIDEDLHSRQLAVYGRETMRRLFGSNV  91



>ref|XP_008804921.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Phoenix 
dactylifera]
Length=1131

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 15/81 (19%)
 Frame = +2

Query  86   KRLKSDCYIggggeessvemggvevngnDAVSNGRRTENGKSPIDCS---RNSPDIDEDL  256
            K+ ++DC I     E++ E            SN     NG   ++C     N P+IDEDL
Sbjct  81   KKTRTDCLISSASTEAAAEE-----------SNHSEPANGMD-MECDANGSNPPEIDEDL  128

Query  257  HSRQLAVYGRETMRRLIGSNV  319
            HSRQLAVYGRETMRRL  SNV
Sbjct  129  HSRQLAVYGRETMRRLFASNV  149



>ref|XP_008804930.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Phoenix 
dactylifera]
Length=1073

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 15/81 (19%)
 Frame = +2

Query  86   KRLKSDCYIggggeessvemggvevngnDAVSNGRRTENGKSPIDCS---RNSPDIDEDL  256
            K+ ++DC I     E++ E            SN     NG   ++C     N P+IDEDL
Sbjct  23   KKTRTDCLISSASTEAAAEE-----------SNHSEPANGMD-MECDANGSNPPEIDEDL  70

Query  257  HSRQLAVYGRETMRRLIGSNV  319
            HSRQLAVYGRETMRRL  SNV
Sbjct  71   HSRQLAVYGRETMRRLFASNV  91



>ref|XP_002275617.3| PREDICTED: ubiquitin-activating enzyme E1 1 [Vitis vinifera]
Length=1144

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            PDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  135  PDIDEDLHSRQLAVYGRETMRRLFASNV  162



>gb|KGN47054.1| Ubiquitin-activating enzyme E1 [Cucumis sativus]
Length=1161

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  150  NPPDIDEDLHSRQLAVYGRETMRKLFASNV  179



>ref|XP_004143167.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus]
 ref|XP_004166684.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus]
Length=1152

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  141  NPPDIDEDLHSRQLAVYGRETMRKLFASNV  170



>ref|XP_009420363.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420364.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Musa acuminata 
subsp. malaccensis]
Length=1076

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  200  NGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NG    +  R   DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  54   NGMEVDEGGRKQADIDEDLHSRQLAVYGRETMRRLFASNV  93



>ref|XP_010922601.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Elaeis 
guineensis]
Length=1131

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N P+IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  120  NPPEIDEDLHSRQLAVYGRETMRRLFASNV  149



>ref|XP_008677098.1| PREDICTED: uncharacterized protein LOC100279472 isoform X1 [Zea 
mays]
 gb|AFW64558.1| hypothetical protein ZEAMMB73_373105 [Zea mays]
 gb|AFW64559.1| hypothetical protein ZEAMMB73_373105 [Zea mays]
Length=1056

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  46   APEIDEDLHSRQLAVYGRETMKRLFGSNV  74



>ref|XP_010922602.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Elaeis 
guineensis]
Length=1073

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N P+IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  62   NPPEIDEDLHSRQLAVYGRETMRRLFASNV  91



>ref|XP_008668365.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=1051

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  41   APEIDEDLHSRQLAVYGRETMKRLFGSNV  69



>gb|AFW64557.1| hypothetical protein ZEAMMB73_373105 [Zea mays]
Length=863

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  46   APEIDEDLHSRQLAVYGRETMKRLFGSNV  74



>ref|XP_010937921.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Elaeis 
guineensis]
Length=1081

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  173  AVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            A     R  +G +     RN  DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  51   AADGNHRPPHGMACDSNGRNGADIDEDLHSRQLAVYGRETMRRLFASSV  99



>emb|CBI15908.3| unnamed protein product [Vitis vinifera]
Length=1046

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            PDIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  78   PDIDEDLHSRQLAVYGRETMRRLFASNV  105



>ref|XP_010937922.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Elaeis 
guineensis]
Length=1066

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  173  AVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            A     R  +G +     RN  DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  36   AADGNHRPPHGMACDSNGRNGADIDEDLHSRQLAVYGRETMRRLFASSV  84



>ref|XP_008465272.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Cucumis melo]
Length=1096

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N PDIDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  85   NPPDIDEDLHSRQLAVYGRETMRKLFASNV  114



>ref|XP_008366783.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Malus domestica]
Length=1079

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  224  SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R+S DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  66   NRSSNDIDEDLHSRQLAVYGRETMRRLFASNI  97



>gb|AFW64560.1| hypothetical protein ZEAMMB73_373105 [Zea mays]
 gb|AFW64561.1| hypothetical protein ZEAMMB73_373105 [Zea mays]
Length=860

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  46   APEIDEDLHSRQLAVYGRETMKRLFGSNV  74



>ref|XP_008662115.1| PREDICTED: uncharacterized protein LOC100381933 isoform X1 [Zea 
mays]
 gb|AFW55794.1| hypothetical protein ZEAMMB73_880977 [Zea mays]
Length=1051

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  41   APEIDEDLHSRQLAVYGRETMKRLFGSNV  69



>ref|XP_002442655.1| hypothetical protein SORBIDRAFT_08g000540 [Sorghum bicolor]
 gb|EES16493.1| hypothetical protein SORBIDRAFT_08g000540 [Sorghum bicolor]
Length=1052

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  42   APEIDEDLHSRQLAVYGRETMKRLFGSNV  70



>ref|XP_002450102.1| hypothetical protein SORBIDRAFT_05g000520 [Sorghum bicolor]
 gb|EES09090.1| hypothetical protein SORBIDRAFT_05g000520 [Sorghum bicolor]
Length=1052

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  42   APEIDEDLHSRQLAVYGRETMKRLFGSNV  70



>ref|XP_011095062.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Sesamum 
indicum]
 ref|XP_011095063.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Sesamum 
indicum]
Length=1031

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  206  KSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            K+PI  S+  P+IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  13   KAPIGDSQ-PPEIDEDLHSRQLAVYGRETMRRLFASNI  49



>ref|XP_011095060.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Sesamum 
indicum]
Length=1074

