BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS122H03

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    177   3e-47   Solanum lycopersicum
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    174   2e-46   Nicotiana sylvestris
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    169   2e-44   Nicotiana tomentosiformis
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    159   5e-41   Solanum tuberosum [potatoes]
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    159   6e-41   Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                              159   6e-41   Solanum tuberosum [potatoes]
emb|CBI39424.3|  unnamed protein product                                151   2e-38   Vitis vinifera
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    151   3e-38   Vitis vinifera
emb|CDP10310.1|  unnamed protein product                                150   4e-38   Coffea canephora [robusta coffee]
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    150   7e-38   Ricinus communis
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             149   2e-37   
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    149   2e-37   Populus euphratica
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             147   9e-37   
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    144   6e-36   Populus euphratica
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                142   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...    140   2e-34   
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   2e-34   
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    140   3e-34   Eucalyptus grandis [rose gum]
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    140   3e-34   Sesamum indicum [beniseed]
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   5e-34   Nelumbo nucifera [Indian lotus]
gb|KJB37917.1|  hypothetical protein B456_006G226300                    138   7e-34   Gossypium raimondii
gb|KJB37918.1|  hypothetical protein B456_006G226300                    137   9e-34   Gossypium raimondii
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    138   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    138   1e-33   Tarenaya hassleriana [spider flower]
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    137   1e-33   Gossypium arboreum [tree cotton]
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...    136   2e-33   Camelina sativa [gold-of-pleasure]
gb|KJB71921.1|  hypothetical protein B456_011G147600                    137   2e-33   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                    137   2e-33   Gossypium raimondii
gb|KJB71923.1|  hypothetical protein B456_011G147600                    137   2e-33   Gossypium raimondii
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    136   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    136   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      136   5e-33   
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                   131   1e-32   Citrus sinensis [apfelsine]
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    134   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    134   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    134   4e-32   Citrus sinensis [apfelsine]
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    133   4e-32   Tarenaya hassleriana [spider flower]
gb|AAC26245.1|  contains similarity glycosyl hydrolases                 130   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             132   1e-31   
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970          132   1e-31   Amborella trichopoda
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg             131   2e-31   
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg             127   2e-31   
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg             128   2e-31   
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    131   3e-31   Fragaria vesca subsp. vesca
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg             127   3e-31   
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    130   5e-31   Gossypium arboreum [tree cotton]
ref|NP_001119280.1|  phosphoglucan, water dikinase                      130   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         130   8e-31   Jatropha curcas
ref|NP_198009.3|  phosphoglucan, water dikinase                         129   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107197.1|  Phosphoglucan, water dikinase                      129   1e-30   
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    129   2e-30   Prunus mume [ume]
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             128   3e-30   Prunus persica
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    126   1e-29   
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    126   1e-29   Cicer arietinum [garbanzo]
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    126   2e-29   Camelina sativa [gold-of-pleasure]
emb|CDY19771.1|  BnaA09g04240D                                          126   2e-29   Brassica napus [oilseed rape]
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    125   2e-29   Brassica rapa
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    125   2e-29   Arabis alpina [alpine rockcress]
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...    125   2e-29   
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             125   3e-29   Capsella rubella
emb|CDY65142.1|  BnaC02g48400D                                          123   2e-28   Brassica napus [oilseed rape]
emb|CDX87051.1|  BnaC09g03660D                                          123   2e-28   
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    123   2e-28   
gb|ABK26307.1|  unknown                                                 117   2e-28   Picea sitchensis
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       122   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    122   4e-28   Cucumis melo [Oriental melon]
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g             121   7e-28   Phaseolus vulgaris [French bean]
ref|XP_008799788.1|  PREDICTED: phosphoglucan, water dikinase, ch...    120   8e-28   
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    120   2e-27   Brassica rapa
emb|CDY05529.1|  BnaA02g31620D                                          120   2e-27   
gb|AFO83531.1|  glucan water dikinase 3                                 120   2e-27   Manihot esculenta [manioc]
gb|ABR17706.1|  unknown                                                 114   6e-27   Picea sitchensis
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    117   2e-26   Cucumis melo [Oriental melon]
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...    116   4e-26   
gb|KGN53052.1|  hypothetical protein Csa_4G012480                       116   4e-26   Cucumis sativus [cucumbers]
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            115   9e-26   Glycine soja [wild soybean]
gb|KEH27294.1|  phosphoglucan, water dikinase                           114   3e-25   Medicago truncatula
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    114   3e-25   Setaria italica
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    113   5e-25   
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            113   5e-25   Triticum urartu
ref|NP_001066613.1|  Os12g0297500                                       112   7e-25   
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...    112   8e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          111   2e-24   Sorghum bicolor [broomcorn]
gb|EEE53074.1|  hypothetical protein OsJ_35828                          109   7e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            109   1e-23   
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    108   1e-23   Oryza brachyantha
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    107   4e-23   Brachypodium distachyon [annual false brome]
gb|EPS59827.1|  glucan/water dikinase                                   103   9e-23   Genlisea aurea
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              104   4e-22   
gb|EEC69133.1|  hypothetical protein OsI_38056                          104   5e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             104   6e-22   
ref|XP_008662597.1|  PREDICTED: phosphoglucan, water dikinase, ch...  96.7    1e-20   
ref|XP_001752167.1|  predicted protein                                  100   2e-20   
ref|XP_001758857.1|  predicted protein                                91.7    1e-17   
ref|XP_010040448.1|  PREDICTED: phosphoglucan, water dikinase, ch...  76.6    3e-14   
ref|XP_009778046.1|  PREDICTED: uncharacterized protein LOC104227496  64.7    5e-09   Nicotiana sylvestris
ref|WP_033217558.1|  cyclomaltodextrin glucanotransferase             57.0    1e-07   
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770            60.8    1e-07   Chlorella variabilis
gb|KIY94688.1|  hypothetical protein MNEG_13275                       58.5    2e-07   Monoraphidium neglectum
ref|XP_002956065.1|  hypothetical protein VOLCADRAFT_97031            59.7    2e-07   Volvox carteri f. nagariensis
ref|XP_009587696.1|  PREDICTED: uncharacterized protein LOC104085387  59.3    3e-07   Nicotiana tomentosiformis
gb|KIZ07735.1|  hypothetical protein MNEG_0234                        58.9    6e-07   Monoraphidium neglectum
ref|XP_004302646.1|  PREDICTED: uncharacterized protein LOC101312742  58.5    6e-07   Fragaria vesca subsp. vesca
ref|XP_001696825.1|  hypothetical protein CHLREDRAFT_150073           57.8    7e-07   Chlamydomonas reinhardtii
ref|XP_005642714.1|  starch-binding domain-like protein               57.4    8e-07   Coccomyxa subellipsoidea C-169
gb|ABK25218.1|  unknown                                               57.4    1e-06   Picea sitchensis
ref|XP_001697099.1|  phosphoglucan water dikinase                     57.4    2e-06   Chlamydomonas reinhardtii
emb|CBI30404.3|  unnamed protein product                              56.2    3e-06   Vitis vinifera
ref|XP_010654173.1|  PREDICTED: uncharacterized protein LOC104880162  56.2    3e-06   Vitis vinifera
ref|WP_030916433.1|  hypothetical protein                             55.1    4e-06   Streptomyces sp. NRRL S-384
gb|KIZ07546.1|  hypothetical protein MNEG_0408                        56.2    4e-06   Monoraphidium neglectum
ref|XP_002974170.1|  hypothetical protein SELMODRAFT_414445           55.8    4e-06   Selaginella moellendorffii
ref|WP_030918859.1|  cyclomaltodextrin glucanotransferase             52.8    4e-06   
ref|XP_005844056.1|  hypothetical protein CHLNCDRAFT_139625           55.1    4e-06   Chlorella variabilis
ref|XP_002968806.1|  hypothetical protein SELMODRAFT_440606           55.8    4e-06   Selaginella moellendorffii
gb|KIZ03831.1|  hypothetical protein MNEG_4121                        55.5    4e-06   Monoraphidium neglectum
emb|CAN60108.1|  hypothetical protein VITISV_044328                   55.8    5e-06   Vitis vinifera
gb|KJB46631.1|  hypothetical protein B456_007G379100                  55.1    5e-06   Gossypium raimondii
ref|XP_004506775.1|  PREDICTED: protein ycf2-like isoform X1          55.5    5e-06   Cicer arietinum [garbanzo]
ref|XP_001258586.1|  starch binding domain protein                    55.5    5e-06   Aspergillus fischeri NRRL 181
ref|WP_033216324.1|  hypothetical protein                             54.7    6e-06   Kitasatospora phosalacinea
ref|XP_005844815.1|  hypothetical protein CHLNCDRAFT_54374            55.5    7e-06   Chlorella variabilis
ref|XP_001702927.1|  predicted protein                                52.8    8e-06   Chlamydomonas reinhardtii
gb|KJB46630.1|  hypothetical protein B456_007G379100                  54.7    8e-06   Gossypium raimondii
ref|XP_007026748.1|  Carbohydrate-binding-like fold, putative iso...  54.7    1e-05   
ref|XP_007026749.1|  Carbohydrate-binding-like fold, putative iso...  54.3    1e-05   
ref|XP_006398635.1|  hypothetical protein EUTSA_v10013736mg           53.9    1e-05   
gb|KJB46629.1|  hypothetical protein B456_007G379100                  53.9    1e-05   Gossypium raimondii
gb|KHN47425.1|  Phosphoglucan, water dikinase, chloroplastic          53.1    2e-05   Glycine soja [wild soybean]
ref|XP_004506776.1|  PREDICTED: protein ycf2-like isoform X2          53.9    2e-05   
dbj|GAM27795.1|  hypothetical protein SAMD00019534_109710             51.2    2e-05   Acytostelium subglobosum LB1
ref|XP_005847512.1|  hypothetical protein CHLNCDRAFT_52636            53.9    2e-05   Chlorella variabilis
ref|XP_005644670.1|  hypothetical protein COCSUDRAFT_67495            53.5    3e-05   Coccomyxa subellipsoidea C-169
ref|XP_002963384.1|  hypothetical protein SELMODRAFT_438530           53.5    3e-05   
ref|XP_001701978.1|  predicted protein                                50.4    3e-05   Chlamydomonas reinhardtii
ref|XP_002974668.1|  hypothetical protein SELMODRAFT_415024           53.1    3e-05   
ref|XP_006398636.1|  hypothetical protein EUTSA_v10013736mg           53.1    3e-05   
ref|XP_002502726.1|  carbohydrate-binding module family 20 protein    53.1    3e-05   Micromonas commoda
ref|XP_004246332.1|  PREDICTED: uncharacterized protein LOC101251213  53.1    4e-05   
gb|KHN48367.1|  Alpha-amylase                                         52.8    4e-05   Glycine soja [wild soybean]
ref|XP_006576534.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    4e-05   
gb|KHG02392.1|  Phosphoglucan, water dikinase, chloroplastic -lik...  52.8    4e-05   Gossypium arboreum [tree cotton]
ref|XP_006576539.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    4e-05   
ref|XP_003520734.1|  PREDICTED: uncharacterized protein LOC100778097  52.8    4e-05   
gb|ACU23169.1|  unknown                                               52.8    5e-05   Glycine max [soybeans]
gb|KHN46339.1|  Phosphoglucan, water dikinase, chloroplastic          52.8    5e-05   Glycine soja [wild soybean]
ref|XP_004183886.1|  hypothetical protein EIN_170650                  50.1    5e-05   Entamoeba invadens IP1
ref|XP_006576535.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.6    6e-05   
gb|KHN45754.1|  Phosphoglucan, water dikinase, chloroplastic          52.4    6e-05   Glycine soja [wild soybean]
ref|XP_003516949.1|  PREDICTED: ribonuclease E/G-like protein, ch...  52.4    6e-05   Glycine max [soybeans]
ref|XP_006366357.1|  PREDICTED: uncharacterized protein LOC102586811  52.4    6e-05   Solanum tuberosum [potatoes]
ref|XP_007205350.1|  hypothetical protein PRUPE_ppa007150mg           52.4    6e-05   
gb|KHN36405.1|  Phosphoglucan, water dikinase, chloroplastic          51.2    7e-05   Glycine soja [wild soybean]
ref|WP_030499128.1|  alpha-amylase                                    52.4    7e-05   Micromonospora purpureochromogenes
gb|EHK25059.1|  glycoside hydrolase family 15 protein                 52.4    7e-05   Trichoderma virens Gv29-8
ref|XP_004156602.1|  PREDICTED: uncharacterized LOC101213899          52.0    8e-05   
ref|XP_006576537.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.6    8e-05   
ref|XP_004137725.1|  PREDICTED: uncharacterized protein LOC101213899  52.0    9e-05   
ref|XP_001768545.1|  predicted protein                                51.6    1e-04   
ref|XP_652601.2|  hypothetical protein                                48.9    1e-04   Entamoeba histolytica HM-1:IMSS
ref|WP_013286849.1|  MULTISPECIES: alpha-amylase                      52.0    1e-04   Micromonospora
gb|EMD46465.1|  starch binding domain containing protein              48.9    1e-04   Entamoeba histolytica KU27
ref|XP_006576541.1|  PREDICTED: ribonuclease E/G-like protein, ch...  51.6    1e-04   
ref|XP_003051549.1|  hypothetical protein NECHADRAFT_92513            51.6    1e-04   [Nectria] haematococca mpVI 77-13-4
ref|XP_008243940.1|  PREDICTED: uncharacterized protein LOC103342132  51.6    1e-04   Prunus mume [ume]
gb|EQB53702.1|  glycosyl hydrolase family 15                          51.6    1e-04   Colletotrichum gloeosporioides Cg-14
gb|KIY98013.1|  hypothetical protein MNEG_9950                        50.8    1e-04   Monoraphidium neglectum
ref|XP_002477993.1|  alpha-amylase, putative                          51.6    1e-04   Talaromyces stipitatus ATCC 10500
ref|XP_006576533.1|  PREDICTED: phosphoglucan, water dikinase, ch...  50.8    1e-04   
ref|WP_034223083.1|  glycosidase                                      51.2    1e-04   
ref|XP_001270539.1|  glucan 1,4-alpha-glucosidase, putative           51.2    1e-04   Aspergillus clavatus NRRL 1
ref|XP_003060950.1|  carbohydrate-binding module family 20 protein    51.2    2e-04   Micromonas pusilla CCMP1545
ref|XP_004538448.1|  PREDICTED: dentin sialophosphoprotein-like i...  51.2    2e-04   
ref|WP_030461968.1|  hypothetical protein                             50.4    2e-04   
ref|XP_006848182.1|  hypothetical protein AMTR_s00029p00236780        50.8    2e-04   
ref|WP_022110961.1|  4-alpha-glucanotransferase                       51.2    2e-04   
gb|KGO46641.1|  Glycoside hydrolase, family 13                        50.8    2e-04   Penicillium expansum
gb|KDP24469.1|  hypothetical protein JCGZ_25033                       50.8    2e-04   Jatropha curcas
ref|XP_009344720.1|  PREDICTED: uncharacterized protein LOC103936...  50.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_003564648.1|  PREDICTED: uncharacterized protein LOC100835...  50.8    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_010232573.1|  PREDICTED: uncharacterized protein LOC100835...  50.8    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_009344719.1|  PREDICTED: uncharacterized protein LOC103936...  50.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_010543884.1|  PREDICTED: uncharacterized protein LOC104816652  50.4    2e-04   Tarenaya hassleriana [spider flower]
ref|WP_030158763.1|  hypothetical protein                             50.8    2e-04   Glycomyces sp. NRRL B-16210
ref|WP_029664274.1|  glycosidase                                      50.8    2e-04   
ref|XP_004366717.1|  kin17-like protein                               50.8    2e-04   Cavenderia fasciculata
ref|WP_028596875.1|  alpha-amylase                                    50.8    3e-04   Paenibacillus pasadenensis
dbj|GAM42477.1|  alpha-amylase                                        50.4    3e-04   Talaromyces cellulolyticus
ref|XP_002145753.1|  alpha-amylase, putative                          50.4    3e-04   Talaromyces marneffei ATCC 18224
ref|WP_012749393.1|  alpha-amylase                                    50.4    3e-04   Geobacillus sp. WCH70
ref|XP_001273135.1|  Glycosyl hydrolase, family 15, putative          50.4    3e-04   Aspergillus clavatus NRRL 1
ref|WP_026447047.1|  hypothetical protein                             50.4    3e-04   Acidobacteriaceae bacterium URHE0068
ref|WP_030583847.1|  hypothetical protein                             48.1    3e-04   
ref|XP_002584589.1|  glucoamylase                                     50.4    3e-04   Uncinocarpus reesii 1704
ref|WP_007544893.1|  cyclomaltodextrin glucanotransferase             50.4    3e-04   Haloferax larsenii
ref|XP_010037714.1|  PREDICTED: uncharacterized protein LOC104426...  50.1    3e-04   Eucalyptus grandis [rose gum]
ref|XP_011399502.1|  Phosphoglucan, water dikinase, chloroplastic     50.1    3e-04   Auxenochlorella protothecoides
ref|XP_009377794.1|  PREDICTED: uncharacterized protein LOC103966354  50.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_002951018.1|  hypothetical protein VOLCADRAFT_91596            50.4    3e-04   Volvox carteri f. nagariensis
ref|XP_001209972.1|  hypothetical protein ATEG_07286                  50.1    3e-04   Aspergillus terreus NIH2624
gb|KDO36025.1|  hypothetical protein CISIN_1g012471mg                 50.1    3e-04   Citrus sinensis [apfelsine]
ref|XP_008370075.1|  PREDICTED: uncharacterized protein LOC103433588  50.1    3e-04   
ref|WP_008323077.1|  cyclomaltodextrin glucanotransferase             50.4    4e-04   Haloferax elongans
ref|WP_009163304.1|  putative 4-alpha-glucanotransferase              50.4    4e-04   Prevotella saccharolytica
ref|WP_013150819.1|  alpha-amylase                                    50.1    4e-04   Thermoanaerobacter mathranii
ref|XP_010037713.1|  PREDICTED: uncharacterized protein LOC104426...  50.1    4e-04   Eucalyptus grandis [rose gum]
ref|XP_001270422.1|  starch binding domain protein                    50.1    4e-04   Aspergillus clavatus NRRL 1
ref|WP_028991976.1|  alpha-amylase                                    50.1    4e-04   Thermoanaerobacter thermocopriae
ref|XP_002502720.1|  carbohydrate-binding module family 20 protein    49.7    4e-04   Micromonas commoda
ref|XP_009344721.1|  PREDICTED: uncharacterized protein LOC103936...  50.1    4e-04   Pyrus x bretschneideri [bai li]
ref|WP_022874232.1|  glycosidase                                      50.1    4e-04   
ref|XP_001696233.1|  hypothetical protein CHLREDRAFT_182288           49.7    5e-04   Chlamydomonas reinhardtii
ref|XP_011077571.1|  PREDICTED: uncharacterized protein LOC105161548  49.7    5e-04   Sesamum indicum [beniseed]
gb|EEH40712.2|  glucoamylase                                          49.7    5e-04   Paracoccidioides lutzii Pb01
ref|WP_012269126.1|  MULTISPECIES: alpha-amylase                      49.7    5e-04   Thermoanaerobacter
ref|XP_002873018.1|  glycoside hydrolase starch-binding domain-co...  49.3    5e-04   
ref|XP_008081828.1|  Six-hairpin glycosidase                          49.7    6e-04   Glarea lozoyensis ATCC 20868
gb|KFY83798.1|  hypothetical protein V500_09893                       49.7    6e-04   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_008442436.1|  PREDICTED: uncharacterized protein LOC103486...  49.7    6e-04   Cucumis melo [Oriental melon]
ref|XP_006795663.1|  PREDICTED: dentin sialophosphoprotein-like       49.7    6e-04   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006576538.1|  PREDICTED: phosphoglucan, water dikinase, ch...  48.9    6e-04   
ref|XP_005729253.1|  PREDICTED: uncharacterized protein LOC102200471  49.7    6e-04   Pundamilia nyererei
ref|XP_005943798.1|  PREDICTED: dentin sialophosphoprotein-like       49.7    6e-04   Haplochromis burtoni
ref|XP_007273214.1|  glucoamylase                                     49.3    7e-04   
ref|XP_006381240.1|  hypothetical protein POPTR_0006s10010g           49.3    7e-04   
ref|WP_038992291.1|  glycosidase                                      49.3    7e-04   
emb|CDX80780.1|  BnaC03g00340D                                        49.3    7e-04   
ref|XP_005716002.1|  Putative Laforin                                 49.3    7e-04   Chondrus crispus [carageen]
ref|XP_008442437.1|  PREDICTED: uncharacterized protein LOC103486...  49.3    7e-04   Cucumis melo [Oriental melon]
ref|XP_008442435.1|  PREDICTED: uncharacterized protein LOC103486...  49.3    7e-04   Cucumis melo [Oriental melon]
ref|XP_003007412.1|  glucoamylase                                     49.3    7e-04   Verticillium alfalfae VaMs.102
ref|XP_008858930.1|  starch binding domain containing protein         46.6    8e-04   Entamoeba nuttalli P19
ref|WP_004057795.1|  alpha-amylase                                    49.3    8e-04   Haloferax mediterranei
emb|CAI46245.1|  cyclomaltodextrin glucanotransferase precursor       49.3    8e-04   Haloferax mediterranei
ref|NP_568087.1|  carbohydrate-binding domain-containing protein      48.9    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|WP_035849789.1|  glycosidase                                      49.3    8e-04   Kitasatospora azatica
ref|XP_002559611.1|  Pc13g11940                                       48.9    8e-04   Penicillium rubens Wisconsin 54-1255
gb|EWM63158.1|  alpha-amylase                                         48.9    9e-04   Micromonospora sp. M42
ref|XP_006576540.1|  PREDICTED: phosphoglucan, water dikinase, ch...  48.1    9e-04   
ref|WP_041648945.1|  glycosidase                                      48.9    0.001   
dbj|GAM26669.1|  hypothetical protein SAMD00019534_098440             48.1    0.001   Acytostelium subglobosum LB1
emb|CBT76664.1|  glycosyl hydrolase, family 13                        48.9    0.001   Glutamicibacter arilaitensis Re117
gb|KJB36893.1|  hypothetical protein B456_006G181700                  48.9    0.001   Gossypium raimondii
ref|WP_043323282.1|  alpha-amylase                                    48.9    0.001   Micromonospora sp. M42
ref|WP_012807740.1|  alpha-amylase                                    48.9    0.001   Halomicrobium mukohataei