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  206  KSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            K+PI  S+  P+IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  56   KAPIGDSQ-PPEIDEDLHSRQLAVYGRETMRRLFASNI  92



>gb|KDP22845.1| hypothetical protein JCGZ_00432 [Jatropha curcas]
Length=1107

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  96   NSQDIDEDLHSRQLAVYGRETMRRLFASNI  125



>ref|XP_004978585.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Setaria italica]
Length=1053

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  43   APEIDEDLHSRQLAVYGRETMKRLFGSNV  71



>gb|EYU41943.1| hypothetical protein MIMGU_mgv1a000559mg [Erythranthe guttata]
Length=1076

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = +2

Query  200  NGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NGK+PI  ++   +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  57   NGKAPIGGAQ--LEIDEDLHSRQLAVYGRETMRRLFASNI  94



>ref|XP_004302531.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Fragaria vesca 
subsp. vesca]
Length=1078

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  67   NSGDIDEDLHSRQLAVYGRETMRRLFASNI  96



>ref|XP_011095059.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Sesamum 
indicum]
Length=1084

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +2

Query  206  KSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            K+PI  S+  P+IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  66   KAPIGDSQ-PPEIDEDLHSRQLAVYGRETMRRLFASNI  102



>ref|XP_004977630.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Setaria italica]
Length=1053

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  43   APEIDEDLHSRQLAVYGRETMKRLFGSNV  71



>ref|XP_010089532.1| Ubiquitin-activating enzyme E1 1 [Morus notabilis]
 gb|EXB37971.1| Ubiquitin-activating enzyme E1 1 [Morus notabilis]
Length=1124

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 33/52 (63%), Gaps = 6/52 (12%)
 Frame = +2

Query  182  NGR------RTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NGR      R E   S      NS DIDEDLHSRQLAVYGR+TMRRL  SNV
Sbjct  91   NGRIGGREEREERAVSLASRDANSEDIDEDLHSRQLAVYGRDTMRRLFASNV  142



>ref|XP_007208126.1| hypothetical protein PRUPE_ppa000563mg [Prunus persica]
 gb|EMJ09325.1| hypothetical protein PRUPE_ppa000563mg [Prunus persica]
Length=1095

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  84   NSNDIDEDLHSRQLAVYGRETMRRLFASNI  113



>ref|XP_004958792.1| PREDICTED: ubiquitin-activating enzyme E1 3-like isoform X2 [Setaria 
italica]
Length=1048

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 7/51 (14%)
 Frame = +2

Query  188  RRTENGKSP-----IDCSRNS--PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R++ G+SP      + SRN   P+IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  16   KRSKVGESPPAATASNGSRNGAPPEIDEDLHSRQLAVYGRETMRRLFASDV  66



>ref|XP_008243126.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Prunus mume]
Length=1083

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  72   NSNDIDEDLHSRQLAVYGRETMRRLFASNI  101



>gb|KHG10931.1| Ubiquitin-activating enzyme E1 1 -like protein [Gossypium arboreum]
Length=1088

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  197  ENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            E   +P D + N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  68   EPAMAPGDSNHN--DIDEDLHSRQLAVYGRETMRRLFASNV  106



>ref|XP_002313232.2| hypothetical protein POPTR_0009s07950g, partial [Populus trichocarpa]
 gb|EEE87187.2| hypothetical protein POPTR_0009s07950g, partial [Populus trichocarpa]
Length=1094

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  86   KRLKSDCYIggggeessvemggvevngnDAVSNGRRTENGKSPIDCSRNSPDIDEDLHSR  265
            K+ + DCY+      S+ +   V  N +D        E   S      N  +IDEDLHSR
Sbjct  35   KKHRVDCYLESTAANSNKKTSSVIGNCSDISRESGGAEEKVSMALGDSNPSEIDEDLHSR  94

Query  266  QLAVYGRETMRRLIGSNV  319
            QLAVYGRETMRRL  SNV
Sbjct  95   QLAVYGRETMRRLFASNV  112



>gb|KJB20444.1| hypothetical protein B456_003G148600 [Gossypium raimondii]
Length=1087

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  197  ENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            E   +P D + N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  67   EPAMAPGDSNHN--DIDEDLHSRQLAVYGRETMRRLFASNV  105



>ref|XP_004958791.1| PREDICTED: ubiquitin-activating enzyme E1 3-like isoform X1 [Setaria 
italica]
Length=1061

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 7/51 (14%)
 Frame = +2

Query  188  RRTENGKSP-----IDCSRNS--PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R++ G+SP      + SRN   P+IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  29   KRSKVGESPPAATASNGSRNGAPPEIDEDLHSRQLAVYGRETMRRLFASDV  79



>ref|XP_010491209.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Camelina sativa]
Length=1075

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +2

Query  185  GRRTENGKSPIDCSRNSP---DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            G  T   ++P+D + N+    +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  46   GLNTGGDETPMDTADNNSNNHEIDEDLHSRQLAVYGRETMRRLFASNV  93



>gb|KDP45776.1| hypothetical protein JCGZ_17383 [Jatropha curcas]
Length=1089

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D ++N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  74   APGDANQN--DIDEDLHSRQLAVYGRETMRRLFASNV  108



>ref|XP_009369576.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Pyrus x bretschneideri]
Length=1145

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  134  NQSDIDEDLHSRQLAVYGRETMRRLFASNV  163



>ref|XP_011003646.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Populus euphratica]
 ref|XP_011003657.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Populus euphratica]
Length=1090

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  86   KRLKSDCYIggggeessvemggvevngnDAVSNGRRTENGKSPIDCSRNSPDIDEDLHSR  265
            K+ + DCY+      S+ +   V  N +D        E   S      N  +IDEDLHSR
Sbjct  31   KKHRVDCYLESTAANSNKKTSSVIGNCSDISRESGGAEEKVSMALGDSNPSEIDEDLHSR  90

Query  266  QLAVYGRETMRRLIGSNV  319
            QLAVYGRETMRRL  SNV
Sbjct  91   QLAVYGRETMRRLFASNV  108



>ref|XP_008235385.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Prunus 
mume]
Length=1152

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  141  NPSDIDEDLHSRQLAVYGRETMRRLFASNV  170