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 106/137 (77%), Gaps = 5/137 (4%)
 Frame = +2

Query  167  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQV  346
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K S+ E ++L+  LDHQV
Sbjct  46   LTLLPATNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNK-SSSEKVQLRFRLDHQV  100

Query  347  EYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWET  526
            EYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDKN+LWE 
Sbjct  101  EYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGEILEYKFVIVGKDKNMLWEN  160

Query  527  GDNRVLKLPAGGSFKMV  577
            G NR+LKLP GGSF++V
Sbjct  161  GSNRILKLPEGGSFELV  177



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = +2

Query  59   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKL-KFSEPRLILEPQGIPGSIMNRPTR  220
            MDSL   H     NAK   P+  I S + T L +L + S    IL P+   G +M+   R
Sbjct  1    MDSLHFTHCYSTLNAKKRQPHNQI-SKQFTVLPQLSQTSVKNSILLPRKKLGFLMDYKGR  59

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            G  +  + AVSSVETRE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   G--TGIVRAVSSVETREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  116

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            KKN+MMDWTE GW+SE+EL  GE +E+KFVIVGKDKN+LWE G NR+L LP GGSF++V
Sbjct  117  KKNIMMDWTENGWISELELPAGESLEYKFVIVGKDKNMLWENGSNRILMLPEGGSFELV  175



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = +2

Query  59   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKLKFSEPR-LILEPQGIPGSIMNRPTR  220
            MDSL   +     NAK   P+ HI S + T L +L  +  +  IL P+     +M+   +
Sbjct  1    MDSLHFSYCYSTLNAKKKQPHNHI-SKKFTVLPQLSHTSVKNSILFPRKKLVFLMDCRIK  59

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            G  +  + A SSVE RE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   GRGTGIVRAASSVEIREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  118

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            KKN+MMDWTE GW+SE+E   GE +E+KFVIVGKDKN+LWE G NR+LKLP GGSF++
Sbjct  119  KKNIMMDWTENGWISELEFPAGESLEYKFVIVGKDKNMLWENGSNRILKLPEGGSFEL  176



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  167  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  337
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  338  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  517
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  518  WETGDNRVLKLPAGGSFKMV  577
            WE G NR+LKLP GG F++V
Sbjct  158  WENGSNRILKLPEGGGFELV  177



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  167  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  337
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  338  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  517
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  518  WETGDNRVLKLPAGGSFKMV  577
            WE G NR+LKLP GG F++V
Sbjct  158  WENGSNRILKLPEGGGFELV  177



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  167  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  337
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  338  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  517
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  518  WETGDNRVLKLPAGGSFKMV  577
            WE G NR+LKLP GG F++V
Sbjct  158  WENGSNRILKLPEGGGFELV  177



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 21/179 (12%)
 Frame = +2

Query  59   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  220
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +V
Sbjct  106  KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVV  164



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 21/179 (12%)
 Frame = +2

Query  59   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  220
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +V
Sbjct  106  KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVV  164



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 4/121 (3%)
 Frame = +2

Query  227  SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  394
            SSR +  VSSVET   E+K ++     R   E + +K+ L+HQVE+GEHIA++GS KELG
Sbjct  5    SSRILSGVSSVETSRKEEKKQKKTKQSRQGQEKVLMKVLLNHQVEFGEHIALLGSAKELG  64

Query  395  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            SWKK +MMDWTE GWV E+ELKGGEPVE KFVIV KDK   WE+GDNRVL LP GGSFK 
Sbjct  65   SWKKELMMDWTEDGWVCELELKGGEPVECKFVIVRKDKRRAWESGDNRVLMLPEGGSFKT  124

Query  575  V  577
            V
Sbjct  125  V  125



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 114/177 (64%), Gaps = 18/177 (10%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS-R  235
            MDSLR LH +  +     IPS  R       F  P       GI     + P R  SS R
Sbjct  1    MDSLRVLHLSNSSPKIIQIPS--RNQFHPFVFFNP-------GI-----SFPLRQSSSFR  46

Query  236  TI-CAVSSVETR--EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  406
            TI C VSS ETR  E + K  + +S    ++L + LDHQVEYGEH+AI+GSTKELG WKK
Sbjct  47   TIICGVSSTETRGEEKKMKKTKSKSGRGKVRLFVHLDHQVEYGEHVAILGSTKELGLWKK  106

Query  407  NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            NV+M+WTE GWV ++ELKG + + FKFV++  DK+++WE GDNR++KLP GGS+K+V
Sbjct  107  NVLMNWTESGWVCDLELKGDDSIGFKFVVLRTDKSVVWEGGDNRIIKLPKGGSYKIV  163



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 108/178 (61%), Gaps = 17/178 (10%)
 Frame = +2

Query  59   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  232
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFIYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  233  RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  403
            R  +C VSS ++RE EK  ++ RS  E   ++L + +DHQVE+GE I I+GSTKELGSWK
Sbjct  49   RRIVCGVSSTQSREQEKAMRKSRSRLERGKVRLNVRVDHQVEFGEQIVILGSTKELGSWK  108

Query  404  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K V M+WTE GWV ++E+KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +V
Sbjct  109  KRVPMNWTENGWVCDLEMKGGGIVEFKFVIVSKDRSFVWESGDNRALRLPRGGSFAVV  166



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 104/182 (57%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   MDSLRALH--------NAKYAYPYRHIPSARRT-SLGKLKFSEPRLILEPQGIPGSIMNR  211
            MDSLR LH          ++ + + H   AR         F  PR+ +            
Sbjct  1    MDSLRLLHFVIPTPTRRNQFHHSHSHHKLARPPGQCATTTFFNPRISI------------  48

Query  212  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  391
            P RG   R +CAVSS +TRE E+       A    KL + +DHQVE+GEHI I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEER-------ATMKSKLNVRIDHQVEFGEHIVIVGSSKEM  98

Query  392  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  571
            GSWKK V M WTE GWV E+ELKGGE VEFKF IV KD  L+WE G NR LKLP  GSF 
Sbjct  99   GSWKKKVPMKWTENGWVCELELKGGEAVEFKFAIVSKDNGLVWENGHNRALKLPREGSFA  158

Query  572  MV  577
            +V
Sbjct  159  IV  160



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 107/182 (59%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   MDSLRALH--------NAKYAYPYRHIPSARRTSL-GKLKFSEPRLILEPQGIPGSIMNR  211
            MDSLR LH          ++ + + H   AR   L     F  PR+ +            
Sbjct  1    MDSLRLLHFVTPTPTRRNQFHHSHSHHKLARPPGLRATTTFFNPRISI------------  48

Query  212  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  391
            P RG   R +CAVSS +TRE E+  K+         L + +DHQVE+GE+I I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEERATKKS-------MLNVRIDHQVEFGENIVIVGSSKEM  98

Query  392  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  571
            GSWKK V M WTE GWV ++ELKGGE VEFKF I  KD +L+WE+GDNR LKLP  GSF 
Sbjct  99   GSWKKKVPMKWTENGWVCKLELKGGEVVEFKFAIASKDNSLVWESGDNRALKLPREGSFA  158

Query  572  MV  577
            +V
Sbjct  159  IV  160



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 107/178 (60%), Gaps = 17/178 (10%)
 Frame = +2

Query  59   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  232
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFMYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  233  RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  403
            R  +C VSS ++RE EK  K+ RS  E   ++L + +DHQVE+GE I I+GS KELGSWK
Sbjct  49   RRIVCGVSSPQSREQEKAMKKSRSRSERGKVRLNVRVDHQVEFGEQIVILGSDKELGSWK  108

Query  404  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K V M+WTE GWV ++++KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +V
Sbjct  109  KRVPMNWTESGWVCDLKMKGGGIVEFKFVIVRKDRSFVWESGDNRALRLPRGGSFAVV  166



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 87/132 (66%), Gaps = 9/132 (7%)
 Frame = +2

Query  209  RPTRGLSSR-TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIA  367
            R TR  S R T+ AVSS ETRE E K       + K+S    + LK+ L HQVEYGEH+A
Sbjct  51   RHTRKASVRMTVSAVSSTETREKESKNENNKERQSKKSGGNKVNLKLRLAHQVEYGEHVA  110

Query  368  IMGSTKELGSWKKNVMMDWTEKGWVSEMELKGG-EPVEFKFVIVGKDKN-LLWETGDNRV  541
            I+GS KE GSWK  VMMDWTE GWV  MEL    EPVE+KFVIVG DK  L WE GDNR 
Sbjct  111  ILGSAKEFGSWKNKVMMDWTENGWVCTMELSNKEEPVEYKFVIVGNDKERLTWENGDNRT  170

Query  542  LKLPAGGSFKMV  577
            LK P  GSF +V
Sbjct  171  LKFPENGSFNVV  182



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 109/180 (61%), Gaps = 16/180 (9%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  226
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  227  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
               + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 109/180 (61%), Gaps = 16/180 (9%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  226
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  227  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
               + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  TRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKE  388
             RG  S  +  VSS ETRE EKKGK+ +S    E + L + LDHQVE+GE +AI+GS +E
Sbjct  59   ARGRPSTVVRGVSSTETREGEKKGKKIKSKPGGEKVHLSVRLDHQVEFGESVAILGSARE  118

Query  389  LGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSF  568
            LGSWKK V MDWT+ GWV E+ELKGGE VE+KFVI  KDK++ WE+GDNRVLKLP GG +
Sbjct  119  LGSWKKKVAMDWTKSGWVCELELKGGESVEYKFVIDRKDKSVAWESGDNRVLKLPKGGKY  178

Query  569  KMV  577
             MV
Sbjct  179  GMV  181



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 8/122 (7%)
 Frame = +2

Query  236  TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
            T+ AVSSVETRE E K       + K S  + +KLK+ LDHQVE+GEH+AI+GS  ELGS
Sbjct  66   TVSAVSSVETREEEMKKDKKKKRQSKTSGADKVKLKVRLDHQVEFGEHVAILGSAIELGS  125

Query  398  WKKNVMMDWTEKGWVSEMELKGG-EPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFK  571
            WK  VMMDWTE GWV ++EL    EPVE+KFVIV KDK  L+WE+GDNR+LK    G+F 
Sbjct  126  WKNKVMMDWTENGWVCDLELNSNEEPVEYKFVIVSKDKGKLVWESGDNRILKFSGNGNFN  185

Query  572  MV  577
            +V
Sbjct  186  IV  187



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 109/180 (61%), Gaps = 16/180 (9%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  226
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  227  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
               + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 109/180 (61%), Gaps = 16/180 (9%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  226
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  227  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
               + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  406
            SSR  C VSSVE R+ EKK + ++   + L L + L+HQVE+GEH+A++GS+KELGSWKK
Sbjct  59   SSRITCGVSSVEERKEEKKMESRKRRGKVL-LSVRLNHQVEFGEHVAMLGSSKELGSWKK  117

Query  407  NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             V +DWTE GWV ++E+KGGE VE+KFVI+ KDK+++WE GDNR LKLP GG F+M+
Sbjct  118  KVNLDWTENGWVCDLEMKGGEEVEYKFVILRKDKSIIWENGDNRSLKLPEGGRFEMI  174



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  418
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  419  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +V
Sbjct  112  SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIV  164



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  418
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  419  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +V
Sbjct  112  SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIV  164



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 11/166 (7%)
 Frame = +2

Query  86   AKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVET  265
            + +    R I  +R +SL       PRL+   + +P     R     S R  C VS+  +
Sbjct  5    SSHCCSSRCIFFSRSSSL-------PRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASAS  56

Query  266  REVE--KKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  439
              +E  ++ K+ RS  + + LK+ LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGW
Sbjct  57   STIEEQRQKKDDRSG-KKVMLKLRLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGW  115

Query  440  VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            V E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +V
Sbjct  116  VCELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVV  161



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 11/166 (7%)
 Frame = +2

Query  86   AKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVET  265
            + +    R I  +R +SL       PRL+   + +P     R     S R  C VS+  +
Sbjct  5    SSHCCSSRCIFFSRSSSL-------PRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASAS  56

Query  266  REVE--KKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  439
              +E  ++ K+ RS  + + LK+ LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGW
Sbjct  57   STIEEQRQKKDDRSG-KKVMLKLRLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGW  115

Query  440  VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            V E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +V
Sbjct  116  VCELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVV  161



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 111/179 (62%), Gaps = 22/179 (12%)
 Frame = +2

Query  65   SLRALHNAKYAYPYR----HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  232
            SLR+LH   +  P R     +P A   S        PR+       PG  +NR  R  S 
Sbjct  5    SLRSLH---FQIPARKQLKFLPDATIFS--------PRISFPFPFPPG--INR-HRKHSH  50

Query  233  RTICAVSSVETREVEKKGKEKR----SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
              + AVSS  TRE EKK K  +    S    + L + LDHQV++GEH+ I+GSTKELGSW
Sbjct  51   SLVFAVSSTPTREEEKKKKMTKVKPMSGSGKVGLNVCLDHQVQFGEHVVILGSTKELGSW  110

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            KK V M+W+E GW+ ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GG+F M+
Sbjct  111  KKQVPMNWSEDGWICDLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGNFGMI  169



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +2

Query  110  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  470  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  128  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  163



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  320  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  499
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  84   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  143

Query  500  KDKNLLWETGDNRVLKLPAGGSFKMV  577
            KDK++ WE G+NRVLKLP GGSF M+
Sbjct  144  KDKSVAWEGGNNRVLKLPQGGSFGMI  169



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  320  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  499
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  84   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  143