>gb|KDO66997.1| hypothetical protein CISIN_1g001074mg [Citrus sinensis]
Length=972

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  152  NQTDIDEDLHSRQLAVYGRETMRRLFASNI  181



>ref|XP_011461461.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011461462.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011461463.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011461464.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Fragaria vesca subsp. 
vesca]
Length=1084

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  73   NAGDIDEDLHSRQLAVYGRETMRRLFASNV  102



>ref|XP_008811687.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Phoenix dactylifera]
Length=1073

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  62   NPTEIDEDLHSRQLAVYGRETMRRLFGSNV  91



>ref|XP_008345334.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Malus domestica]
Length=1148

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  137  NQSDIDEDLHSRQLAVYGRETMRRLFASNV  166



>ref|XP_002313230.2| ubiquitin activating enzyme 2 family protein [Populus trichocarpa]
 gb|EEE87185.2| ubiquitin activating enzyme 2 family protein [Populus trichocarpa]
Length=894

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  73   NPMEIDEDLHSRQLAVYGRETMRRLFGSNV  102



>ref|XP_006425139.1| hypothetical protein CICLE_v10027704mg [Citrus clementina]
 gb|ESR38379.1| hypothetical protein CICLE_v10027704mg [Citrus clementina]
Length=1163

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  152  NQTDIDEDLHSRQLAVYGRETMRRLFASNI  181



>ref|XP_011003623.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Populus 
euphratica]
Length=1097

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  86   NPMEIDEDLHSRQLAVYGRETMRRLFGSNV  115



>ref|XP_010452577.1| PREDICTED: ubiquitin-activating enzyme E1 2 [Camelina sativa]
 ref|XP_010452579.1| PREDICTED: ubiquitin-activating enzyme E1 2 [Camelina sativa]
Length=1078

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  215  IDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +D + N+ +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  62   VDNNSNNHEIDEDLHSRQLAVYGRETMRRLFASNV  96



>ref|XP_010043403.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Eucalyptus 
grandis]
Length=1140

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  129  NSTDIDEDLHSRQLAVYGRETMRRLFASSV  158



>ref|XP_007208384.1| hypothetical protein PRUPE_ppa000549mg [Prunus persica]
 gb|EMJ09583.1| hypothetical protein PRUPE_ppa000549mg [Prunus persica]
Length=1101

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  90   NPSDIDEDLHSRQLAVYGRETMRRLFASNV  119



>gb|KDO66996.1| hypothetical protein CISIN_1g001074mg [Citrus sinensis]
Length=1163

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  152  NQTDIDEDLHSRQLAVYGRETMRRLFASNI  181



>gb|KDO66999.1| hypothetical protein CISIN_1g001074mg [Citrus sinensis]
Length=1018

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  7    NQTDIDEDLHSRQLAVYGRETMRRLFASNI  36



>ref|XP_002526617.1| ubiquitin-activating enzyme E1, putative [Ricinus communis]
 gb|EEF35776.1| ubiquitin-activating enzyme E1, putative [Ricinus communis]
Length=1107

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D  +N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  91   APGDVHQN--DIDEDLHSRQLAVYGRETMRRLFASNV  125



>ref|XP_011003628.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011003635.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Populus 
euphratica]
Length=1084

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  73   NPMEIDEDLHSRQLAVYGRETMRRLFGSNV  102



>ref|XP_008235451.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Prunus 
mume]
 ref|XP_008235524.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Prunus 
mume]
 ref|XP_008235598.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Prunus 
mume]
Length=1088

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  77   NPSDIDEDLHSRQLAVYGRETMRRLFASNV  106



>ref|XP_010043404.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85404.1| hypothetical protein EUGRSUZ_B02226 [Eucalyptus grandis]
Length=1095

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            NS DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  84   NSTDIDEDLHSRQLAVYGRETMRRLFASSV  113



>ref|XP_002313231.2| hypothetical protein POPTR_0009s07960g [Populus trichocarpa]
 gb|EEE87186.2| hypothetical protein POPTR_0009s07960g [Populus trichocarpa]
Length=1084

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  73   NPMEIDEDLHSRQLAVYGRETMRRLFGSNV  102



>gb|KJB26263.1| hypothetical protein B456_004G233800 [Gossypium raimondii]
Length=1123

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D + N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  107  APRDANHN--DIDEDLHSRQLAVYGRETMRRLFASNI  141



>ref|XP_006425138.1| hypothetical protein CICLE_v10027704mg [Citrus clementina]
 gb|ESR38378.1| hypothetical protein CICLE_v10027704mg [Citrus clementina]
Length=1099

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  88   NQTDIDEDLHSRQLAVYGRETMRRLFASNI  117



>gb|KDO66998.1| hypothetical protein CISIN_1g001074mg [Citrus sinensis]
Length=1099

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  88   NQTDIDEDLHSRQLAVYGRETMRRLFASNI  117



>ref|XP_006429468.1| hypothetical protein CICLE_v10010950mg [Citrus clementina]
 gb|ESR42708.1| hypothetical protein CICLE_v10010950mg [Citrus clementina]
Length=1093

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  82   NPSDIDEDLHSRQLAVYGRETMRRLFASNI  111



>ref|XP_006488575.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Citrus sinensis]
Length=1097

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  86   NQTDIDEDLHSRQLAVYGRETMRRLFASNI  115



>gb|KDO63225.1| hypothetical protein CISIN_1g0013011mg, partial [Citrus sinensis]
 gb|KDO63226.1| hypothetical protein CISIN_1g0013011mg, partial [Citrus sinensis]
Length=895

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  82   NPSDIDEDLHSRQLAVYGRETMRRLFASNI  111



>gb|KDO63224.1| hypothetical protein CISIN_1g0013011mg, partial [Citrus sinensis]
Length=906

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  93   NPSDIDEDLHSRQLAVYGRETMRRLFASNI  122



>ref|XP_009590106.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1172

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  161  NPHDIDEDLHSRQLAVYGRETMRRLFASNV  190



>gb|KJB26261.1| hypothetical protein B456_004G233800 [Gossypium raimondii]
Length=1093

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D + N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  77   APRDANHN--DIDEDLHSRQLAVYGRETMRRLFASNI  111



>ref|XP_009802174.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Nicotiana 
sylvestris]
Length=1172

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  161  NPHDIDEDLHSRQLAVYGRETMRRLFASNV  190



>ref|XP_006481094.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481095.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006481096.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Citrus 
sinensis]
Length=1093

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  82   NPSDIDEDLHSRQLAVYGRETMRRLFASNI  111



>ref|XP_006286939.1| hypothetical protein CARUB_v10000084mg [Capsella rubella]
 gb|EOA19837.1| hypothetical protein CARUB_v10000084mg [Capsella rubella]
Length=1122

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  218  DCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D + N+ +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  105  DNNSNNHEIDEDLHSRQLAVYGRETMRRLFASNV  138



>ref|XP_002300000.2| ubiquitin activating enzyme 2 family protein [Populus trichocarpa]
 gb|EEE84805.2| ubiquitin activating enzyme 2 family protein [Populus trichocarpa]
Length=1087

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = +2

Query  86   KRLKSDCYIggggeessvemggvevngnDAVSNGR-RTENGKSPIDCSRNSPDIDEDLHS  262
            K+ + DC +      +         +  D  SN R + E   SP D      +IDEDLHS
Sbjct  30   KKNRIDCSLESNVSSNKNSCVIGNCSDTDRDSNNRCKEELIMSPGD--SKPMEIDEDLHS  87

Query  263  RQLAVYGRETMRRLIGSNV  319
            RQLAVYGRETMRRL GSNV
Sbjct  88   RQLAVYGRETMRRLFGSNV  106



>ref|XP_008789164.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Phoenix 
dactylifera]
Length=1080

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  173  AVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            A     R  +G +      N  DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  50   AAEGSHRPPHGMACDSNGSNGADIDEDLHSRQLAVYGRETMRRLFASSV  98



>gb|ABA95612.2| Ubiquitin-activating enzyme E1 2, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21847.1| Ubiquitin-activating enzyme E1 2, putative, expressed [Oryza 
sativa Japonica Group]
Length=968

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  39   APEIDEDLHSRQLAVYGRETMKRLFASNV  67



>ref|XP_009412523.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Musa acuminata 
subsp. malaccensis]
Length=1075

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  224  SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R   +IDEDLHSRQLAVYGRETMRRL+ SNV
Sbjct  61   NRKRSEIDEDLHSRQLAVYGRETMRRLVASNV  92



>ref|XP_006662651.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Oryza brachyantha]
Length=1045

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  35   TPEIDEDLHSRQLAVYGRETMKRLFASNV  63



>ref|XP_008789165.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Phoenix 
dactylifera]
Length=1065

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  173  AVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            A     R  +G +      N  DIDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  35   AAEGSHRPPHGMACDSNGSNGADIDEDLHSRQLAVYGRETMRRLFASSV  83



>ref|XP_011080780.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Sesamum indicum]
Length=1085

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  74   NPRDIDEDLHSRQLAVYGRETMRRLFASNV  103



>ref|XP_010089531.1| Ubiquitin-activating enzyme E1 2 [Morus notabilis]
 gb|EXB37970.1| Ubiquitin-activating enzyme E1 2 [Morus notabilis]
Length=1093

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ DIDEDLHSRQLAVYGR+TMRRL  SNV
Sbjct  81   NTADIDEDLHSRQLAVYGRDTMRRLFASNV  110



>emb|CDP09233.1| unnamed protein product [Coffea canephora]
Length=1101

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  90   NPHDIDEDLHSRQLAVYGRETMRRLFASNV  119



>gb|EEE52605.1| hypothetical protein OsJ_34931 [Oryza sativa Japonica Group]
Length=1064

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  39   APEIDEDLHSRQLAVYGRETMKRLFASNV  67



>ref|XP_004240416.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Solanum lycopersicum]
 ref|XP_010321768.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Solanum lycopersicum]
Length=1091

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  79   NPHDIDEDLHSRQLAVYGRETMRRLFASNV  108



>gb|EPS70237.1| hypothetical protein M569_04521 [Genlisea aurea]
Length=1196

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  185  NPRDIDEDLHSRQLAVYGRETMRRLFASNV  214



>ref|NP_001065539.1| Os11g0106400 [Oryza sativa Japonica Group]
 gb|ABA91080.1| Ubiquitin-activating enzyme E1 2, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91081.1| Ubiquitin-activating enzyme E1 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27384.1| Os11g0106400 [Oryza sativa Japonica Group]
Length=1048

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  38   APEIDEDLHSRQLAVYGRETMKRLFASNV  66



>ref|XP_006664269.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Oryza brachyantha]
Length=858

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  35   TPEIDEDLHSRQLAVYGRETMKRLFASNV  63



>ref|XP_009337737.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Pyrus x bretschneideri]
Length=1079

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +S DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  68   SSNDIDEDLHSRQLAVYGRETMRRLFASNI  97



>ref|XP_006344068.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Solanum tuberosum]
Length=1091

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  79   NPHDIDEDLHSRQLAVYGRETMRRLFASNV  108



>ref|XP_008370185.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Malus domestica]
Length=1079

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +S DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  68   SSNDIDEDLHSRQLAVYGRETMRRLFASNI  97



>ref|XP_009376402.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Pyrus x bretschneideri]
Length=1079

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +S DIDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  68   SSNDIDEDLHSRQLAVYGRETMRRLFASNI  97



>ref|XP_009802175.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009802176.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Nicotiana 
sylvestris]
Length=1092

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  81   NPHDIDEDLHSRQLAVYGRETMRRLFASNV  110



>ref|XP_009590107.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009590108.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1092

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  81   NPHDIDEDLHSRQLAVYGRETMRRLFASNV  110



>ref|XP_010033002.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Eucalyptus 
grandis]
Length=1018

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  10   DIDEDLHSRQLAVYGRETMRRLFASNV  36



>ref|XP_010032999.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Eucalyptus 
grandis]
Length=1181

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  173  DIDEDLHSRQLAVYGRETMRRLFASNV  199



>ref|XP_011024908.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Populus euphratica]
Length=1168

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL GSNV
Sbjct  160  EIDEDLHSRQLAVYGRETMRRLFGSNV  186