Query  500  KDKNLLWETGDNRVLKLPAGGSFKMV  577
            KDK++ WE G+NRVLKLP GGSF M+
Sbjct  144  KDKSVAWEGGNNRVLKLPQGGSFGMI  169



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  320  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  499
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  25   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  84

Query  500  KDKNLLWETGDNRVLKLPAGGSFKMV  577
            KDK++ WE G+NRVLKLP GGSF M+
Sbjct  85   KDKSVAWEGGNNRVLKLPQGGSFGMI  110



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +2

Query  110  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  470  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  128  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  163



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +2

Query  188  IPGSIMNRPTRGLSSRTICAVSSVETREVEK--KGKEKRSAHEN--LKLKIWLDHQVEYG  355
            +P S  +R      S+  C +SSV+TRE E+     + RS  EN  ++L I L HQV++G
Sbjct  44   LPSSTTSR------SQIFCGISSVQTREEEEIMNNNKTRSRRENGKVQLSILLKHQVQFG  97

Query  356  EHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  535
            E + I GS+KE+GSW+K V M+WT+ GWV ++ELKGG+  EFKFVI+GKDK+L WE+GDN
Sbjct  98   ECVVIFGSSKEMGSWEKPVTMNWTDNGWVLDLELKGGDSGEFKFVIMGKDKSLTWESGDN  157

Query  536  RVLKLPAGGSFKM  574
            R L++P GG F +
Sbjct  158  RKLQIPGGGKFTL  170



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 112/178 (63%), Gaps = 18/178 (10%)
 Frame = +2

Query  59   MDS--LRALHNAKYAY-PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLS  229
            MDS  LR+LH         R +P+   T+L   + S P     P GI     NR  R  S
Sbjct  1    MDSIPLRSLHPQILVRKQLRFLPN---TALSNPRISFPL----PPGI-----NR-HRKHS  47

Query  230  SRTICAVSSVETREVEKKGKEKR--SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  403
                 AVSS  TRE EKK  + +  S    + L + LDHQVE+GEH+AI+GSTKELGSWK
Sbjct  48   LPLFFAVSSTLTREEEKKKMKAKPKSGRGKVGLNVCLDHQVEFGEHVAILGSTKELGSWK  107

Query  404  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K V M+WTE GWV ++ELKG E VE+KFVIV KDK+++WE GDNRVLKLP  G+F MV
Sbjct  108  KQVPMNWTEGGWVCDLELKGDESVEYKFVIVRKDKSVVWEGGDNRVLKLPQSGNFGMV  165



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  490
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  10   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  69

Query  491  IVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            IV  DK+  WE GDNR+LKLP GGSF++V
Sbjct  70   IVRNDKSKAWEAGDNRILKLPKGGSFEIV  98



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  110  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            H  S+  T + +   + P+L+   + +  +  +   R  SSR  C  SS  T  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLTHQSHRLRNSSSRLTCTASSSST--IEEQRK  65

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WT+KGWV ++EL GG+
Sbjct  66   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTDKGWVCQLELDGGQ  125

Query  470  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  126  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  110  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            H  S+  T + +   + P+L+   + +  +  +   R  SSR  C  SS  T  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLTHQSHRLRNSSSRLTCTASSSST--IEEQRK  65

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WT+KGWV ++EL GG+
Sbjct  66   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTDKGWVCQLELDGGQ  125

Query  470  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  126  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  490
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  147

Query  491  IVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            IV  DK+  WE GDNR+LKLP GGSF++V
Sbjct  148  IVRNDKSKAWEAGDNRILKLPKGGSFEIV  176



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +2

Query  227  SSRTICAVSSVETREVEKKGKEK--RSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            S R  C VS+  +  +E++ K K    + + +KL + LDHQVE+GEH++I GS++E+GSW
Sbjct  44   SCRITCTVSASASSTIEEQRKSKGDDKSGKTVKLNLRLDHQVEFGEHVSIFGSSEEIGSW  103

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            KK V + WTE GWV E+EL GG+ +E+KFVIV KD +L WE+GDNRVL+LP  GSF +
Sbjct  104  KKKVPLAWTENGWVCELELSGGQVLEYKFVIVRKDGSLAWESGDNRVLQLPNSGSFSV  161



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 98/159 (62%), Gaps = 9/159 (6%)
 Frame = +2

Query  101  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  280
            P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +E+
Sbjct  12   PFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEE  62

Query  281  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  460
            + K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+EL 
Sbjct  63   QRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELELD  122

Query  461  GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +V
Sbjct  123  GGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVV  161



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +2

Query  110  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            H  S+  T + +   S P+L+   + +  S  +   R  SSR  C  +S  T  +E++ K
Sbjct  7    HCCSSPFTFITRNTSSLPKLVNFTRRVNLSHQSHRLRNSSSRLTCTATSSST--IEEQRK  64

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
            +K  +   +KL + LD+QV++GEH+A+ GS KE+GSWKK   ++WTE GWV E+EL GG+
Sbjct  65   KKDGSGTKVKLNVRLDYQVKFGEHVAMFGSAKEIGSWKKKSPLNWTENGWVCELELDGGQ  124

Query  470  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +E+KFVIV  D +L WE+GDNRVLK+P  G+F +V
Sbjct  125  VLEYKFVIVKDDGSLSWESGDNRVLKVPNSGNFSVV  160



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 102/173 (59%), Gaps = 5/173 (3%)
 Frame = +2

Query  59   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRT  238
            M S R L +   +  Y     +  +SL  LK   PR  L P    GS  +          
Sbjct  1    MASFR-LFSCSSSSLYTDYDESSSSSLHILKL-RPRFFLLP-CFEGSRFSSHVLSRRLYP  57

Query  239  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  418
            +    SV  RE +    +++     + ++I LDHQV++GEHIAI GS+KELGSWKKNV M
Sbjct  58   VVCRGSVSEREAKMAPVDRKKG--KVAIRIRLDHQVKFGEHIAITGSSKELGSWKKNVDM  115

Query  419  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             WTE GWV++++LKGGE VE+KFVI+ K+K  +WE GDNR LKLP  G F+MV
Sbjct  116  SWTEDGWVADLKLKGGENVEYKFVILAKEKTTIWEEGDNRALKLPKEGKFEMV  168



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = +2

Query  155  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  334
            S PR++   + +     ++  R   SR  CA SS     +E++ K+K  +   +KL + L
Sbjct  21   SLPRIVNFTRSVHLGRQSQRLRNSPSRLTCAASST----IEEQRKKKDGSGTKVKLNVRL  76

Query  335  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  514
            +HQV +GEH+A+ GS KE+GSWKK   + WTE GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  77   NHQVNFGEHVAMFGSAKEIGSWKKKSPLTWTENGWVCELELSGGQVLEYKFVIVHNDGSL  136

Query  515  LWETGDNRVLKLPAGGSFKMV  577
             WE+GDNRVLKLP  GSF +V
Sbjct  137  SWESGDNRVLKLPNSGSFSVV  157



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  490
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  491  IVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            IV  DK+  WE G NR+LKLP GGSF++V
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIV  176



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  490
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  491  IVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            IV  DK+  WE G NR+LKLP GGSF++V
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIV  176



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 5/122 (4%)
 Frame = +2

Query  227  SSRTICAV-----SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  391
            S R +C V      S+E  +  K   + +  H  + L I LDHQVE+GE IA++GS+KEL
Sbjct  57   SLRILCGVGVSPPQSIEEEKETKMKSKSKDRHGKVWLNIRLDHQVEFGESIAVLGSSKEL  116

Query  392  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  571
            GSWKK V ++WTE GWV ++E KG E +E+KFV V  DK++LWE GDNRVLKLP+ GSF 
Sbjct  117  GSWKKKVPLNWTESGWVCQLEFKGDEVIEYKFVTVRADKSMLWEGGDNRVLKLPSRGSFG  176

Query  572  MV  577
            MV
Sbjct  177  MV  178



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  490
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  491  IVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            IV  DK+  WE G NR+LKLP GGSF++V
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIV  176



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  293  KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEP  472
            K SA   + L I LD QV+YGEH+ I+GS KELGSWKK V M W+E+GWV + E  GG+ 
Sbjct  4    KLSAPGKVCLNICLDLQVKYGEHVVILGSAKELGSWKKQVPMSWSERGWVCDFEFDGGQS  63

Query  473  VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             EFKFVIVG DK L+WETG+NR+LKLP GGS+ +V
Sbjct  64   AEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIV  98



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 99/161 (61%), Gaps = 9/161 (6%)
 Frame = +2

Query  95   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  274
            + P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +
Sbjct  10   SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--I  60

Query  275  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  454
            E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61   EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  455  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            L GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +V
Sbjct  121  LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVV  161



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  281  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  460
            K  + +S    ++L   LDHQVE+G+H+ I+GSTKELG WKKN+ M WTE GWV ++ LK
Sbjct  2    KTNKSKSGSGKVRLNFRLDHQVEFGDHVVILGSTKELGLWKKNLPMTWTESGWVCDLVLK  61

Query  461  GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            GGE +EFKFVI  KDK L+WE GDNR LKLP GG +++V
Sbjct  62   GGESIEFKFVIARKDKTLVWEGGDNRTLKLPKGGHYEIV  100



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 99/161 (61%), Gaps = 9/161 (6%)
 Frame = +2

Query  95   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  274
            + P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +
Sbjct  10   SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--I  60

Query  275  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  454
            E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61   EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  455  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            L GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +V
Sbjct  121  LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVV  161



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  299  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  478
            S  + ++L I LDHQV++GEH+ I+GSTKELGSWKK V ++WTE+GWV ++ELKGG  +E
Sbjct  5    SGRDKVQLSIRLDHQVKFGEHVVILGSTKELGSWKKKVHLNWTERGWVCQLELKGGNSIE  64

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            +KFVI+GKD++LLWE+G+NRVL LP  G + +V
Sbjct  65   YKFVILGKDESLLWESGENRVLGLPERGIYGIV  97



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  224  LSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  403
            L S  + +  S+E  +  K   + +S +E ++L + LDHQVE+GE + I+GS KELGSWK
Sbjct  59   LCSAGVSSAQSIEEEKESKMKSKSKSGNEKVRLNVRLDHQVEFGESVVILGSIKELGSWK  118

Query  404  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE GDNRVLKLP GG+F +V
Sbjct  119  KRVPMNWTESGWVCSLEFKGGESVEYKFLTVRADKSVLWEGGDNRVLKLPKGGNFGIV  176



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  305  HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFK  484
            +E ++L + LDHQVE+GE + I+GS KELGSWKK V M+WTE GWV  +E KGGE VE+K
Sbjct  86   NEKVRLNVRLDHQVEFGESVVILGSIKELGSWKKKVPMNWTESGWVCSLEFKGGESVEYK  145

Query  485  FVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            F+ V  DK +LWE GDNRVLKLP GG+F +V
Sbjct  146  FLTVRADKTVLWEGGDNRVLKLPKGGNFGIV  176



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  230  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  409
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  410  VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V
Sbjct  107  VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTV  162



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  230  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  409
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  410  VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V
Sbjct  107  VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTV  162



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  275  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  454
            E++ K+K  +   +KL + LDHQV++GEH+A+ GS KE+GSWKK   ++WT+KGWV E+E
Sbjct  50   EEQRKKKDGSGTKVKLNVRLDHQVQFGEHVAMFGSAKEIGSWKKKSPLNWTDKGWVCEIE  109

Query  455  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  110  LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  150



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  415
            T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51   TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  416  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +V
Sbjct  109  LAWSEKGWVCELELNGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVV  162



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  415
            T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51   TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  416  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +V
Sbjct  109  LAWSEKGWVCELELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVV  162



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 4/121 (3%)
 Frame = +2

Query  218  RGLSSRTIC-AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  394
            R   SR  C A SS  T E ++K   K ++   +KLK+ LDHQV +GEH+A+ GS KE+G
Sbjct  42   RNSHSRLTCTASSSSSTIEDQRK---KDASGTKVKLKVRLDHQVNFGEHVAMFGSAKEIG  98

Query  395  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            SWKK   ++WTE GWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVL+LP  GSF +
Sbjct  99   SWKKKSPLNWTENGWVCDLELSGGQVLEYKFVIVQNDGSLSWESGDNRVLRLPNSGSFSV  158

Query  575  V  577
            V
Sbjct  159  V  159



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = +2

Query  272  VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  442
            VE+  +EKR A      +++++ LDHQVE+GEH+A++GSTKELG WK+ V MDWT +GWV
Sbjct  57   VERIEEEKRKASGKRRKVRMRVQLDHQVEFGEHVAVLGSTKELGLWKRQVPMDWTPEGWV  116

Query  443  SEMELKGGEPVEFKFVIVGKDK-NLLWETGDNRVLKLPAGGSFKMV  577
             E+EL GGE +E+KFVI+ K K  ++WE GDNRVLKLP  G F MV
Sbjct  117  CELELCGGEVLEYKFVILRKGKMGMIWEDGDNRVLKLPEEGMFDMV  162



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +2

Query  218  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
            R  SSR  C+ +S  +   E++ KE  S  + +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  45   RNSSSRLTCSAASSSSTIEEQRKKEDGSGTK-VKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WKK   ++WTE GWV E+ L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  104  WKKKSPLNWTENGWVCELNLDGGQVLEYKFVIVKDDGSLSWESGDNRVLKLPNSGNFSVV  163



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 92/159 (58%), Gaps = 13/159 (8%)
 Frame = +2

Query  101  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  280
            P+  I   R +SL +L    PR           + +  ++  S R  C+ SS    E   
Sbjct  12   PFTSI--TRNSSLPRLVHFTPR-----------VFHIRSQSDSRRLTCSASSSTIEEQRM  58

Query  281  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  460
                   + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E+ L 
Sbjct  59   NKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCELHLN  118

Query  461  GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            GG+P+EFKFVI+  D +L WE+GDNRVL LP  G+F +V
Sbjct  119  GGQPLEFKFVIMKTDGSLSWESGDNRVLNLPKSGAFSVV  157



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  272  VEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEM  451
            +E++ K +  +   +KL + LD QV++GEH+A+ GS KE+G WK+   + W+EKGWV E+
Sbjct  65   IEEQRKNRDGSGGKVKLNVRLDRQVKFGEHVAMFGSAKEIGCWKEKSPLAWSEKGWVCEL  124

Query  452  ELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +V
Sbjct  125  ELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPDSGSFSVV  166



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            +++++ LDHQVE+GEH+A++GSTKELGSW+K+VMM+WT  GWV ++EL+GGE VEFKFV+
Sbjct  158  VRVRVRLDHQVEFGEHVAVLGSTKELGSWRKHVMMEWTPDGWVQDIELRGGESVEFKFVV  217

Query  494  VGK-DKNLLWETGDNRVLKLPAGGSFKMV  577
            + +  K+++WE G NRVL LP  G+F MV
Sbjct  218  LLRGKKDVVWEGGGNRVLTLPEKGAFDMV  246



>gb|ABK26307.1| unknown [Picea sitchensis]
Length=237

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = +2

Query  128  RTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSV-ETREVEKKGKEKRSA  304
            +T  G+ K S  RLI  P G   S +N          +C+ + +  T+  EK G   RS 
Sbjct  25   KTIFGR-KCSGKRLIFLPSG-GFSPLNTSFSANRGSILCSSAGIASTQRSEKMGI--RSG  80

Query  305  HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFK  484
               ++L   LDHQV +GE+ AI+GS+K LG+WKK +MM W+E GW+ ++E  GGE VE+K
Sbjct  81   EGKVQLHFRLDHQVRFGENHAILGSSKALGAWKKKLMMSWSESGWILDLETGGGEKVEYK  140

Query  485  FVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            F+IV +D  ++WE G NRVL+LP  G+F++V
Sbjct  141  FLIVSRDGKIIWEGGCNRVLELPKEGNFEIV  171



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = +2

Query  95   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  274
            + P+  I     +SL       PRL+     +  S  +   R  +SR     +S  T  +
Sbjct  10   SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTRTATSSST--I  60

Query  275  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  454
            E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61   EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  455  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            L GG+ +E KFVIV  D +L WE+GDNRVLK+P  G+F +V
Sbjct  121  LDGGQVLECKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVV  161



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = +2

Query  227  SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  394
            S R +C VSS     + +  ++    K  +   + LK+ LDHQV++GE + I+GS++ELG
Sbjct  55   SRRIVCGVSSASQETIREDEEQMMTGKLGSGGKVLLKVRLDHQVQFGESVVILGSSEELG  114

Query  395  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            SWK   +++W++ GWV ++E +G E VEFKFVI+GKD ++LWE+GDNRVL+LP  G F +
Sbjct  115  SWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVLWESGDNRVLQLPKVGKFSL  174

Query  575  V  577
            V
Sbjct  175  V  175



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 80/119 (67%), Gaps = 6/119 (5%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKE------KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            + AVSS E++  +++ +E        S    ++L++ LDHQV++G+H+AI GSTKELGSW
Sbjct  54   LSAVSSPESQTRDEQQQEGDNNPSSVSMDRKVRLQVRLDHQVQFGDHVAIRGSTKELGSW  113

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K NV + WT+ GWV  +E KG + +EFKF+ V KD  ++WE G NRVLKLP  G F  V
Sbjct  114  KTNVPLSWTKNGWVCLLEFKGTDHIEFKFITVKKDSTMVWEAGQNRVLKLPVAGHFTTV  172



>ref|XP_008799788.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=758

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 4/106 (4%)
 Frame = +2

Query  272  VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  442
            VE+  +EKR A      + +++ LDHQVE+GE +A++GSTKELG WKK V MDWT +GWV
Sbjct  58   VERVEEEKRKASGKRRRVHIRVRLDHQVEFGEQVAVLGSTKELGLWKKQVPMDWTPEGWV  117

Query  443  SEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMV  577
             E+EL GGE +E+KFVI+ K  K ++WE GDNRVLKLP  G F MV
Sbjct  118  CELELCGGEVLEYKFVILMKGRKGMIWEDGDNRVLKLPEEGMFDMV  163