>gb|EEC67514.1| hypothetical protein OsI_34806 [Oryza sativa Indica Group]
Length=1099

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P+IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  100  APEIDEDLHSRQLAVYGRETMKRLFASNV  128



>ref|XP_010033000.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Eucalyptus 
grandis]
 ref|XP_010033001.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Eucalyptus 
grandis]
Length=1093

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  85   DIDEDLHSRQLAVYGRETMRRLFASNV  111



>ref|XP_002862736.1| hypothetical protein ARALYDRAFT_359413 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38994.1| hypothetical protein ARALYDRAFT_359413 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  87   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  116



>gb|KHG05202.1| Ubiquitin-activating enzyme E1 1 -like protein [Gossypium arboreum]
Length=1018

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  7    NYTEIDEDLHSRQLAVYGRETMRRLFASNI  36



>gb|KJB83907.1| hypothetical protein B456_013G270300 [Gossypium raimondii]
Length=1018

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  7    NYTEIDEDLHSRQLAVYGRETMRRLFASNI  36



>gb|KCW52518.1| hypothetical protein EUGRSUZ_J01907 [Eucalyptus grandis]
Length=1547

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  681  DIDEDLHSRQLAVYGRETMRRLFASNV  707



>gb|KCW52517.1| hypothetical protein EUGRSUZ_J01907 [Eucalyptus grandis]
Length=1689

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  681  DIDEDLHSRQLAVYGRETMRRLFASNV  707



>gb|KHG29820.1| Ubiquitin-activating enzyme E1 2 -like protein [Gossypium arboreum]
Length=1161

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  150  NHAEIDEDLHSRQLAVYGRETMRRLFASNI  179



>gb|KJB20437.1| hypothetical protein B456_003G148200 [Gossypium raimondii]
 gb|KJB20438.1| hypothetical protein B456_003G148200 [Gossypium raimondii]
Length=1160

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  149  NHAEIDEDLHSRQLAVYGRETMRRLFASNI  178



>ref|XP_006293588.1| hypothetical protein CARUB_v10022535mg, partial [Capsella rubella]
 gb|EOA26486.1| hypothetical protein CARUB_v10022535mg, partial [Capsella rubella]
Length=1124

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  113  NRQEIDEDLHSRQLAVYGRETMRRLFASNV  142



>ref|XP_002982764.1| hypothetical protein SELMODRAFT_179776 [Selaginella moellendorffii]
 gb|EFJ16009.1| hypothetical protein SELMODRAFT_179776 [Selaginella moellendorffii]
Length=1021

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL G+NV
Sbjct  15   EIDEDLHSRQLAVYGRETMRRLFGANV  41



>gb|EMS68322.1| Ubiquitin-activating enzyme E1 2 [Triticum urartu]
Length=1016

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  7    EIDEDLHSRQLAVYGRETMKRLFGSNV  33



>ref|XP_006410077.1| hypothetical protein EUTSA_v10016166mg [Eutrema salsugineum]
 ref|XP_006410078.1| hypothetical protein EUTSA_v10016166mg [Eutrema salsugineum]
 gb|ESQ51530.1| hypothetical protein EUTSA_v10016166mg [Eutrema salsugineum]
 gb|ESQ51531.1| hypothetical protein EUTSA_v10016166mg [Eutrema salsugineum]
Length=1086

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 6/50 (12%)
 Frame = +2

Query  170  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            D+V   R    G S      N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  61   DSVDQHRDMAFGNS------NRQEIDEDLHSRQLAVYGRETMRRLFASNV  104



>ref|XP_008653532.1| PREDICTED: ubiquitin-activating enzyme E1 3 isoform X2 [Zea mays]
 tpg|DAA64244.1| TPA: hypothetical protein ZEAMMB73_124698 [Zea mays]
Length=1050

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +2

Query  188  RRTENGKSPI-------DCSRN--SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R + G+SP        + +RN  +P+IDEDLHSRQLAVYGRETMRRL  ++V
Sbjct  16   KRAKLGESPSAARVGTSNGTRNGAAPEIDEDLHSRQLAVYGRETMRRLFAADV  68



>ref|XP_008653531.1| PREDICTED: ubiquitin-activating enzyme E1 3 isoform X1 [Zea mays]
Length=1063

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = +2

Query  188  RRTENGKSPI-------DCSRN--SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R + G+SP        + +RN  +P+IDEDLHSRQLAVYGRETMRRL  ++V
Sbjct  29   KRAKLGESPSAARVGTSNGTRNGAAPEIDEDLHSRQLAVYGRETMRRLFAADV  81



>ref|XP_009122253.1| PREDICTED: ubiquitin-activating enzyme E1 2 [Brassica rapa]
Length=1071

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = +2

Query  173  AVSNGRRTENGKSPIDCSRNSP---DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            ++SN          +D   NS    +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  38   SISNIELNSTAPMSVDAVGNSSTNHEIDEDLHSRQLAVYGRETMRRLFASNV  89



>gb|EMT16594.1| Ubiquitin-activating enzyme E1 1 [Aegilops tauschii]
Length=1016

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  7    EIDEDLHSRQLAVYGRETMKRLFGSNV  33



>ref|XP_003579050.1| PREDICTED: ubiquitin-activating enzyme E1 2 [Brachypodium distachyon]
Length=1054

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  45   EIDEDLHSRQLAVYGRETMKRLFGSNV  71



>emb|CDY29699.1| BnaA04g17280D [Brassica napus]
Length=1047

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  36   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  65



>emb|CDX84858.1| BnaA03g13720D [Brassica napus]
Length=1018

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  7    NRHEIDEDLHSRQLAVYGRETMRRLFASNV  36



>ref|XP_009141040.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Brassica rapa]
Length=1047

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  36   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  65



>ref|XP_006399119.1| hypothetical protein EUTSA_v10012525mg [Eutrema salsugineum]
 gb|ESQ40572.1| hypothetical protein EUTSA_v10012525mg [Eutrema salsugineum]
Length=1072

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  61   NNHEIDEDLHSRQLAVYGRETMRRLFASNV  90