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 95/163 (58%), Gaps = 14/163 (9%)
 Frame = +2

Query  92   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  271
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  272  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  448
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  449  MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +V
Sbjct  116  LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVV  158



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 95/163 (58%), Gaps = 14/163 (9%)
 Frame = +2

Query  92   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  271
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  272  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  448
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  449  MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +V
Sbjct  116  LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVV  158



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  299  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  478
            S +  ++L + L  +VE+GEH+ I+GS KELG WKK V M+WTE GWV  +EL+GGE +E
Sbjct  8    SGNGKVRLNVRLGCEVEFGEHVVILGSAKELGLWKKKVPMNWTESGWVCNVELRGGESIE  67

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            FKFV+V KD+++LWE G NR LKLP GGS+++V
Sbjct  68   FKFVVVKKDESMLWEGGGNRTLKLPKGGSYEIV  100



>gb|ABR17706.1| unknown [Picea sitchensis]
Length=328

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 8/161 (5%)
 Frame = +2

Query  107  RHIPSARRTSLGKL--KFSEPRLILEP-QGIPGSIMNRPTRGLSSRTICAVSSVET-REV  274
            RH P   + +  KL  K+SE RLI  P +G     +N       +  +C+ + + +    
Sbjct  23   RHNPDEPKVTCMKLGRKYSEKRLIFLPYEGF--RPLNTSFSANRASILCSNTGIASPHRD  80

Query  275  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  454
            EK G   R     + L   LDHQV +GEH A++GS+K  G+WKK +MM W+E  W+ ++E
Sbjct  81   EKMGI--RCGERKVNLYFKLDHQVSFGEHHAVLGSSKAFGAWKKKLMMSWSESEWILDLE  138

Query  455  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +GGE VE+KFVIV  D  ++WE G NRVL LP  G F++V
Sbjct  139  TRGGEKVEYKFVIVSGDGKIIWEGGHNRVLALPKEGRFEIV  179



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  320  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  499
            LK+ LDHQV++GE + I+GS++ELGSWK   +++W++ GWV ++E +G E VEFKFVI+G
Sbjct  14   LKVRLDHQVQFGESVVILGSSEELGSWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILG  73

Query  500  KDKNLLWETGDNRVLKLPAGGSFKMV  577
            KD ++LWE+GDNRVL+LP  G F +V
Sbjct  74   KDGSVLWESGDNRVLQLPKVGKFSLV  99



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 80/118 (68%), Gaps = 4/118 (3%)
 Frame = +2

Query  233  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            K   +++W++ GWV ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +
Sbjct  117  KNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSL  174



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = +2

Query  233  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116

Query  401  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            K   +++W++ GWV ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F + 
Sbjct  117  KNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLA  175



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 11/124 (9%)
 Frame = +2

Query  239  ICAVSS---VETREVEKKGKEK-----RSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  394
            I AVSS    +TR+ + +  E+     +S    ++L++ LDHQV++G+H+ I GSTKELG
Sbjct  52   ISAVSSSPQTQTRDDQDQEHEQEQGKNKSLKNKVRLQVRLDHQVQFGDHVVIRGSTKELG  111

Query  395  SWKKNVMMDWTEKGWVSEMELKGGE---PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGS  565
            SW  +V ++WT+ GWV ++E + G+    +EFKFV V KD  L+WE G+NRVLK+P  G+
Sbjct  112  SWTNSVPLNWTQNGWVCDLEFEQGQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGN  171

Query  566  FKMV  577
            F  V
Sbjct  172  FATV  175



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  415
            ++ A SS +T+        K+    N+ L + LDHQV++G+H+ ++GSTK+LGSW  +V 
Sbjct  63   SVAASSSTQTQP-RNNTNNKKEEDINVHLHLRLDHQVQFGDHVVLLGSTKQLGSWTTHVP  121

Query  416  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            ++WT  GWV +     G+ +EFKF+IV +D  L WE+GDNRVL LP  G F+ +
Sbjct  122  LNWTPNGWVCDFHFNAGDHLEFKFIIVHQDGTLHWESGDNRVLNLPNAGHFQTI  175



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = +2

Query  218  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
            RG S R   A S+ +     K+ K  + + + ++L++ LDHQV++GEH+ I+GSTKE+GS
Sbjct  47   RGFSCRAGSAASAAQRT---KEKKRTKPSKDRVQLRVCLDHQVKFGEHVGIIGSTKEVGS  103

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKM  574
            WK  V M+WT  GWV +++L G   +EFKFVI  K+ K  +WE GDNRV+ LP  G+F +
Sbjct  104  WKSQVEMEWTPDGWVCQLDLPGETLMEFKFVIFLKEGKEKVWEDGDNRVVNLPKDGAFDI  163

Query  575  V  577
            +
Sbjct  164  L  164



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +2

Query  284  GKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKG  463
            GK K S    ++L++ LDHQV++G+H+ I GSTKELGSW  +V ++WT+ GWV ++E + 
Sbjct  78   GKNK-SLKNKVRLQVRLDHQVQFGDHVVIRGSTKELGSWTNSVPLNWTQNGWVCDLEFEQ  136

Query  464  GE---PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            G+    +EFKFV V KD  L+WE G+NRVLK+P  G+F  V
Sbjct  137  GQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGNFATV  177



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNV  412
            + IC      T+E   K +   S   ++ L++ L HQV+YGEH+ I+GS KELG+WK++V
Sbjct  2    QLICVSVYCRTKE---KNRADPSKSGSVLLQVCLQHQVKYGEHVGIIGSAKELGAWKQHV  58

Query  413  MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMV  577
             +DW+E GWV ++EL G   VEFKFVIV K  N   WE GDNR ++LP GG+  +V
Sbjct  59   KLDWSEDGWVCQLELPGEAAVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIV  114



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 16/151 (11%)
 Frame = +2

Query  161  PR--LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHEN  313
            PR  L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    
Sbjct  17   PRRGLVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPL  74

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI
Sbjct  75   VHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVI  134

Query  494  V---GKDKNLLWETGDNRVLKLPAGGSFKMV  577
                GKDK  +WE G+NRV++LP  G F +V
Sbjct  135  FLVGGKDK--IWEDGNNRVVELPKDGKFDIV  163



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 16/151 (11%)
 Frame = +2

Query  161  PR--LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHEN  313
            PR  L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    
Sbjct  17   PRRGLVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPL  74

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI
Sbjct  75   VHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVI  134

Query  494  V---GKDKNLLWETGDNRVLKLPAGGSFKMV  577
                GKDK  +WE G+NRV++LP  G F +V
Sbjct  135  FLVGGKDK--IWEDGNNRVVELPKDGKFDIV  163



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +2

Query  254  SVETREVEKKGKEKR---SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDW  424
            +  T+ + +  +EK+   S  + ++L + LDHQV +GEH+ I+GS KELGSWK  V MDW
Sbjct  60   AASTKHITRTKEEKQTDPSKQDIVRLHVCLDHQVMFGEHVGIIGSAKELGSWKSPVEMDW  119

Query  425  TEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMV  577
            T  GWV +++L G   +EFKFV+    GKDK  +WE GDNRV+ LP  GSF M 
Sbjct  120  TPNGWVCQLDLPGETLLEFKFVVFLNRGKDK--IWEDGDNRVVNLPKNGSFDMA  171



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +2

Query  218  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  397
            RG + R   A S+ E R  EKK ++  S    + L++ L+HQV++GEH+ I+GSTKELGS
Sbjct  7    RGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGS  64

Query  398  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSF  568
            W++ V ++WT  GWV +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F
Sbjct  65   WEEQVELEWTTNGWVCQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKF  122

Query  569  KMV  577
             +V
Sbjct  123  DIV  125



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  263  TREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  442
            +R  ++K +   S   ++ L++ L+HQV+YGEH+ I+GS KELG+WK++V +DWT+ GWV
Sbjct  7    SRRTKEKSRADPSKSGSVLLQVCLEHQVKYGEHVGIIGSAKELGAWKQHVELDWTQDGWV  66

Query  443  SEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKM  574
             ++EL     VEFKFVIV K  N   WE GDNR ++LP GG+  +
Sbjct  67   CQLELPSEALVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDI  111



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 15/157 (10%)
 Frame = +2

Query  128  RTSLGKLKFSEPRLIL------EPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  289
            RT  G +    PR++       E   +PG       RG S R   A S+ E   +++K +
Sbjct  16   RTHRGLVLLPPPRVVAGAMFRREAIALPGR------RGFSCRGGSAASAAE--RIKEKQR  67

Query  290  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  469
               S    + L+++L+HQV++GEHI ++GSTKELGSWK+ V ++WT  GWV +++L G  
Sbjct  68   GDSSKKPLVHLQVYLEHQVKFGEHIGVIGSTKELGSWKEQVELEWTPDGWVCQLKLPGET  127

Query  470  PVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMV  577
             VEFKFVI  K  K+  WE G+NRV++LP  G + +V
Sbjct  128  LVEFKFVIFLKGIKDKTWEDGNNRVVELPKDGKYDIV  164



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +2

Query  242  CAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMD  421
            C  +S    E+ K   +  +    + L+++L+HQV++GEH+ ++GSTKELGSWKK+V + 
Sbjct  52   CRAASPSAAEITKD--KNTTDPSKVLLRVFLEHQVKFGEHVGVIGSTKELGSWKKHVELV  109

Query  422  WTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMV  577
            WT+ GWV ++EL     VEFKFVI+   GK K   WE G+NRV++LP GG+F +V
Sbjct  110  WTQDGWVGQLELPAETLVEFKFVIILEGGKGKT--WEDGNNRVIELPKGGTFDIV  162



>gb|EPS59827.1| glucan/water dikinase, partial [Genlisea aurea]
Length=315

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = +2

Query  266  REVEKKGKEKRSAHENL----KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEK  433
            RE E+K   K+    N+    +++  L+HQV +GEH+A++GS KELG WKK +MM+WTE 
Sbjct  1    REGEEKNLMKKERQLNVVGKVEVEFRLEHQVAFGEHVALLGSVKELGFWKKKLMMNWTEN  60

Query  434  GWVSEMELKGGEP-VEFKFVIVGKDK-NLLWETGDNRVLKLPAGG-SFKMV  577
            GW+  + L   E  VE+KF IVGKDK NL+WE+G+NR L LP  G SF +V
Sbjct  61   GWICNLNLDTSEQLVEYKFAIVGKDKQNLIWESGENRTLTLPEKGRSFSVV  111



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            +K ++ LDHQVE+GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10   VKFRLRLDHQVEFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  494  VGKDKNLLWETGDNRVLKLPAGGS  565
            V  D  L WE G NRVL +P+GGS
Sbjct  70   VAGDGRLTWEEGPNRVLDVPSGGS  93



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 7/108 (6%)
 Frame = +2

Query  269  EVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  442
            ++  K K++R + +   + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV
Sbjct  23   DILTKEKKRRDSSKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWV  82

Query  443  SEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMV  577
             +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +V
Sbjct  83   CQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIV  128



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            +KL++ LDHQV++GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10   VKLRLRLDHQVKFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  494  VGKDKNLLWETGDNRVLKLPAGGS  565
            V  D  L WE G NRVL +P+GGS
Sbjct  70   VAGDGRLTWEEGPNRVLDVPSGGS  93



>ref|XP_008662597.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Zea mays]
Length=287

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLW  520
            +GEH+ I+GSTKELGSWK  V MDWT  GWV ++++ G   +EFKFVI+   GKDK  +W
Sbjct  2    FGEHVGIIGSTKELGSWKSQVDMDWTPNGWVCQLDVPGEALLEFKFVIILNKGKDK--IW  59

Query  521  ETGDNRVLKLPAGGSFKM  574
            E GDNRV+ LP  GSF M
Sbjct  60   EDGDNRVVNLPKNGSFDM  77



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKF  487
            E +K+++ LDHQV++GE  AI+GS K +G+W++ V M WTE GWV ++E   GE VE+K 
Sbjct  11   EKVKVRVRLDHQVQFGETHAILGSAKSIGAWQEKVPMTWTEAGWVVDLEGDSGETVEYKH  70

Query  488  VIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            +IV  D  ++WE G NR + LP  G F++V
Sbjct  71   IIVTHDGGVIWEEGPNRTISLPDEGDFELV  100



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  493
            +K+++ +DHQV++GE  AI+GS++  G+W++ V + WTE GWV E+E   GE  E+K +I
Sbjct  8    VKVRLRIDHQVQFGESHAILGSSQCTGAWRERVPLQWTESGWVVELEANPGETFEYKHII  67

Query  494  VGKDKNLLWETGDNRVLKLPAGGSFKMV  577
            V    +++WE G NRVL +P  G F++V
Sbjct  68   VTHGGDVIWEGGPNRVLSVPDEGEFEVV  95



>ref|XP_010040448.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Eucalyptus grandis]
Length=147

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  263  TREVEKKGKE--KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG  436
             RE EKK K+   +   E + L + LD+QVE GE IAI GST+ELGS KKN+ MD T+ G
Sbjct  2    CREEEKKAKKIISKLGQEKMHLSVRLDYQVEIGESIAISGSTRELGSRKKNMAMDRTKSG  61

Query  437  WVSEMELKGGEPVEFKFVIV  496
            WV  ++LKGGE V+ + +I+
Sbjct  62   WVCVLKLKGGESVKLEELIL  81



>ref|XP_009778046.1| PREDICTED: uncharacterized protein LOC104227496 [Nicotiana sylvestris]
Length=440

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = +2

Query  200  IMNRPTRGLSSRTI----CA---VSSVETR---EVEKKGKEKRSAHENLKLKIWLDHQVE  349
            I+N  +  +  +T+    CA    SS +T+   + E+      +  E +++K  L+ +  
Sbjct  49   IVNVSSLSIQRKTVQPIFCAPALQSSTDTQTHTQSEESETTDTNQSEPVRVKFQLNKECT  108

Query  350  YGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+P+ +KF++ G  + +LW
Sbjct  109  FGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKPISYKFILKGDAETILW  168

Query  521  ETGDNRVLK  547
            + G +R+L+
Sbjct  169  QQGPDRILQ  177



>ref|WP_033217558.1| cyclomaltodextrin glucanotransferase, partial [Kitasatospora 
phosalacinea]
Length=98

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWK--KNVMMDWTEKG----WVSEMELKGGEPVEFKFVIVGKDKN  511
            YG+ + + G+  ELG W   K V +  T+ G    W ++++L    PVE+K++I   D  
Sbjct  14   YGQGLYLAGNLAELGGWDPAKAVPLT-TDSGSYPAWTADLQLPSDTPVEYKYLIKDPDGT  72

Query  512  LLWETGDNRVLKLPAGGSF  568
            ++WE GDNR    PA G+F
Sbjct  73   VVWEDGDNRTALTPATGTF  91



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 22/124 (18%)
 Frame = +2

Query  209  RPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKE  388
            RP RGL++  +CA                +   +++ ++  +  +V++GE + ++GS   
Sbjct  14   RPARGLAA-PVCA----------------QGGGDDVLVRFSVQREVKFGEAVRLVGSHPS  56

Query  389  LGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDK-NLLWETGDNRVLKLP  553
            LG+WK  K   M W E   WV+E+ L  G  +EFK V V G+D  +  WE GDNR L +P
Sbjct  57   LGNWKVRKAPSMGWREGHIWVAEVALPPGTALEFKCVRVKGEDGGDGRWEDGDNRSLVVP  116

Query  554  AGGS  565
            AGG+
Sbjct  117  AGGA  120



>gb|KIY94688.1| hypothetical protein MNEG_13275 [Monoraphidium neglectum]
Length=234

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = +2

Query  293  KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKG  463
            KRS    + ++ WL  +VEYG+ + + G +K LG+W   K   M W+E   W   ++L  
Sbjct  95   KRSDSGRVNVRFWLKFRVEYGQSLRVTGGSKVLGAWDLAKAPRMVWSEGDLWNVTLDLDA  154

Query  464  GEPVEFKFVIVGKDKNL--LWETGDNRVLKL  550
            G   E+K+V+VG D      W+TG N V+ L
Sbjct  155  GMVYEYKYVVVGWDGQTAAAWQTGGNGVIAL  185



>ref|XP_002956065.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
 gb|EFJ42805.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
Length=385

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  484
            +++K  L ++  YG+ + I+GS  +LGSW  N  + +DWT+   W++ +EL  G   E+K
Sbjct  28   VQVKFCLKYRTSYGQSVKIIGSHPKLGSWDINKALNLDWTDGDRWIAAVELPAGAVYEYK  87

Query  485  FVIVGKDK--NLLWETGDNRVLKL  550
            +V+V  D    L W+ G N VL L
Sbjct  88   YVLVDHDSRATLAWQGGGNSVLAL  111



>ref|XP_009587696.1| PREDICTED: uncharacterized protein LOC104085387 [Nicotiana tomentosiformis]
Length=440

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVE  478
            E +++K  L+ +  +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+ + 
Sbjct  95   EPVRVKFQLNKECTFGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKTIS  154

Query  479  FKFVIVGKDKNLLWETGDNRVLK  547
            +KF++ G  + +LW+ G +R+L+
Sbjct  155  YKFILKGDAETILWQQGPDRILQ  177



>gb|KIZ07735.1| hypothetical protein MNEG_0234 [Monoraphidium neglectum]
Length=832

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  511
            QV YG+ + ++G+   LG W   + + + W+E   W  E+EL  G  VEFK V VGKD +
Sbjct  14   QVNYGQQLRVVGNAPGLGGWDTARGLHLKWSEGHVWSGEVELDAGSHVEFKLVCVGKDSD  73

Query  512  LLWETGDNRVLKLPAGG  562
              WE G+NR +K+   G
Sbjct  74   -AWEDGNNRGIKVLGAG  89



>ref|XP_004302646.1| PREDICTED: uncharacterized protein LOC101312742 [Fragaria vesca 
subsp. vesca]
Length=500

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--  400
            + +  +SS    E+E    + + ++  + + +K  L  +  +G+   I+G    LGSW  
Sbjct  59   KPLVCLSSKTQAELETPDAQIQDSYPIKTMHVKFQLQKECSFGQQFLIVGDDPILGSWDP  118

Query  401  KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            ++ + MDW++   W  E+++  G+ ++FKF++ G   N LW+ G +R+ +
Sbjct  119  ERAIPMDWSDGNVWSVELDIPVGKSIQFKFILTGDAGNFLWQPGPDRIFQ  168



>ref|XP_001696825.1| hypothetical protein CHLREDRAFT_150073 [Chlamydomonas reinhardtii]
 gb|EDP00933.1| predicted protein [Chlamydomonas reinhardtii]
Length=323

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEF  481
            N++++  L ++  YG+ + I+GS  +LG+W  N  +++ WT+   WV+ +EL  G   E+
Sbjct  23   NVQVRFCLKYRTSYGQSVKIIGSHAKLGNWDINKALVLSWTDGDRWVATIELPAGSVYEY  82

Query  482  KFVIVGKD--KNLLWETGDNRVLKL  550
            K+V+V  D    L W+ G N VL +
Sbjct  83   KYVLVDHDGRSALAWQGGSNSVLAI  107



>ref|XP_005642714.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18170.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
Length=260

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEME--LKGGEPVE  478
            ++LK+ + +   +G+H+ I+GST+ LG W   + V M+W++   W ++ +  L+ G  +E
Sbjct  55   IRLKLAIPYHCNFGQHLCIVGSTESLGGWNIDQGVPMEWSDGDLWSADFDLPLQLGTELE  114

Query  479  FKFVIVGKDKNLLWETGDNRVLKLP  553
            +K+V+  +D ++ W+ G N  +++P
Sbjct  115  YKYVVRSEDGSVYWKPGCNLCIRIP  139



>gb|ABK25218.1| unknown [Picea sitchensis]
Length=307

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFK  484
            + +K  L+ + ++G+   ++G   + GSW  K  V ++W+E   W  E+++  G+ +E+K
Sbjct  110  VTVKFVLEKKCKFGQQFHVVGDAPQFGSWNPKAAVPLEWSEGDMWTKEVDVPVGKQIEYK  169

Query  485  FVIVGKDKNLLWETGDNRVLK  547
            F+++GK   LLW+ G NR  +
Sbjct  170  FILIGKRGELLWQPGPNRAFE  190



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  511
            QV++GE + ++G+   LGSW  KK V + WTE   W +E  +  G  VEFK V +  D  
Sbjct  37   QVDFGESVRLVGNQPFLGSWQPKKAVELRWTEGNIWKTEARVPVGTEVEFKVVKMKPDGE  96

Query  512  LLWETGDNRVL  544
            ++WE GDNR  
Sbjct  97   VIWEDGDNRTF  107



>emb|CBI30404.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  376
            S+ ++P   +SS +    + +ET E + +   K+S    + +++ L  +  YGE   I+G
Sbjct  47   SVQHKPIHPISSSSPEPQAELETAETKIQ---KKSRSNTVHVRLQLQKRCSYGEQFLIVG  103

Query  377  STKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  104  DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  163



>ref|XP_010654173.1| PREDICTED: uncharacterized protein LOC104880162 [Vitis vinifera]
Length=455

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  376
            S+ ++P   +SS +    + +ET E +    +K+S    + +++ L  +  YGE   I+G
Sbjct  48   SVQHKPIHPISSSSPEPQAELETAETKI---QKKSRSNTVHVRLQLQKRCSYGEQFLIVG  104

Query  377  STKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  105  DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  164



>ref|WP_030916433.1| hypothetical protein [Streptomyces sp. NRRL S-384]
Length=240

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (53%), Gaps = 5/78 (6%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  514
            YG+++ + G+  ELG W     +  T  G     W + ++L    P+ +K++I   D  +
Sbjct  156  YGQNLYLAGNLSELGGWDPAKAVPLTTDGTSYPVWSAGLQLPPNTPIAYKYLIKNPDGTV  215

Query  515  LWETGDNRVLKLPAGGSF  568
            +WE GDNR    PA G+F
Sbjct  216  VWEGGDNRTATTPATGTF  233



>gb|KIZ07546.1| hypothetical protein MNEG_0408 [Monoraphidium neglectum]
Length=538

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 5/89 (6%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTEKG-WVSEMELKGG-EPVE  478
            N+ ++  +  ++ +GE +A++G   ELG+W       + W+E   W  E+E+    + +E
Sbjct  176  NVDVRFSVTAELRFGEQVAVVGDAPELGAWSPEAARRLTWSEGHVWTGEVEVAAARKSLE  235

Query  479  FKFVIVGKDKNL-LWETGDNRVLKLPAGG  562
            FKF+++G+      WE G NR   LPA G
Sbjct  236  FKFIVLGESGAAERWEPGQNRAAPLPAAG  264



>ref|XP_002974170.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
 gb|EFJ25125.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
Length=371

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  502
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  503  DKNLLWETGDNRVLK  547
                 W+ G NR+ K
Sbjct  151  KAVPEWQPGPNRIFK  165



>ref|WP_030918859.1| cyclomaltodextrin glucanotransferase, partial [Streptomyces sp. 
NRRL S-384]
Length=98

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  514
            YG+++ + G   ELG W     +  T  G     W + ++L  G P+ +K++I   D  +
Sbjct  14   YGQNLYLSGDIAELGGWDPAKAVPLTTDGTSYPVWTANLQLPAGTPIAYKYLIKNPDGTV  73

Query  515  LWETGDNR  538
            +WE+GDNR
Sbjct  74   IWESGDNR  81



>ref|XP_005844056.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
 gb|EFN51954.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
Length=246

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEK-GWVSEMELKGGEPVEF  481
            ++ +   L  +  YG+ + ++GS++ELG+WK    + + W+E+  W + + L  G  VE+
Sbjct  16   SVAVSFILKKETYYGQRVLLVGSSQELGAWKLDAGLPLRWSEEHKWSTTVALPAGAAVEY  75

Query  482  KFVIVGKDKNLLWETGDNRVLKL  550
            KFVI   ++  LWE+  NR L +
Sbjct  76   KFVITDPEQPPLWESCLNRSLAV  98



>ref|XP_002968806.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
 gb|EFJ29922.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
Length=392

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  502
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  503  DKNLLWETGDNRVLK  547
                 W+ G NR+ K
Sbjct  151  KAVPEWQPGPNRIFK  165



>gb|KIZ03831.1| hypothetical protein MNEG_4121, partial [Monoraphidium neglectum]
Length=325

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 57/136 (42%), Gaps = 9/136 (7%)
 Frame = +2

Query  179  PQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGE  358
            P   P     R  R  S+R+  AV    T   +  G+    A    + +I     V +GE
Sbjct  23   PAAAPVCAAGRAPR--STRSGLAVVRFATDSAD--GEVDVDAAATARFRI--TTPVRFGE  76

Query  359  HIAIMGSTKELGSWKKNVMM--DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETG  529
            H+ ++G    LGSW  +  +   W+E   W    +L  G+ +EFKF+I        WE G
Sbjct  77   HVRVVGGAPSLGSWSPDAALKLTWSEGDKWEGAAQLPAGQDIEFKFLICPAAGAPAWEPG  136

Query  530  DNRVLKLPAGGSFKMV  577
             N    LP G    +V
Sbjct  137  ANHKAALPEGAEAVIV  152



>emb|CAN60108.1| hypothetical protein VITISV_044328 [Vitis vinifera]
Length=430

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  376
            S+ ++P   +SS +    + +ET E + +   K+S    + +++ L  +  YGE   I+G
Sbjct  23   SVQHKPIHPISSSSPEPQAELETAETKIQ---KKSRSNTVHVRLQLQKRCSYGEQFLIVG  79

Query  377  STKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  80   DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGJTGTILWQPGPDRILR  139



>gb|KJB46631.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=305

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query  257  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  430
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  431  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>ref|XP_004506775.1| PREDICTED: protein ycf2-like isoform X1 [Cicer arietinum]
Length=472

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E   +  E+ +    ++++  L    ++GE   I+G    LGSW   + + M W+
Sbjct  74   DLETVEPRVQQSEQTNESNFVRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWS  133

Query  428  EKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            +   W  E+++  G+PV++KF++ G + +++W+ G +R++
Sbjct  134  DGHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRII  173



>ref|XP_001258586.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
 gb|EAW16689.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
Length=497

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGK  502
              YGE+I I GS  +LG+W  +  +  +  G       W  +++L  G   ++KF+  G+
Sbjct  406  TSYGENIFISGSIDQLGNWDTSRAVALSASGYTSSNPVWSVKLDLYAGTYFQYKFIRKGQ  465

Query  503  DKNLLWETGDNRVLKLPAG  559
            D +++WE+G NR   LP+G
Sbjct  466  DGSVIWESGPNRSYTLPSG  484



>ref|WP_033216324.1| hypothetical protein [Kitasatospora phosalacinea]
Length=239

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  508
              YG+++ + G+  ELG W     +  +  G     W + ++L    P+E+K++I   D 
Sbjct  153  TAYGQNLYLAGNLAELGGWDPAKAVPLSTDGAHYPLWTAGLQLPPNTPIEYKYLIKNPDG  212

Query  509  NLLWETGDNRVLKLPAGGSFKM  574
             ++WE G NR    PA G+F  
Sbjct  213  TVVWENGGNRTAVTPATGTFTT  234



>ref|XP_005844815.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
 gb|EFN52713.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
Length=687

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  335  DHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKD  505
            D  +++GEH+ ++GS  E+G W  K    +DW E   WV+E+ L  GE + FK VI+  D
Sbjct  86   DCPLQFGEHLRLVGSCAEMGGWDAKSAPSLDWQEGNNWVAELALPPGEHL-FKLVIMRSD  144

Query  506  KNLLWETGDNRVL  544
                WE G+NR L
Sbjct  145  GEQQWEDGNNREL  157



>ref|XP_001702927.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96780.1| predicted protein [Chlamydomonas reinhardtii]
Length=141

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 59/120 (49%), Gaps = 9/120 (8%)
 Frame = +2

Query  227  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  406
            S+  +CA + V T  V  +   +   HE   +K  L  +V  GE   I+G   ELG  K 
Sbjct  18   STVRVCAQAQVAT--VTARPAVRSVEHE---VKFTLKQKVGLGECWKIVGMCPELGRMKP  72

Query  407  NVM--MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  577
             V   M WT    W  E +++ G   EFK V+   D + LWE G +RVL++P G S K V
Sbjct  73   EVAPYMQWTNGDVWTLEAKMRPGT-YEFKAVLRKPDGSYLWEDGKDRVLEVPFGASGKNV  131



>gb|KJB46630.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=335

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query  257  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  430
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  431  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>ref|XP_007026748.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07250.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
Length=449

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +2

Query  269  EVEKKGKEKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  430
            +V+ +  E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  
Sbjct  72   QVDFETAETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-  130

Query  431  KG--WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            KG  W  E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  131  KGHVWTVELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  171



>ref|XP_007026749.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07251.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
Length=426

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = +2

Query  290  EKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG--WVS  445
            E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  KG  W  
Sbjct  45   ETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-KGHVWTV  103

Query  446  EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  104  ELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  137



>ref|XP_006398635.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40088.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=318

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  373
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  374  GSTKELG-SWK-KNVM-MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  541
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  542  LK  547
            L+
Sbjct  170  LQ  171



>gb|KJB46629.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=276

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +2

Query  245  AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMM  418
            A   +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + +
Sbjct  12   AYGELETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPL  65

Query  419  DWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             W+E   W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  66   TWSEGHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  109



>gb|KHN47425.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=225

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  61   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  120

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  121  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  160



>ref|XP_004506776.1| PREDICTED: protein ycf2-like isoform X2 [Cicer arietinum]
Length=468

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 57/99 (58%), Gaps = 5/99 (5%)
 Frame = +2

Query  257  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  430
            V+   VE + ++  S    ++++  L    ++GE   I+G    LGSW   + + M W++
Sbjct  73   VDLETVEPRVQQNESNF--VRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWSD  130

Query  431  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
               W  E+++  G+PV++KF++ G + +++W+ G +R++
Sbjct  131  GHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRII  169



>dbj|GAM27795.1| hypothetical protein SAMD00019534_109710, partial [Acytostelium 
subglobosum LB1]
Length=128

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            K++ WL + V++G+ + + G+ ++LG+W  +K   + +++   W  E+ L     +E+K+
Sbjct  32   KIRFWLKYHVQFGQQVRVTGNCEQLGNWDPQKAFPLKFSQGDTWEGELLLGQAGRIEYKY  91

Query  488  VIVGKDKN--LLWETGDNRVLKLPAGGS  565
             I   D    L WETG NRV  L AG S
Sbjct  92   FISYYDTGDLLYWETGSNRVF-LVAGSS  118



>ref|XP_005847512.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
 gb|EFN55410.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
Length=541

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNV--MMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDKN  511
            +++GEH+ ++G+  ELG W       + W E   W  E+ L  G  V FK VIV G    
Sbjct  136  LQFGEHLRVVGNCPELGEWDAQAAPALIWHEDDVWKGELTLPSGRHVAFKLVIVRGDGVT  195

Query  512  LLWETGDNRVLKLP  553
            L WE G +R L++P
Sbjct  196  LYWEPGADRRLRVP  209



>ref|XP_005644670.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20126.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
Length=470

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 5/85 (6%)
 Frame = +2

Query  320  LKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFV  490
            +   L +   YG+ I ++GS + LGSW  ++   + WTE   W + +EL GG   E+K+V
Sbjct  197  VHFCLQYHTSYGQQIRLVGSHENLGSWQLREGPDLRWTEGDNWRATVELPGGTVYEYKYV  256

Query  491  IVG--KDKNLLWETGDNRVLKLPAG  559
            ++       L W+ G+N VL + AG
Sbjct  257  LLDSYSGHALSWQRGNNSVLAIKAG  281



>ref|XP_002963384.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
 gb|EFJ35255.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
Length=516

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  192  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  251

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V+  ++  + W+ G NRV   P
Sbjct  252  VLQCQNGWIHWQPGPNRVFSTP  273



>ref|XP_001701978.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06953.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=106

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEP---  472
            +LKL   + ++V +G+ IA++GS   LG+W  K+++ M WT+   W  E+ +  G     
Sbjct  1    SLKLNFKVGYRVNFGQTIAMIGSGDALGNWDPKRSIAMKWTDGDYWTVELNVAPGRSALD  60

Query  473  VEFKFVIVGKDKNL-LWETGDNRVLKLPAGGS  565
            +E+K+V+V  D ++  W+ G N  + LP   S
Sbjct  61   LEYKYVVVNSDGHIGYWKPGSNYKVTLPLNSS  92



>ref|XP_002974668.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
 gb|EFJ24188.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
Length=407

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  135  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  194

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V+  ++  + W+ G NRV   P
Sbjct  195  VLQCQNGWIHWQPGPNRVFSTP  216



>ref|XP_006398636.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40089.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=397

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  373
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  374  GSTKELG-SWK-KNVM-MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  541
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  542  LK  547
            L+
Sbjct  170  LQ  171



>ref|XP_002502726.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO63984.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=300

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  484
             +++  + +Q + GE + I+GS K++G W ++  + M W++ G W +++EL  G  V +K
Sbjct  112  CRVQFRIGYQTQVGEDLFIVGSHKKMGEWNQHHALPMQWSDGGNWFTDLELPAGGVVFYK  171

Query  485  FVIVGKDKNLLWETGDNRVLKLP  553
            +V+   +    W+ G N +L LP
Sbjct  172  YVVKQANGAYRWQEGANNLLVLP  194



>ref|XP_004246332.1| PREDICTED: uncharacterized protein LOC101251213 [Solanum lycopersicum]
Length=423

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 58/106 (55%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--V  412
             CA  +    + E+      + ++ +++K  L+ +  +G+H  ++G    LG W  +  V
Sbjct  59   FCASDTQIHNQSEETETTDTNQYKPVRVKFQLNKECSFGQHFYLVGDDPMLGLWDPSNAV  118

Query  413  MMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             ++W+E   W  E+++  G+ + +KF++   D+ +LW+ G +R+L+
Sbjct  119  PLEWSEGHVWNVELDIPSGKTISYKFIMTVDDETILWQQGPDRILQ  164



>gb|KHN48367.1| Alpha-amylase [Glycine soja]
Length=392

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W 
Sbjct  73   DLDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWF  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>ref|XP_006576534.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006607034.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=221

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>gb|KHG02392.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=451

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +2

Query  251  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDW  424
            S VE   VE +  EK    + + ++  L+ +  +GEH  I+G    LG W  +  V + W
Sbjct  69   SQVELETVETQ-PEKEIPSKTVNVRFQLEKECSFGEHFFIVGDHPMLGLWDPDNAVPLTW  127

Query  425  TE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            +E   W  E+++  G  ++FKF++     NLLW+   +R+ +
Sbjct  128  SEGHVWTVELDVPVGVSIQFKFILKTSTGNLLWQPDPDRIFE  169



>ref|XP_006576539.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X4 [Glycine max]
Length=221

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_003520734.1| PREDICTED: uncharacterized protein LOC100778097 [Glycine max]
Length=464

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>gb|ACU23169.1| unknown [Glycine max]
Length=464

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>gb|KHN46339.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=451

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +2

Query  257  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  430
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  431  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|XP_004183886.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
 gb|ELP84540.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
Length=131

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 3/79 (4%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTE-KGWVSEMELKGGEPVEFKFVI  493
            K +  ++++   G  +A++GS KELG W+  ++M WT    W  E+E+    P E+K+ I
Sbjct  3    KFQFNINYKTTLGCKVAVVGSCKELGEWQHGILMTWTSGNNWRCEVEIT-NVPFEYKYQI  61

Query  494  VGKDKN-LLWETGDNRVLK  547
              +  N  +WE   NR+++
Sbjct  62   TDERGNVFVWEATQNRLVQ  80



>ref|XP_006576535.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X3 [Glycine max]
 ref|XP_006607035.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=217

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>gb|KHN45754.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=523