>ref|XP_009133152.1| PREDICTED: ubiquitin-activating enzyme E1 1-like, partial [Brassica 
rapa]
Length=1103

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  92   NRHEIDEDLHSRQLAVYGRETMRRLFASNV  121



>emb|CDY24028.1| BnaC03g16630D [Brassica napus]
Length=1018

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  7    NRHEIDEDLHSRQLAVYGRETMRRLFASNV  36



>sp|P20973.1|UBE11_WHEAT RecName: Full=Ubiquitin-activating enzyme E1 1 [Triticum aestivum]
 pir||A38373 ubiquitin-protein ligase (EC 6.3.2.19) E1 - wheat
 gb|AAA34308.1| ubiquitin-activating enzyme E1 [Triticum aestivum]
Length=1051

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL GSNV
Sbjct  42   EIDEDLHSRQLAVYGRETMKRLFGSNV  68



>ref|XP_002990914.1| hypothetical protein SELMODRAFT_161306 [Selaginella moellendorffii]
 gb|EFJ07958.1| hypothetical protein SELMODRAFT_161306 [Selaginella moellendorffii]
Length=1059

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL G+NV
Sbjct  53   EIDEDLHSRQLAVYGRETMRRLFGANV  79



>ref|XP_003576371.2| PREDICTED: ubiquitin-activating enzyme E1 2-like [Brachypodium 
distachyon]
Length=1048

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  224  SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +R + +IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  34   ARPAAEIDEDLHSRQLAVYGRETMKRLFASNV  65



>ref|XP_010557978.1| PREDICTED: ubiquitin-activating enzyme E1 2 [Tarenaya hassleriana]
Length=1081

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  70   NHQEIDEDLHSRQLAVYGRETMRRLFASNV  99



>emb|CDX97850.1| BnaC04g40890D [Brassica napus]
Length=1053

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  42   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  71



>emb|CDY10711.1| BnaA05g12250D [Brassica napus]
Length=1065

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  54   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  83



>ref|XP_009144330.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Brassica rapa]
 ref|XP_009144331.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Brassica rapa]
Length=1078

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  67   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  96



>ref|XP_002881085.1| hypothetical protein ARALYDRAFT_481921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57344.1| hypothetical protein ARALYDRAFT_481921 [Arabidopsis lyrata subsp. 
lyrata]
Length=1083

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  72   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  101



>gb|AAL90910.1| At2g30110/T27E13.15 [Arabidopsis thaliana]
 gb|AAP21171.1| At2g30110/T27E13.15 [Arabidopsis thaliana]
Length=1080

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  69   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  98



>ref|NP_565693.1| ubiquitin-activating enzyme E1 1 [Arabidopsis thaliana]
 sp|P93028.1|UBE11_ARATH RecName: Full=Ubiquitin-activating enzyme E1 1; Short=AtUBA1; 
AltName: Full=Protein MODIFIER OF SNC1 5 [Arabidopsis thaliana]
 gb|AAB39246.1| ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|AAC16961.1| ubiquitin activating enzyme 1 (UBA1) [Arabidopsis thaliana]
 gb|AEC08346.1| ubiquitin-activating enzyme E1 1 [Arabidopsis thaliana]
Length=1080

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  69   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  98



>ref|XP_010469894.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Camelina sativa]
Length=1082

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  71   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  100



>ref|XP_010414311.1| PREDICTED: ubiquitin-activating enzyme E1 1-like, partial [Camelina 
sativa]
Length=686

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  70   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  99



>emb|CDY02037.1| BnaC04g14640D [Brassica napus]
Length=1077

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  66   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  95



>ref|XP_007016954.1| Ubiquitin activating enzyme 2, 2 isoform 1 [Theobroma cacao]
 ref|XP_007016955.1| Ubiquitin activating enzyme 2, 2 isoform 1 [Theobroma cacao]
 gb|EOY34573.1| Ubiquitin activating enzyme 2, 2 isoform 1 [Theobroma cacao]
 gb|EOY34574.1| Ubiquitin activating enzyme 2, 2 isoform 1 [Theobroma cacao]
Length=1104

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  179  SNGRRTENGKSPIDC-SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +N R  E+  S +     N  +IDEDLHSRQLAVYGRETMRRL  SN+
Sbjct  75   TNSRVVESSPSIMALGDANHTEIDEDLHSRQLAVYGRETMRRLFASNI  122



>ref|XP_002526660.1| ubiquitin-activating enzyme E1, putative [Ricinus communis]
 gb|EEF35682.1| ubiquitin-activating enzyme E1, putative [Ricinus communis]
Length=1100

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  233  SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            S DIDEDLHSRQLAVYGRETMR+L  SN+
Sbjct  90   SQDIDEDLHSRQLAVYGRETMRKLFASNI  118



>ref|XP_010510409.1| PREDICTED: ubiquitin-activating enzyme E1 1 [Camelina sativa]
Length=1075

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  64   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  93



>ref|XP_010521968.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010521969.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010521970.1| PREDICTED: ubiquitin-activating enzyme E1 1 isoform X1 [Tarenaya 
hassleriana]
Length=1082

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  70   NRQEIDEDLHSRQLAVYGRETMRRLFASNV  99



>ref|NP_001060725.1| Os07g0692900 [Oryza sativa Japonica Group]
 dbj|BAC75563.1| putative ubiquitin-activating enzyme [Oryza sativa Japonica Group]
 dbj|BAF22639.1| Os07g0692900 [Oryza sativa Japonica Group]
Length=1045

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            P+IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  36   PEIDEDLHSRQLAVYGRETMRRLFASHV  63



>gb|EEC82734.1| hypothetical protein OsI_27435 [Oryza sativa Indica Group]
Length=1058

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            P+IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  49   PEIDEDLHSRQLAVYGRETMRRLFASHV  76



>gb|EEE67868.1| hypothetical protein OsJ_25682 [Oryza sativa Japonica Group]
Length=1243

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            P+IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  49   PEIDEDLHSRQLAVYGRETMRRLFASHV  76



>ref|XP_002461268.1| hypothetical protein SORBIDRAFT_02g043880 [Sorghum bicolor]
 gb|EER97789.1| hypothetical protein SORBIDRAFT_02g043880 [Sorghum bicolor]
Length=1066

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 2/34 (6%)
 Frame = +2

Query  224  SRN--SPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +RN  +P+IDEDLHSRQLAVYGRETMRRL  ++V
Sbjct  51   TRNGAAPEIDEDLHSRQLAVYGRETMRRLFAADV  84



>emb|CDX98925.1| BnaC09g49100D [Brassica napus]
Length=1025

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  224  SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            S  + +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  64   SSTNHEIDEDLHSRQLAVYGRETMRRLFASNV  95



>emb|CDY67833.1| BnaA10g30270D [Brassica napus]
Length=1019

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  224  SRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            S  + +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  58   SSTNHEIDEDLHSRQLAVYGRETMRRLFASNV  89



>ref|NP_568168.1| ubiquitin-activating enzyme E1 2 [Arabidopsis thaliana]
 sp|P92974.1|UBE12_ARATH RecName: Full=Ubiquitin-activating enzyme E1 2; Short=AtUBA2 
[Arabidopsis thaliana]
 gb|AAB37569.1| ubiquitin activating enzyme 2 [Arabidopsis thaliana]
 dbj|BAB08968.1| ubiquitin activating enzyme 2 [Arabidopsis thaliana]
 gb|AED91020.1| ubiquitin-activating enzyme E1 2 [Arabidopsis thaliana]
Length=1077

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ +IDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  66   NNQEIDEDLHSRQLAVYGRETMRKLFASNV  95



>ref|XP_002871219.1| ATUBA2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47478.1| ATUBA2 [Arabidopsis lyrata subsp. lyrata]
Length=1079

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ +IDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  68   NNQEIDEDLHSRQLAVYGRETMRKLFASNV  97



>ref|XP_007016956.1| Ubiquitin-activating enzyme 1 isoform 1 [Theobroma cacao]
 gb|EOY34575.1| Ubiquitin-activating enzyme 1 isoform 1 [Theobroma cacao]
Length=1092

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D + N  DIDEDLHSRQLAVYGRETMR L  SN+
Sbjct  76   APGDANHN--DIDEDLHSRQLAVYGRETMRLLFASNI  110



>ref|XP_007016957.1| Ubiquitin-activating enzyme E1 1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY34576.1| Ubiquitin-activating enzyme E1 1 isoform 2, partial [Theobroma 
cacao]
Length=1040

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +2

Query  209  SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +P D + N  DIDEDLHSRQLAVYGRETMR L  SN+
Sbjct  76   APGDANHN--DIDEDLHSRQLAVYGRETMRLLFASNI  110



>ref|NP_001049821.1| Os03g0294900 [Oryza sativa Japonica Group]
 gb|ABF95428.1| Ubiquitin-activating enzyme E1 3, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11735.1| Os03g0294900 [Oryza sativa Japonica Group]
 dbj|BAH00064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1064

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  56   EIDEDLHSRQLAVYGRETMRRLFASNV  82



>ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago truncatula]
 gb|AES98759.1| ubiquitin-activating enzyme E1 1 [Medicago truncatula]
Length=1179

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  168  NAQEIDEDLHSRQLAVYGRETMRRLFASSV  197



>ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula]
 gb|AES98760.1| ubiquitin-activating enzyme E1 1 [Medicago truncatula]
Length=1180

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N+ +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  169  NAQEIDEDLHSRQLAVYGRETMRRLFASSV  198



>ref|XP_009381381.1| PREDICTED: ubiquitin-activating enzyme E1 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1124

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  115  EIDEDLHSRQLAVYGRETMRRLFASNV  141



>ref|XP_003615800.1| Ubiquitin-activating enzyme E1 [Medicago truncatula]
Length=1735

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  702  NPQEIDEDLHSRQLAVYGRETMRRLFASSV  731



>ref|XP_006658172.1| PREDICTED: ubiquitin-activating enzyme E1 3-like [Oryza brachyantha]
Length=1046

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  236  PDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            P+IDEDLHSRQLAVYGR+TMRRL  S+V
Sbjct  36   PEIDEDLHSRQLAVYGRDTMRRLFASHV  63



>ref|XP_009381382.1| PREDICTED: ubiquitin-activating enzyme E1 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1069

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  60   EIDEDLHSRQLAVYGRETMRRLFASNV  86



>gb|EEE58872.1| hypothetical protein OsJ_10472 [Oryza sativa Japonica Group]
Length=1179

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  SNV
Sbjct  171  EIDEDLHSRQLAVYGRETMRRLFASNV  197



>ref|XP_004490630.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Cicer 
arietinum]
Length=1111

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  100  NPQEIDEDLHSRQLAVYGRETMRRLFASSV  129



>gb|EMT09352.1| Ubiquitin-activating enzyme E1 2 [Aegilops tauschii]
Length=1015

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  6    EIDEDLHSRQLAVYGRETMKRLFASNV  32



>ref|XP_004490631.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Cicer 
arietinum]
 ref|XP_004490632.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Cicer 
arietinum]
Length=1086

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  75   NPQEIDEDLHSRQLAVYGRETMRRLFASSV  104



>gb|EMS68144.1| Ubiquitin-activating enzyme E1 2 [Triticum urartu]
Length=1015

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+RL  SNV
Sbjct  6    EIDEDLHSRQLAVYGRETMKRLFASNV  32



>ref|XP_001765171.1| predicted protein [Physcomitrella patens]
 gb|EDQ69899.1| predicted protein [Physcomitrella patens]
Length=1018

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL G+ V
Sbjct  10   EIDEDLHSRQLAVYGRETMRRLFGAQV  36



>ref|XP_010542669.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Tarenaya hassleriana]
 ref|XP_010542670.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Tarenaya hassleriana]
Length=1080

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMRR+  SNV
Sbjct  69   NRQEIDEDLHSRQLAVYGRETMRRIFVSNV  98



>ref|XP_001752631.1| predicted protein [Physcomitrella patens]
 gb|EDQ82502.1| predicted protein [Physcomitrella patens]
Length=1058

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL G++V
Sbjct  50   EIDEDLHSRQLAVYGRETMRRLFGAHV  76