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +2

Query  257  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  430
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  431  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|XP_003516949.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=462

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W 
Sbjct  73   DLDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWF  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>ref|XP_006366357.1| PREDICTED: uncharacterized protein LOC102586811 [Solanum tuberosum]
Length=422

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--V  412
             CA  S    + E+      +  E +++K  L+ +  +G+H  ++G    LG W  +  V
Sbjct  59   FCASDSQIHTQSEETETTDTNQSEPVRVKFQLNKECSFGQHFYLVGDDPILGLWDPSNAV  118

Query  413  MMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             ++W+E   W  E+++  G+ + +KF++   D+ +LW+ G +R+++
Sbjct  119  PLEWSEGHLWNVELDIPSGKTISYKFIMTVDDETILWQQGPDRIIQ  164



>ref|XP_007205350.1| hypothetical protein PRUPE_ppa007150mg [Prunus persica]
 gb|EMJ06549.1| hypothetical protein PRUPE_ppa007150mg [Prunus persica]
Length=380

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN-  409
            IC  S  +T E+E    + +  H  + + +K  L  +  +G+   I+G     G W  + 
Sbjct  63   ICLSSKTQT-ELEVTDDQIQETHHTKTIHVKFQLQKECSFGQQFLIVGDDPMFGLWDPSS  121

Query  410  -VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             + M+W++   W  E+++  G+ V+FKF++     N+LW+ G +R+ +
Sbjct  122  AIPMNWSDGNVWTVELDIPVGKSVQFKFILKEITGNILWQPGPDRIFQ  169



>gb|KHN36405.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=210

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|WP_030499128.1| alpha-amylase [Micromonospora purpureochromogenes]
Length=738

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            YG+++ ++G+T  LGSW     +  +      W + ++L     +E+K+V    D  + W
Sbjct  656  YGQNVFVVGNTPALGSWNPAAAVALSSAAYPVWRATVDLPANTAIEYKYVKKNPDGTVTW  715

Query  521  ETGDNRVLKLPAGGS  565
            E+G NR L  PAGG+
Sbjct  716  ESGANRTLTTPAGGT  730



>gb|EHK25059.1| glycoside hydrolase family 15 protein [Trichoderma virens Gv29-8]
Length=631

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +2

Query  347  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKD  505
            ++G+ I ++GS  ELG+W  N  +             W+  + L  GE V++K++ VG D
Sbjct  540  QFGQTIKVVGSVPELGNWSTNAAVALNAVNYASNHPLWLGSINLAAGEVVQYKYINVGSD  599

Query  506  KNLLWETGDNRVLKLPA  556
             ++ WE+  N    +PA
Sbjct  600  GSVTWESDPNHTYTVPA  616



>ref|XP_004156602.1| PREDICTED: uncharacterized LOC101213899 [Cucumis sativus]
Length=446

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/114 (22%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +2

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELG  394
            G+   + C  S  +   ++    E +   ++  +++K  L  +  +GEH  ++G     G
Sbjct  62   GIDFISSCFASYQQADTIQNDAVENQETDQSKTVRVKFQLLKECTFGEHFYVVGDDPIFG  121

Query  395  SWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            SW     + ++W +   W +E+++  G+ ++FKF++ G   N++W+ G +R  +
Sbjct  122  SWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFKFILQGITGNVVWQPGPDRTFQ  175



>ref|XP_006576537.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=291

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_004137725.1| PREDICTED: uncharacterized protein LOC101213899 [Cucumis sativus]
 gb|KGN58768.1| hypothetical protein Csa_3G731790 [Cucumis sativus]
Length=446

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/114 (22%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +2

Query  221  GLSSRTICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELG  394
            G+   + C  S  +   ++    E +   ++  +++K  L  +  +GEH  ++G     G
Sbjct  62   GIDFISSCFASYQQADTIQNDAVENQETDQSKTVRVKFQLLKECTFGEHFYVVGDDPIFG  121

Query  395  SWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            SW     + ++W +   W +E+++  G+ ++FKF++ G   N++W+ G +R  +
Sbjct  122  SWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFKFILQGITGNVVWQPGPDRTFQ  175



>ref|XP_001768545.1| predicted protein [Physcomitrella patens]
 gb|EDQ66696.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEF  481
             +K+K  L  +  +G+   ++GS  + G+W  +  V ++W+E   W +++++  G+ +E+
Sbjct  102  TVKVKFELQRECHFGQQFKVVGSDPQFGNWDPSAAVPLNWSEGHLWTADLDVPEGKKIEY  161

Query  482  KFVIVG-KDKNLLWETGDNRVLKLPAGG  562
            K+++V  +++ + W+ G N VL+  AG 
Sbjct  162  KYILVSDQEETVEWQPGSNGVLETVAGA  189



>ref|XP_652601.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL47215.2| hypothetical protein EHI_132040 [Entamoeba histolytica HM-1:IMSS]
Length=108

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWT-EKGWVSEMELKGGEPVEFKFVIVGKD-  505
            ++++   G  +A++GS KELG W+    MDWT    W  E+++K   P E+K+ I+    
Sbjct  4    INYKTTPGNSVAVVGSCKELGEWEHGAKMDWTVSNNWKIELDIKNM-PFEYKYQIIDSTG  62

Query  506  KNLLWETGDNRVL  544
            + L+WE   NR+ 
Sbjct  63   RVLIWEATQNRMF  75



>ref|WP_013286849.1| MULTISPECIES: alpha-amylase [Micromonospora]
 gb|ADL47225.1| alpha amylase catalytic region [Micromonospora aurantiaca ATCC 
27029]
 gb|ADU10176.1| alpha amylase catalytic region [Micromonospora sp. L5]
Length=734

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 3/75 (4%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            YG+++ ++G+   LG W  +  +  +      W + ++L     VE+K+V    D  ++W
Sbjct  652  YGQNVFVVGNVPALGGWNPSAAVALSPAAYPVWRATVDLPANTAVEYKYVKKNPDGTVIW  711

Query  521  ETGDNRVLKLPAGGS  565
            E+G NR    PAGG+
Sbjct  712  ESGANRTFTTPAGGT  726



>gb|EMD46465.1| starch binding domain containing protein [Entamoeba histolytica 
KU27]
 gb|EMH75373.1| starch binding domain containing protein [Entamoeba histolytica 
HM-1:IMSS-B]
 gb|EMS17073.1| starch binding domain containing protein [Entamoeba histolytica 
HM-3:IMSS]
 gb|ENY62571.1| starch binding domain containing protein [Entamoeba histolytica 
HM-1:IMSS-A]
Length=112

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWT-EKGWVSEMELKGGEPVEFKFVIVGKD-  505
            ++++   G  +A++GS KELG W+    MDWT    W  E+++K   P E+K+ I+    
Sbjct  8    INYKTTPGNSVAVVGSCKELGEWEHGAKMDWTVSNNWKIELDIKNM-PFEYKYQIIDSTG  66

Query  506  KNLLWETGDNRVL  544
            + L+WE   NR+ 
Sbjct  67   RVLIWEATQNRMF  79



>ref|XP_006576541.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=527

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + + +   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVHVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILEGEGGDIIWQPGSDRLI  172



>ref|XP_003051549.1| hypothetical protein NECHADRAFT_92513 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU45836.1| hypothetical protein NECHADRAFT_92513 [Nectria haematococca mpVI 
77-13-4]
Length=582

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 7/78 (9%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVG  499
            + EYG+ I I+GS   LGSW   K + +  +E       W + + L  G+  E+K++ V 
Sbjct  490  KTEYGDTIKIVGSIAALGSWDTTKAISLSASEYTASNPLWKTTISLTAGQAFEYKYINVK  549

Query  500  KDKNLLWETGDNRVLKLP  553
            KD +L+WE   NR   +P
Sbjct  550  KDGSLVWERDPNRSYTVP  567



>ref|XP_008243940.1| PREDICTED: uncharacterized protein LOC103342132 [Prunus mume]
Length=511

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +2

Query  239  ICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN-  409
            IC  S  +T E+E    + +  H  + + +K  L  +  +G+   I+G     G W  + 
Sbjct  60   ICLSSKTQT-ELEVTDDQIQETHHTKTIHVKFQLQKECSFGQQFLIVGDDPMFGLWDPSS  118

Query  410  -VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             + M+W++   W  E+++  G+ V+FKF++     N+LW+ G +R+ +
Sbjct  119  AIPMNWSDGNVWTVELDIPVGKSVQFKFILKEITGNILWQPGPDRIFQ  166



>gb|EQB53702.1| glycosyl hydrolase family 15 [Colletotrichum gloeosporioides 
Cg-14]
Length=437

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 41/78 (53%), Gaps = 7/78 (9%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE-------MELKGGEPVEFKFVIVGK  502
             ++G+ I I+G+T +LG+W     +  +  G+ S        +EL+ G+ +++K++ V  
Sbjct  348  TQFGQTIKIVGNTAQLGNWSPGSAISLSASGYTSANPVWSVTIELQAGQAIQYKYINVAS  407

Query  503  DKNLLWETGDNRVLKLPA  556
            D  + WE   N    +P+
Sbjct  408  DGTVTWEADPNHTYTVPS  425



>gb|KIY98013.1| hypothetical protein MNEG_9950 [Monoraphidium neglectum]
Length=254

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 6/92 (7%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKF  487
            K+   L   VE+G  +A++GS+  LG W     V ++WTE   W +E E+  G  VE+K+
Sbjct  35   KVSFTLPLHVEFGTEVALVGSSPVLGEWDATSAVPLNWTEGDVWTAEAEVPVGSSVEYKY  94

Query  488  VI-VGKDKNLL-WE-TGDNRVLKLPAGGSFKM  574
            +I V +D  +L W+ T  N VL +P  G   +
Sbjct  95   IIRVPEDGKVLEWQPTPANLVLSIPEAGPVAV  126



>ref|XP_002477993.1| alpha-amylase, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED21030.1| alpha-amylase, putative [Talaromyces stipitatus ATCC 10500]
Length=610

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  508
            YG+ + + GS  +LGSW  +  V+M  ++       W   ++L  GE  ++KF+I   D 
Sbjct  520  YGQEVYLSGSISQLGSWSTSSAVLMSASQYTSSNPLWTVTVDLPAGESFQYKFIIKNTDG  579

Query  509  NLLWETGDNRVLKLPAG  559
            ++ WE+  NR   +P G
Sbjct  580  SITWESDPNRSYTVPTG  596



>ref|XP_006576533.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=275

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|WP_034223083.1| glycosidase [Actinotalea ferrariae]
 gb|EYR64530.1| glycosidase [Actinotalea ferrariae CF5-4]
Length=573

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 57/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query  185  GIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHI  364
            G  G  +     G  + T+ A + +      K G    +      +   ++    YG+++
Sbjct  435  GCSGRSITVNASGQFTATVNANTPLALHVNAKAGASTTTPTTQTTISFGVNATTVYGQNV  494

Query  365  AIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  535
             ++G+   LGSW     +  +      W + +    G  VE+K+V V    N++WE+G N
Sbjct  495  RVVGNHPSLGSWNAAAGVPLSSAAYPVWRAGVAFPAGTRVEYKYVKVDGSGNVVWESGVN  554

Query  536  RVLKLPAGGSFKM  574
            RV   P+ G+  +
Sbjct  555  RVATAPSTGTLTL  567



>ref|XP_001270539.1| glucan 1,4-alpha-glucosidase, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW09113.1| glucan 1,4-alpha-glucosidase, putative [Aspergillus clavatus 
NRRL 1]
Length=617

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (9%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-------KNVMMDWTEKGWVSEME-LKG  463
            + + +  WL     +G+++ + G+T  LG+W         + +     + WV+ +E LK 
Sbjct  515  KRVPVTFWLTASTYWGQNVFMTGNTTALGNWNTTAGYALSSALYTEANQLWVASVEELKP  574

Query  464  GEPVEFKFVIVGKDKNLLWETGDNRVLKLPAG  559
            GE +E++F  V  D+++ WE+   RV  +P G
Sbjct  575  GETIEYRFYKVEPDRSITWESTKKRVYTVPTG  606



>ref|XP_003060950.1| carbohydrate-binding module family 20 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH54600.1| carbohydrate-binding module family 20 protein [Micromonas pusilla 
CCMP1545]
Length=451

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (49%), Gaps = 21/96 (22%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWK---------KNVMMDWTEK--GWVSEMELKGGEPVEFKFVIV  496
            +GE + + GS +ELG W          K  + D TE    W   ++++ G   +FKFV+V
Sbjct  329  FGESVRVCGSLRELGEWNAYEAPDMVYKKTVGDPTEGVGTWDVTLQIQQGSEFKFKFVVV  388

Query  497  G----------KDKNLLWETGDNRVLKLPAGGSFKM  574
            G          +  N+ W+ GD+R+++LP    F +
Sbjct  389  GGLDEEERSRGQQPNMYWQEGDDRMVRLPKDNVFSL  424



>ref|XP_004538448.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Maylandia 
zebra]
 ref|XP_004538449.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Maylandia 
zebra]
Length=835

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  299  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  469
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  E G W + + L    
Sbjct  737  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAEDGNWATVVSLPAES  793

Query  470  PVEFKFVIVGKDKNLLWETGDNRVL  544
             VE+KFV++ K +   WE   NR+L
Sbjct  794  IVEWKFVVMDKGEVCRWEECGNRLL  818



>ref|WP_030461968.1| hypothetical protein [Kitasatospora sp. NRRL B-11411]
Length=239

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  514
            YG+++ + G   ELG W     +  T        W + ++L    P+ +K+++   D ++
Sbjct  155  YGQNLYLAGDLAELGGWDPAKAVPLTTGSGSYPVWSAGLQLPPNTPIAYKYLLKNPDGSV  214

Query  515  LWETGDNRVLKLPAGGSF  568
            +WE+GDNR    P  G+F
Sbjct  215  VWESGDNRTATTPPTGTF  232



>ref|XP_006848182.1| hypothetical protein AMTR_s00029p00236780 [Amborella trichopoda]
 gb|ERN09763.1| hypothetical protein AMTR_s00029p00236780 [Amborella trichopoda]
Length=386

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +2

Query  203  MNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGST  382
            ++R +  +S + +C+  S  + E E        +   + ++  L  +  +G+   I+G  
Sbjct  44   IHRLSIHVSQKLMCSSVSC-SSEPEVNVDPVAPSQSAVHVRFILQKECMFGQQFFIVGEH  102

Query  383  KELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
              LGSW     ++MDW++   W +++E+  G  + +KF++ GK   + W+ G +RV+K
Sbjct  103  PSLGSWDPTAALLMDWSDGHVWTTDLEVPAGTTLLYKFILKGKLGEIEWQPGPDRVVK  160



>ref|WP_022110961.1| 4-alpha-glucanotransferase [Prevotella sp. CAG:604]
 emb|CDA54651.1| 4-alpha-glucanotransferase [Prevotella sp. CAG:604]
Length=890

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELK--GGEPVEFKFVIVGKD  505
            Q+  GE +A++GS   LG+W KN  +   ++    W  ++ ++      +EFKFV + + 
Sbjct  136  QLREGERLAVVGSDPALGAWDKNHALPMVQQAYNEWTVDINVETLAVNYLEFKFVALNEK  195

Query  506  KNLLWETGDNRVLKLP  553
            K  LWETG NR +++P
Sbjct  196  KECLWETGYNRSIEIP  211



>gb|KGO46641.1| Glycoside hydrolase, family 13 [Penicillium expansum]
 gb|KGO53522.1| Glycoside hydrolase, family 13 [Penicillium expansum]
 gb|KGO70887.1| Glycoside hydrolase, family 13 [Penicillium expansum]
Length=392

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 39/81 (48%), Gaps = 7/81 (9%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNVMM-----DWTEKG--WVSEMELKGGEPVEFKFVIVGK  502
              YG++I + GS  +LGSW  +  +      +T     W + + L  G   E+KF   G 
Sbjct  301  TSYGQNIFVTGSISQLGSWSTSSAIALSAGSYTSSNPLWTASISLPAGTTFEYKFFKKGS  360

Query  503  DKNLLWETGDNRVLKLPAGGS  565
            D ++ WE+  NR   +P G S
Sbjct  361  DGSITWESDPNRSYTVPTGCS  381



>gb|KDP24469.1| hypothetical protein JCGZ_25033 [Jatropha curcas]
Length=461

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +2

Query  92   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  271
            Y Y +R   S R    G     +  + L  +G+      RP    S  T    + +ET E
Sbjct  24   YCY-WREFNSIRYAKNGFFPSKKLLICLRQKGL------RPIYASSFSTKSQQTDLETVE  76

Query  272  VEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWV  442
             + +  ++      + +K+ L  +  +GE  A++G+    G W  +  + ++W++   W 
Sbjct  77   TQNQETDQSKT---VHVKVQLKKECSFGEQFAMVGNDPIFGVWDPENAIPLNWSDGHVWT  133

Query  443  SEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
             ++++  G+ +EFKF++      +LW+ G +R+LK
Sbjct  134  LDLDIPIGKSIEFKFILKQITGEVLWQPGPDRILK  168



>ref|XP_009344720.1| PREDICTED: uncharacterized protein LOC103936600 isoform X2 [Pyrus 
x bretschneideri]
Length=826

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 58/119 (49%), Gaps = 5/119 (4%)
 Frame = +2

Query  206  NRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGS  379
            N P      R I  +SS    E+E    + +  H  + +++K+ L  +  +G+   I+G 
Sbjct  383  NMPESKPVIRPIICLSSKTQTELEIADSQIQETHHTKTIRVKLQLQKECSFGQEFLIVGD  442

Query  380  TKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
                G W     + M+W++   W  E+++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  443  DPMFGLWDPASAIPMNWSDGNVWTVELDIPVGKSIQFKFILKEHTGNISWQPGPDRIFQ  501


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  403
            R I  +SS    E+E    + +  H  + + +K  L  +  +G+   I+G     G W  
Sbjct  58   RPIICLSSKTQTELEIADSQIQETHHTKTIHVKFQLQKECSFGQEFLIVGDDPMFGLWDP  117