>ref|XP_002465413.1| hypothetical protein SORBIDRAFT_01g038300 [Sorghum bicolor]
 gb|EER92411.1| hypothetical protein SORBIDRAFT_01g038300 [Sorghum bicolor]
Length=994

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  20   EIDEDLHSRQLAVYGRETMRQLFASNV  46



>ref|XP_003562406.2| PREDICTED: ubiquitin-activating enzyme E1 3 isoform X1 [Brachypodium 
distachyon]
Length=1064

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +2

Query  182  NGRRTENGKSPIDCSRNSP---DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            + +R   G+S     R  P   +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  34   DAKRPRLGESGTTDDRALPPPQEIDEDLHSRQLAVYGRETMRRLFASHV  82



>ref|XP_010233609.1| PREDICTED: ubiquitin-activating enzyme E1 3 isoform X2 [Brachypodium 
distachyon]
Length=1050

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +2

Query  182  NGRRTENGKSPIDCSRNSP---DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            + +R   G+S     R  P   +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  20   DAKRPRLGESGTTDDRALPPPQEIDEDLHSRQLAVYGRETMRRLFASHV  68



>ref|XP_008654582.1| PREDICTED: ubiquitin-activating enzyme E1 3-like [Zea mays]
 tpg|DAA44877.1| TPA: hypothetical protein ZEAMMB73_028401 [Zea mays]
Length=1030

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMR+L  SNV
Sbjct  20   EIDEDLHSRQLAVYGRETMRQLFASNV  46



>dbj|BAK05907.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  44   EIDEDLHSRQLAVYGRETMRRLFASDV  70



>sp|P31252.1|UBE13_WHEAT RecName: Full=Ubiquitin-activating enzyme E1 3 [Triticum aestivum]
 gb|AAA34266.1| ubiquitin activating enzyme [Triticum aestivum]
Length=1053

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  45   EIDEDLHSRQLAVYGRETMRRLFASDV  71



>ref|XP_007142173.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
 ref|XP_007142174.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
 ref|XP_007142175.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
 gb|ESW14167.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
 gb|ESW14168.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
 gb|ESW14169.1| hypothetical protein PHAVU_008G258500g [Phaseolus vulgaris]
Length=1088

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N  +IDEDLHSRQLAVYGRETMR+L  S+V
Sbjct  78   NPAEIDEDLHSRQLAVYGRETMRKLFASSV  107



>sp|P31251.1|UBE12_WHEAT RecName: Full=Ubiquitin-activating enzyme E1 2 [Triticum aestivum]
 gb|AAA34265.1| ubiquitin activating enyme [Triticum aestivum]
Length=1051

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETM+ L GSNV
Sbjct  42   EIDEDLHSRQLAVYGRETMKPLFGSNV  68



>ref|XP_003544897.2| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Glycine 
max]
 ref|XP_006596434.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X2 [Glycine 
max]
 ref|XP_006596435.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X3 [Glycine 
max]
Length=1094

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  S+V
Sbjct  87   EIDEDLHSRQLAVYGRETMRRLFASSV  113



>ref|XP_003055551.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60803.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1016

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRE+MRRL G++V
Sbjct  6    EIDEDLHSRQLAVYGRESMRRLAGASV  32



>gb|KHN46129.1| Ubiquitin-activating enzyme E1 2 [Glycine soja]
Length=1017

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  S++
Sbjct  10   EIDEDLHSRQLAVYGRETMRRLFASSI  36



>gb|EMS51846.1| Ubiquitin-activating enzyme E1 3 [Triticum urartu]
Length=943

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMR L  SNV
Sbjct  18   EIDEDLHSRQLAVYGRETMRLLFASNV  44



>ref|XP_003518319.2| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max]
Length=1092

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRETMRRL  S++
Sbjct  85   EIDEDLHSRQLAVYGRETMRRLFASSI  111



>ref|XP_005647121.1| ubiquitin-activating enzyme E1 [Coccomyxa subellipsoidea C-169]
 gb|EIE22577.1| ubiquitin-activating enzyme E1 [Coccomyxa subellipsoidea C-169]
Length=1045

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  242  IDEDLHSRQLAVYGRETMRRLIGSNV  319
            IDEDLHSRQLAVYGRE+MRR+  SNV
Sbjct  38   IDEDLHSRQLAVYGRESMRRMAASNV  63



>ref|XP_002503580.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64838.1| predicted protein [Micromonas sp. RCC299]
Length=1014

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRE+MR+L G+ V
Sbjct  6    EIDEDLHSRQLAVYGRESMRKLAGATV  32



>gb|KJB83908.1| hypothetical protein B456_013G270400, partial [Gossypium raimondii]
Length=969

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            DIDEDL+SRQLAV GRETMRRL  SN+
Sbjct  83   DIDEDLYSRQLAVCGRETMRRLFASNI  109



>ref|XP_007508781.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19867.1| predicted protein [Bathycoccus prasinos]
Length=1075

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  230  NSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            N   IDEDLHSRQLAVYGRE+ R+L+G+ V
Sbjct  44   NENKIDEDLHSRQLAVYGRESFRKLVGAKV  73



>ref|XP_011398027.1| Ubiquitin-activating enzyme E1 2 [Auxenochlorella protothecoides]
 gb|KFM25136.1| Ubiquitin-activating enzyme E1 2 [Auxenochlorella protothecoides]
Length=1021

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYG+E+MRR+  +NV
Sbjct  15   EIDEDLHSRQLAVYGKESMRRMATANV  41



>emb|CEF98884.1| Ubiquitin/SUMO-activating enzyme E1 [Ostreococcus tauri]
Length=1042

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  191  RTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLIGSNV  319
            R E  +     +    +IDEDLHSRQLAVYGRET R+L G+ V
Sbjct  18   RVERERETAAMTTGPMEIDEDLHSRQLAVYGRETFRKLAGARV  60



>ref|XP_003080559.1| ubiquitin activating enzyme (ISS) [Ostreococcus tauri]
Length=879

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  239  DIDEDLHSRQLAVYGRETMRRLIGSNV  319
            +IDEDLHSRQLAVYGRET R+L G+ V
Sbjct  7    EIDEDLHSRQLAVYGRETFRKLAGARV  33



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552963472315