Query  404  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + M+W++   W  E+++  G+ ++FKF++  +  N+ W+ G +R+ +
Sbjct  118  ASAIPMNWSDGNLWTVELDIPVGKSIQFKFILKERTGNISWQPGPDRIFQ  167



>ref|XP_003564648.1| PREDICTED: uncharacterized protein LOC100835703 isoform X2 [Brachypodium 
distachyon]
Length=339

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVE  478
            + +++K  L  Q  +G+   ++G    LG W   K  ++DW+E   W ++ +L   + +E
Sbjct  89   KTVQVKFVLQKQCAFGQQFIVVGDDPALGLWDPTKATVLDWSEGHVWTAKKDLPASKSIE  148

Query  479  FKFVIVGKDKNLLWETGDNRVLKL  550
            FKF++      + W+ G NR L++
Sbjct  149  FKFLLRDPSGQVCWQHGCNRTLQI  172



>ref|XP_010232573.1| PREDICTED: uncharacterized protein LOC100835703 isoform X1 [Brachypodium 
distachyon]
Length=343

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVE  478
            + +++K  L  Q  +G+   ++G    LG W   K  ++DW+E   W ++ +L   + +E
Sbjct  93   KTVQVKFVLQKQCAFGQQFIVVGDDPALGLWDPTKATVLDWSEGHVWTAKKDLPASKSIE  152

Query  479  FKFVIVGKDKNLLWETGDNRVLKL  550
            FKF++      + W+ G NR L++
Sbjct  153  FKFLLRDPSGQVCWQHGCNRTLQI  176



>ref|XP_009344719.1| PREDICTED: uncharacterized protein LOC103936600 isoform X1 [Pyrus 
x bretschneideri]
Length=842

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 56/110 (51%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  403
            R I  +SS    E+E    + +  H  + +++K+ L  +  +G+   I+G     G W  
Sbjct  408  RPIICLSSKTQTELEIADSQIQETHHTKTIRVKLQLQKECSFGQEFLIVGDDPMFGLWDP  467

Query  404  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + M+W++   W  E+++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  468  ASAIPMNWSDGNVWTVELDIPVGKSIQFKFILKEHTGNISWQPGPDRIFQ  517


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  403
            R I  +SS    E+E    + +  H  + + +K  L  +  +G+   I+G     G W  
Sbjct  58   RPIICLSSKTQTELEIADSQIQETHHTKTIHVKFQLQKECSFGQEFLIVGDDPMFGLWDP  117

Query  404  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + M+W++   W  E+++  G+ ++FKF++  +  N+ W+ G +R+ +
Sbjct  118  ASAIPMNWSDGNLWTVELDIPVGKSIQFKFILKERTGNISWQPGPDRIFQ  167



>ref|XP_010543884.1| PREDICTED: uncharacterized protein LOC104816652 [Tarenaya hassleriana]
Length=401

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKN  511
            +  +GEH  I+G     G W  +  + ++W++   W  +++L  G+ +EFKF++ GK   
Sbjct  80   ECAFGEHFFILGDDPVFGLWDPENAIPLNWSDGHVWTVDLDLPVGKSIEFKFILKGKTGI  139

Query  512  LLWETGDNRVLK  547
            +LW+ G NRV +
Sbjct  140  ILWQPGQNRVFE  151



>ref|WP_030158763.1| hypothetical protein [Glycomyces sp. NRRL B-16210]
Length=610

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 35/73 (48%), Gaps = 3/73 (4%)
 Frame = +2

Query  353  GEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLWE  523
            G+ + ++GS  ELGSW        +      W   +EL  G   E+K+V V  D  L WE
Sbjct  525  GQEVHLIGSIGELGSWNAANAPKLSADDYPVWRGTVELPAGTAFEYKYVKVAPDGALEWE  584

Query  524  TGDNRVLKLPAGG  562
            +G NR    PA G
Sbjct  585  SGGNRTFTAPASG  597



>ref|WP_029664274.1| glycosidase [Cellulomonas sp. KRMCY2]
Length=571

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (49%), Gaps = 3/84 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGK  502
            +D    +G+ + ++GS   LGSW     +  +  G   W   + L  G  V +K+V V  
Sbjct  482  VDAGTTWGQSVRVVGSVAALGSWSPAAGVPLSAAGYPVWRGSVNLPAGSTVAYKYVKVDA  541

Query  503  DKNLLWETGDNRVLKLPAGGSFKM  574
              N++WE+G +R + +P  G   +
Sbjct  542  AGNVVWESGSDRTVTVPVSGVLTL  565



>ref|XP_004366717.1| kin17-like protein [Dictyostelium fasciculatum]
 gb|EGG19084.1| kin17-like protein [Dictyostelium fasciculatum]
Length=695

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            K++ WL H V +G+ I + GS  +LG+W  +K+  + +++   W  E+ L     +E+K+
Sbjct  599  KVRFWLKHHVPFGQQIRVTGSCDQLGNWDPQKSFPLKFSQGDTWEGEIILGQAGRIEYKY  658

Query  488  VIVGKDKNLL--WETGDNRVLKLPAGGSFK  571
             I   D   L  WE G NRV  + +  +++
Sbjct  659  FISYYDTGELVYWEGGPNRVFLVSSNSNYR  688



>ref|WP_028596875.1| alpha-amylase [Paenibacillus pasadenensis]
Length=760

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (47%), Gaps = 4/79 (5%)
 Frame = +2

Query  353  GEHIAIMGSTKELGSW----KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            G++I ++GS  ELGSW        MM+     W   + +  G   +FKFV      N++W
Sbjct  677  GQNIHLVGSIAELGSWDAAKSTEAMMNPNYPVWFLPVSVPKGATFQFKFVKKDASGNVVW  736

Query  521  ETGDNRVLKLPAGGSFKMV  577
            E G NR    P  GS   V
Sbjct  737  EGGSNRTFTAPTSGSADTV  755



>dbj|GAM42477.1| alpha-amylase [Talaromyces cellulolyticus]
Length=609

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 7/77 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  508
            YG+ + + GS  +LGSW  +  V++   +       W   + L  GE  ++KF+IV  D 
Sbjct  520  YGQEVYLTGSISQLGSWSTSSAVLLSAAQYTSSDPLWTVTVNLPAGESFQYKFIIVNSDG  579

Query  509  NLLWETGDNRVLKLPAG  559
             + WE+  NR   +P G
Sbjct  580  TVEWESDPNRSYTVPTG  596



>ref|XP_002145753.1| alpha-amylase, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA25206.1| alpha-amylase, putative [Talaromyces marneffei ATCC 18224]
 gb|KFX41751.1| Acid alpha-amylase [Talaromyces marneffei PM1]
Length=608

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  508
            YG+ + ++GS   LGSW  +  V++  ++       W   + L  GE  ++KF++V  D 
Sbjct  519  YGQKVYLVGSISALGSWSASSAVLLSASQYTASDPVWTGTVNLPAGESFQYKFIVVNTDG  578

Query  509  NLLWETGDNRVLKLPAG  559
            ++ WE+  NR   +P G
Sbjct  579  SVKWESDPNRSYTVPTG  595



>ref|WP_012749393.1| alpha-amylase [Geobacillus sp. WCH70]
 gb|ACS23592.1| alpha amylase catalytic region [Geobacillus sp. WCH70]
Length=767

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKN----VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  517
            +GE+I ++G+  ELGSW  N     M++     W   + +  G   EFKF+    + N++
Sbjct  680  WGENIYVVGNIPELGSWDPNQSSEAMLNPNYPEWFLPVSVPKGATFEFKFIKKDNNGNVI  739

Query  518  WETGDNRVLKLP  553
            WE+  NRV   P
Sbjct  740  WESRSNRVFTAP  751



>ref|XP_001273135.1| Glycosyl hydrolase, family 15, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW11709.1| Glycosyl hydrolase, family 15, putative [Aspergillus clavatus 
NRRL 1]
Length=642

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSW--KKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  508
            YGE I I+GS  ELGSW   K V +  T+       W   ++L  G+  E+K++    + 
Sbjct  553  YGETILIVGSIPELGSWDATKAVALSATKYSASNPLWFVTIDLPAGKSFEYKYIRKQTNG  612

Query  509  NLLWETGDNRVLKLPA  556
            N+ WE+  NR  K+PA
Sbjct  613  NVKWESNPNRSYKVPA  628



>ref|WP_026447047.1| hypothetical protein [Acidobacteriaceae bacterium URHE0068]
Length=708

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 6/77 (8%)
 Frame = +2

Query  353  GEHIAIMGSTKELGSWKKNV------MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  514
            G++I + GST ELG+W          M+      W   + L  G+ V+FKF+ +  + N+
Sbjct  623  GDYIFVTGSTVELGNWATTFQTAVGPMLAPDYPNWFLNVALPAGQAVQFKFIDIQSNGNV  682

Query  515  LWETGDNRVLKLPAGGS  565
            +WE G N    +P  G+
Sbjct  683  VWENGPNHSYIVPTSGT  699



>ref|WP_030583847.1| hypothetical protein [Streptomyces sclerotialus]
Length=141

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/77 (26%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = +2

Query  347  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLL  517
            ++G+ + + G+  ELGSW  +  +  +      W + + L     VE+K+++   +  ++
Sbjct  57   QWGQQVYVTGNRPELGSWNPDKAVPLSSASYPTWSATVVLPANTGVEYKYIVKAANTPVV  116

Query  518  WETGDNRVLKLPAGGSF  568
            WETG NR    P  G++
Sbjct  117  WETGPNRTTITPPTGTY  133



>ref|XP_002584589.1| glucoamylase [Uncinocarpus reesii 1704]
 gb|EEP80436.1| glucoamylase [Uncinocarpus reesii 1704]
Length=617

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 7/78 (9%)
 Frame = +2

Query  341  QVEYGEHIAIMGSTKELGSWKKN----VMMDWTEKG---WVSEMELKGGEPVEFKFVIVG  499
            + ++GE+I I+GS  ELGSW       +  D  E     W ++++L  G  VE+K++   
Sbjct  525  ETKWGENIFIVGSVAELGSWNPEAATPLRADKYEDSCHMWYAQVDLPAGARVEYKYIRKS  584

Query  500  KDKNLLWETGDNRVLKLP  553
             D  ++WE+  NR  K+P
Sbjct  585  GDGKVVWESDPNRSYKIP  602



>ref|WP_007544893.1| cyclomaltodextrin glucanotransferase [Haloferax larsenii]
 gb|ELZ74804.1| cyclomaltodextrin glucanotransferase [Haloferax larsenii JCM 
13917]
Length=713

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 11/82 (13%)
 Frame = +2

Query  335  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  487
            D   + GE++ ++G+  ELG+W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDMGENVYVVGNVHELGNWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V +  D  + WE+G NR    P
Sbjct  680  VKIADDGTVTWESGSNRTYTTP  701



>ref|XP_010037714.1| PREDICTED: uncharacterized protein LOC104426382 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  484
            + ++  +  + ++GE   ++G    LGSW  +  V +DW++   W  E+++  G  ++FK
Sbjct  96   VHVRFQVQRECQFGEQFLVIGDDPALGSWDPSSAVPLDWSDGHIWSVELDIPIGRDIQFK  155

Query  485  FVIVGKDKNLLWETGDNRVLKL  550
            F++  +D  + W+   +R+L++
Sbjct  156  FILRQRDGEIQWQPDPDRILQI  177



>ref|XP_011399502.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26564.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=287

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            ++   L  + ++G+ + I+GS + LG+W+      M WT    WV+E++L  G   E+KF
Sbjct  27   RVHFTLCFRTDWGQRLRIVGSQEGLGNWRLADGHNMKWTTGDNWVAEVDLPTGTVYEYKF  86

Query  488  VIV--GKDKNLLWETGDNRVLKL  550
            V+V       L W++G+N VL L
Sbjct  87   VVVDHASGHALAWQSGNNSVLAL  109



>ref|XP_009377794.1| PREDICTED: uncharacterized protein LOC103966354 [Pyrus x bretschneideri]
Length=497

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 10/118 (8%)
 Frame = +2

Query  209  RPTRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGST  382
            +P R L    IC  S  +T E+E    + + A+  + + +K  L  +  +G+   I+G  
Sbjct  55   KPIRPL----ICLSSKTQT-ELEVADSQMQEAYHTKTIHVKFQLQKECSFGQEFLIVGDD  109

Query  383  KELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               G W     + M+W++   W  EM++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  110  PMFGLWDPASAIPMNWSDGNVWTVEMDIPVGKSIQFKFILKESTGNISWQPGPDRIFQ  167



>ref|XP_002951018.1| hypothetical protein VOLCADRAFT_91596 [Volvox carteri f. nagariensis]
 gb|EFJ47912.1| hypothetical protein VOLCADRAFT_91596 [Volvox carteri f. nagariensis]
Length=561

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 7/88 (8%)
 Frame = +2

Query  287  KEKRSAHENLKLKIWLDH--QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEM  451
            K KR AH + ++ + L +     +GE  A++GS  ELGSW   + V M WT    WV+ +
Sbjct  114  KFKRGAHRS-QVPVILKYGKHCNFGEAYAVVGSVSELGSWDPARAVKMRWTPGDVWVAHV  172

Query  452  ELKGGEPVEFKFVIVGKDKNLL-WETGD  532
            +L     V++K+V + KD  L+ WE  D
Sbjct  173  QLPVDTEVQYKYVRINKDGALVAWEGAD  200



>ref|XP_001209972.1| hypothetical protein ATEG_07286 [Aspergillus terreus NIH2624]
 gb|EAU32670.1| hypothetical protein ATEG_07286 [Aspergillus terreus NIH2624]
Length=400

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (52%), Gaps = 7/79 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  508
            +GE++ + GS  +LGSW  +  +  +  G       W + ++L  G   E+KF+    D 
Sbjct  311  WGENVFVTGSISQLGSWSTDKAVALSATGYTASNPLWTTTIDLPAGTTFEYKFIKKETDG  370

Query  509  NLLWETGDNRVLKLPAGGS  565
            +++WE+  NR   +P G S
Sbjct  371  SIIWESDPNRSYTVPTGCS  389



>gb|KDO36025.1| hypothetical protein CISIN_1g012471mg [Citrus sinensis]
Length=463

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 61/110 (55%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  406
            + + A+SS + +   + G +  +A+E+  + +K  L  +  +GE   ++G    LG W  
Sbjct  61   QPVSALSSSDGQAEVETGAQTLAAYESKTVHVKFQLQKECLFGEQFFLVGDDPMLGLWDP  120

Query  407  N--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + +DW++   W +E+++  G+ +++KF++ GK   ++W+ G +R  +
Sbjct  121  TSAIPLDWSDGHIWTAEIDVPVGKTIQYKFILRGKTGQIVWQPGPDRSFQ  170



>ref|XP_008370075.1| PREDICTED: uncharacterized protein LOC103433588 [Malus domestica]
Length=497

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  403
            R +  +SS    E+E    + + A+  + + +K  L  +  +G+   I+G     G W  
Sbjct  58   RPVICLSSKTQTELEVADSQMQEAYHTKTIHVKFQLQKECSFGQEFLIVGDDPMFGLWDP  117

Query  404  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + M+W++   W  EM++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  118  ASAIPMNWSDGNVWTVEMDIPVGKSIQFKFILKESTGNISWQPGPDRIFQ  167



>ref|WP_008323077.1| cyclomaltodextrin glucanotransferase [Haloferax elongans]
 gb|ELZ87682.1| cyclomaltodextrin glucanotransferase [Haloferax elongans ATCC 
BAA-1513]
Length=713

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 11/82 (13%)
 Frame = +2

Query  335  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  487
            D   + GE++ ++G+  ELG+W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDMGENVYVVGNVHELGNWDPDRAVGPFFNQVVHEYPN--WYYDVNLPAGADIEFKF  679

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V +  D  + WE+G NR    P
Sbjct  680  VKIADDGTVTWESGSNRTYTTP  701



>ref|WP_009163304.1| putative 4-alpha-glucanotransferase [Prevotella saccharolytica]
 gb|EKX98401.1| putative 4-alpha-glucanotransferase [Prevotella saccharolytica 
F0055]
Length=913

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 7/105 (7%)
 Frame = +2

Query  260  ETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTE---  430
            +T       K   +A+E     I    Q+   + + ++G+   LG+W  +  +D TE   
Sbjct  131  KTEHAHTGSKHNTAAYEKTLRLIVSAPQLRSEQRLVVVGNDLALGAWTLSRAIDMTEVSL  190

Query  431  KGWVSEMELK--GGEPVEFKFVIVGKDKNL--LWETGDNRVLKLP  553
              W  ++++    G  +E KFV V  DK+   LWETG NR+L+LP
Sbjct  191  NEWAVDLDIDRFSGHRIELKFVAVSADKHTAPLWETGYNRILELP  235



>ref|WP_013150819.1| alpha-amylase [Thermoanaerobacter mathranii]
 gb|ADH61639.1| alpha amylase catalytic region [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
Length=757

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +2

Query  347  EYGEHIAIMGSTKELGSWKKNV----MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  514
            E+G++I I+G+  ELG+W   +    MM      W   + +  G   EFKF+    + N+
Sbjct  669  EWGQNIHIVGNLPELGNWDPTLSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKDSNGNV  728

Query  515  LWETGDNRVLKLP  553
            +WE+G+NR+   P
Sbjct  729  IWESGENRIFTSP  741



>ref|XP_010037713.1| PREDICTED: uncharacterized protein LOC104426382 isoform X1 [Eucalyptus 
grandis]
 gb|KCW49465.1| hypothetical protein EUGRSUZ_K02988 [Eucalyptus grandis]
 gb|KCW49466.1| hypothetical protein EUGRSUZ_K02988 [Eucalyptus grandis]
Length=457

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  484
            + ++  +  + ++GE   ++G    LGSW  +  V +DW++   W  E+++  G  ++FK
Sbjct  96   VHVRFQVQRECQFGEQFLVIGDDPALGSWDPSSAVPLDWSDGHIWSVELDIPIGRDIQFK  155

Query  485  FVIVGKDKNLLWETGDNRVLKL  550
            F++  +D  + W+   +R+L++
Sbjct  156  FILRQRDGEIQWQPDPDRILQI  177



>ref|XP_001270422.1| starch binding domain protein [Aspergillus clavatus NRRL 1]
 gb|EAW08996.1| starch binding domain protein [Aspergillus clavatus NRRL 1]
Length=385

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 7/81 (9%)
 Frame = +2

Query  344  VEYGEHIAIMGSTKELGSWKKNVMM-----DWTEKG--WVSEMELKGGEPVEFKFVIVGK  502
              YGE+I ++GS  +LGSW  +  +      +T     W   ++L  G   E+KF+   K
Sbjct  294  TNYGENIFLVGSISQLGSWSTSSAVPLSATQYTSSNPLWTVTVQLPAGATFEYKFIRKQK  353

Query  503  DKNLLWETGDNRVLKLPAGGS  565
            D +++WE+  NR    P G S
Sbjct  354  DGSVIWESNPNRSYTTPNGCS  374



>ref|WP_028991976.1| alpha-amylase [Thermoanaerobacter thermocopriae]
Length=757

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +2

Query  347  EYGEHIAIMGSTKELGSWKKNV----MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  514
            E+G++I I+G+  ELG+W   +    MM      W   + +  G   EFKF+    + N+
Sbjct  669  EWGQNIHIVGNLPELGNWDPTLSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKDSNGNV  728

Query  515  LWETGDNRVLKLP  553
            +WE+G+NR+   P
Sbjct  729  IWESGENRIFTSP  741



>ref|XP_002502720.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO63978.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=291

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +2

Query  311  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEF  481
            ++K+   L +  + GE + I+GS + LG+W +N  V M WTE   W  EM+L  G    +
Sbjct  112  DMKVCFSLHYVTKPGEDLFIIGSDERLGNWDQNQGVAMTWTEGNVWKCEMDLPAGGVFFY  171

Query  482  KFVIVGKDKNLLWETGDNRVLKLP  553
            K+++        W+ G N +L LP
Sbjct  172  KYLVKLPGNGFKWQDGANNLLVLP  195



>ref|XP_009344721.1| PREDICTED: uncharacterized protein LOC103936600 isoform X3 [Pyrus 
x bretschneideri]
Length=810

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  403
            R I  +SS    E+E    + +  H  + + +K  L  +  +G+   I+G     G W  
Sbjct  58   RPIICLSSKTQTELEIADSQIQETHHTKTIHVKFQLQKECSFGQEFLIVGDDPMFGLWDP  117

Query  404  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
               + M+W++   W  E+++  G+ ++FKF++  +  N+ W+ G +R+ +
Sbjct  118  ASAIPMNWSDGNLWTVELDIPVGKSIQFKFILKERTGNISWQPGPDRIFQ  167



>ref|WP_022874232.1| glycosidase [Arthrobacter sp. PAO19]
Length=572

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  478
            +   +++ +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVRVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            +K+V   +  N  WE+G NR+  + A GS  +
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNL  566



>ref|XP_001696233.1| hypothetical protein CHLREDRAFT_182288 [Chlamydomonas reinhardtii]
 gb|EDP08210.1| predicted protein [Chlamydomonas reinhardtii]
Length=331

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 6/84 (7%)
 Frame = +2

Query  296  RSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGG  466
            R++  ++  KI     VEYG+ + ++G   ELG+W   K V ++W+E   W +++ L  G
Sbjct  24   RASSVDVTFKI--HRHVEYGQSLLLVGGPAELGNWDGTKAVPLEWSEGDNWTAKVSLPAG  81

Query  467  EPVEFKFVIVGKDKNLLWETGDNR  538
               E+K++I  KD +L W  G N+
Sbjct  82   ASAEYKYIIKRKD-SLDWCPGQNK  104



>ref|XP_011077571.1| PREDICTED: uncharacterized protein LOC105161548 [Sesamum indicum]
Length=475

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 61/112 (54%), Gaps = 7/112 (6%)
 Frame = +2

Query  233  RTICAVSSVETREVEKKGKEKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW  400
            + +  +S+V + +   + +E ++ H +    + ++  L  +  +G+   ++G    LG W
Sbjct  59   KDVHPISAVSSAQANAETEEIQTMHSDQLKTVNIRFKLQKKCAFGQQFLVVGDDPVLGLW  118

Query  401  KKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
              +  V ++W++   W++++E+  G+ + +KF++ G    L W+ G +RVL+
Sbjct  119  DTSDAVPLNWSDGHVWIADIEIPNGKALTYKFILKGDTGTLSWQPGPDRVLE  170



>gb|EEH40712.2| glucoamylase [Paracoccidioides sp. 'lutzii' Pb01]
Length=648

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 39/77 (51%), Gaps = 7/77 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  508
            +G+ I ++GS  ELGSW     +  +          W   + L  G+  E+K++    D 
Sbjct  541  FGQMILLVGSIPELGSWAPGSAIALSADQYSDANHLWYKTITLSAGQKFEYKYIRQETDG  600

Query  509  NLLWETGDNRVLKLPAG  559
            N++WE+G NR+  +P G
Sbjct  601  NIVWESGSNRLYTVPRG  617



>ref|WP_012269126.1| MULTISPECIES: alpha-amylase [Thermoanaerobacter]
 gb|ABY94335.1| alpha amylase, catalytic region [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 gb|ADV79284.1| alpha amylase catalytic region [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
Length=757

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSW----KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  499
            ++   E+G++I I+G+  ELG W        MM      W   + +  G   EFKF+   
Sbjct  664  VNASTEWGQNIHIVGNLPELGGWDPAMSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKD  723

Query  500  KDKNLLWETGDNRVLKLP  553
             + N++WE+G+NR+   P
Sbjct  724  SNGNVIWESGENRIFTSP  741



>ref|XP_002873018.1| glycoside hydrolase starch-binding domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH49277.1| glycoside hydrolase starch-binding domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=387

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 53/103 (51%), Gaps = 4/103 (4%)
 Frame = +2

Query  251  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS-WKKNVMM--D  421
            SS++  +V  +  +  +  + ++++  L  +  +GEH  I+G     G  W     +  +
Sbjct  68   SSIKDSQVNVEASDIEAHRKTVRVRFQLRKECVFGEHFFILGDDPVFGGLWDPETALPLN  127

Query  422  WTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            W++   W  +++L  G  VEFKF++  +   +LW+ G NR L+
Sbjct  128  WSDGNVWTVDLDLPVGRLVEFKFILKAQTGEILWQPGPNRALE  170



>ref|XP_008081828.1| Six-hairpin glycosidase [Glarea lozoyensis ATCC 20868]
 gb|EPE30417.1| Six-hairpin glycosidase [Glarea lozoyensis ATCC 20868]
Length=683

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  508
            YG+ I ++GS   LG+W     +  +          W   + L  G  VE+K++ V  D 
Sbjct  585  YGQTIKLVGSVAALGNWAPANAITLSAAQYTASNPLWFGTVGLPAGTRVEYKYINVAADG  644

Query  509  NLLWETGDNRVLKLPAGGS  565
            ++ WE G NRV  +PA G+
Sbjct  645  SVTWEGGANRVYTVPASGT  663



>gb|KFY83798.1| hypothetical protein V500_09893 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=924

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +2

Query  353  GEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDKN  511
            G+ I I+GS  +LGSW     +  +  G       W   ++L  G  VE+KF+ V  D  
Sbjct  591  GQTIKIVGSVAKLGSWNPASAVALSASGYTDSNPLWSISVDLPAGTKVEYKFINVASDGT  650

Query  512  LLWETGDNRVLKLP  553
            + WE+G NR   +P
Sbjct  651  VTWESGPNRQYTVP  664



>ref|XP_008442436.1| PREDICTED: uncharacterized protein LOC103486305 isoform X2 [Cucumis 
melo]
Length=412

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +2

Query  239  ICAVSSVETREVEKKG---KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--  403
            I   SS +  ++ +      ++    + +++K  L  +  +GEH  ++G     GSW   
Sbjct  68   ISCFSSYQQADINQSDALENQETDQSKTVRVKFQLQKECTFGEHFFVVGDDPIFGSWDVT  127

Query  404  KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
              + ++W +   W +E+++  G+ ++FKF++ G   N+ W+ G +R  +
Sbjct  128  SAIPLNWADGHQWAAEVDIPVGKIIQFKFILQGITGNVEWQPGPDRTFQ  176



>ref|XP_006795663.1| PREDICTED: dentin sialophosphoprotein-like [Neolamprologus brichardi]
Length=839

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  338  HQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDK  508
            H + +  H  +AI GS +ELG+WKK ++++  + G W + + L     VE+KFV++ K +
Sbjct  751  HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAESIVEWKFVVMDKGE  810

Query  509  NLLWETGDNRVL  544
               WE   NR+L
Sbjct  811  VCRWEECGNRLL  822



>ref|XP_006576538.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X3 [Glycine max]
Length=221

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+   +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPRLDRLI  172



>ref|XP_005729253.1| PREDICTED: uncharacterized protein LOC102200471 [Pundamilia nyererei]
Length=829

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  299  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  469
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  + G W + + L    
Sbjct  731  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAES  787

Query  470  PVEFKFVIVGKDKNLLWETGDNRVL  544
             VE+KFV++ K +   WE   NR+L
Sbjct  788  IVEWKFVVMDKGEVCRWEECGNRLL  812



>ref|XP_005943798.1| PREDICTED: dentin sialophosphoprotein-like [Haplochromis burtoni]
Length=832

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  299  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  469
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  + G W + + L    
Sbjct  734  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAES  790

Query  470  PVEFKFVIVGKDKNLLWETGDNRVL  544
             VE+KFV++ K +   WE   NR+L
Sbjct  791  IVEWKFVVMDKGEVCRWEECGNRLL  815



>ref|XP_007273214.1| glucoamylase [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA37711.1| glucoamylase [Colletotrichum gloeosporioides Nara gc5]
Length=626

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/77 (26%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +2

Query  347  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKD  505
            ++G+ I I+G+T +LG+W     +  +  G       W   +EL+ G+ +++K++ V  D
Sbjct  538  QFGQTIKIVGNTAQLGNWSPGSAISLSASGYTSANPVWSVTIELQAGQAIQYKYINVASD  597

Query  506  KNLLWETGDNRVLKLPA  556
              + WE   N    +P+
Sbjct  598  GTVTWEADPNHTYTVPS  614



>ref|XP_006381240.1| hypothetical protein POPTR_0006s10010g [Populus trichocarpa]
 gb|ERP59037.1| hypothetical protein POPTR_0006s10010g [Populus trichocarpa]
Length=379

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  484
            +++K  L  +  +GE   I+G    LG W     + ++W+++  W  E++L  G+  +FK
Sbjct  89   VRVKFQLQKECSFGEQFTIVGDDPLLGLWDPGSVIPLNWSDEHLWTVELDLPVGKSFQFK  148

Query  485  FVIVGKDKNLLWETGDNRVLK  547
            F++ G    + W+ G +RVL+
Sbjct  149  FILKGIGGGICWQPGPDRVLQ  169



>ref|WP_038992291.1| glycosidase [Arthrobacter sp. W1]
Length=572

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  478
            +   + + +  Q  +G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVSVEVTAQTVWGQNIRIVGNRPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            +K+V   +  N  WE+G NR+  + A GS  +
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNL  566



>emb|CDX80780.1| BnaC03g00340D [Brassica napus]
Length=435

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +2

Query  197  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  376
            S+  R  + +  R+    +++E  + E +  EK S   +++++  L  +  +GEH  I+G
Sbjct  86   SLHGRILKPIPLRSSSIKANIEEEDAETEAVEK-SPGRSVRVRFQLRKECVFGEHFFILG  144

Query  377  STKELGS--WK-KNVM-MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  541
                 G   W  +N + ++W++   W  ++EL  G  VEFKF++  K   +LW+ G NR 
Sbjct  145  DHPVFGGGLWDPENALPLNWSDGHVWTLDLELPVGRLVEFKFILKAKTGEILWQPGPNRA  204

Query  542  L  544
            +
Sbjct  205  I  205



>ref|XP_005716002.1| Putative Laforin [Chondrus crispus]
 emb|CDF36183.1| Putative Laforin [Chondrus crispus]
Length=549

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 40/83 (48%), Gaps = 7/83 (8%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEME----LKGGEPVEFKFVIVGKDK  508
            YG+ + ++GST  LG W  N  V   WT    WV+       L      EFKFVI+ KD 
Sbjct  11   YGDRLVLLGSTPALGKWDLNRAVPCAWTSGDVWVASHVARPFLHAPSRFEFKFVIIQKDG  70

Query  509  NLLWETGDNRVLKLPAGGSFKMV  577
              +WE G N +  +P   +  +V
Sbjct  71   PPIWEPGPNHIAHIPVHPALPLV  93



>ref|XP_008442437.1| PREDICTED: uncharacterized protein LOC103486305 isoform X3 [Cucumis 
melo]
Length=411

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFK  484
            +++K  L  +  +GEH  ++G     GSW     + ++W +   W +E+++  G+ ++FK
Sbjct  97   VRVKFQLQKECTFGEHFFVVGDDPIFGSWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFK  156

Query  485  FVIVGKDKNLLWETGDNRVLK  547
            F++ G   N+ W+ G +R  +
Sbjct  157  FILQGITGNVEWQPGPDRTFQ  177



>ref|XP_008442435.1| PREDICTED: uncharacterized protein LOC103486305 isoform X1 [Cucumis 
melo]
Length=413

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +2

Query  314  LKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFK  484
            +++K  L  +  +GEH  ++G     GSW     + ++W +   W +E+++  G+ ++FK
Sbjct  97   VRVKFQLQKECTFGEHFFVVGDDPIFGSWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFK  156

Query  485  FVIVGKDKNLLWETGDNRVLK  547
            F++ G   N+ W+ G +R  +
Sbjct  157  FILQGITGNVEWQPGPDRTFQ  177



>ref|XP_003007412.1| glucoamylase [Verticillium alfalfae VaMs.102]
 gb|EEY15491.1| glucoamylase [Verticillium alfalfae VaMs.102]
Length=632

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +2

Query  353  GEHIAIMGSTKELGSWKKN--VMMDW-----TEKGWVSEMELKGGEPVEFKFVIVGKDKN  511
            G+ I ++G+   LG W     V +D      T+  W   + L  G+ VE+K+V++  D +
Sbjct  544  GQDIRVVGNVPGLGRWDPGHAVPLDASQYTATDPSWRVTIPLPAGQVVEYKYVMLESDGS  603

Query  512  LLWETGDNRVLKLPA  556
            ++WE G NRVL +P+
Sbjct  604  VVWEAGSNRVLTVPS  618



>ref|XP_008858930.1| starch binding domain containing protein [Entamoeba nuttalli 
P19]
 gb|EKE38733.1| starch binding domain containing protein [Entamoeba nuttalli 
P19]
Length=108

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWT-EKGWVSEMELKGGEPVEFKFVIVGKD-  505
            +++Q   G  +A++GS KELG W+    M WT    W   +++K   P E+K+ I+    
Sbjct  4    INYQTTPGNSVAVVGSCKELGEWEHGAKMSWTSSNNWKIALDIK-NMPFEYKYQIIDSTG  62

Query  506  KNLLWETGDNRVL  544
            + L+WE   NR+ 
Sbjct  63   RVLIWEATQNRMF  75



>ref|WP_004057795.1| alpha-amylase [Haloferax mediterranei]
 ref|YP_006348249.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|AFK18262.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|EMA02465.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|AHZ22336.1| alpha-amylase [Haloferax mediterranei ATCC 33500]
Length=713

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 11/82 (13%)
 Frame = +2

Query  335  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  487
            D   + GE++ ++G+  ELG W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDVGENVYVVGNVHELGDWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V +  D  + WE+G NR    P
Sbjct  680  VKIASDGTVTWESGSNRQYTTP  701



>emb|CAI46245.1| cyclomaltodextrin glucanotransferase precursor [Haloferax mediterranei]
Length=713

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 11/82 (13%)
 Frame = +2

Query  335  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  487
            D   + GE++ ++G+  ELG W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDVGENVYVVGNVHELGDWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  488  VIVGKDKNLLWETGDNRVLKLP  553
            V +  D  + WE+G NR    P
Sbjct  680  VKIASDGTVTWESGSNRQYTTP  701



>ref|NP_568087.1| carbohydrate-binding domain-containing protein [Arabidopsis thaliana]
 gb|AAL15255.1| AT5g01260/F7J8_240 [Arabidopsis thaliana]
 gb|AAN28796.1| At5g01260/F7J8_240 [Arabidopsis thaliana]
 gb|AED90319.1| carbohydrate-binding domain-containing protein [Arabidopsis thaliana]
Length=306

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = +2

Query  251  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS-WKKNVMM--D  421
            SS++  +V  + +E  ++++ ++++  L  +  +GEH  I+G     G  W     +  +
Sbjct  66   SSIKDSQVNVEDEEIEASNKTVRVRFQLRKECVFGEHFFIVGDDPVFGGLWDPETALPLN  125

Query  422  WTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            W++   W  +++L  G  VEFK ++  +   +LW+ G NR L+
Sbjct  126  WSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGPNRALE  168



>ref|WP_035849789.1| glycosidase [Kitasatospora azatica]
Length=570

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/84 (24%), Positives = 42/84 (50%), Gaps = 3/84 (4%)
 Frame = +2

Query  332  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGK  502
            ++    YG+++ ++G    LG W     +  +  G   W  ++ L  G   ++K+V+   
Sbjct  481  VNATTSYGQNVYLVGDNPALGGWDTGKALPLSSAGYPVWSLDLALPAGTAFQYKYVLKDG  540

Query  503  DKNLLWETGDNRVLKLPAGGSFKM  574
            +  + WE+G NR   +P+GG  ++
Sbjct  541  NGAVTWESGANRTATVPSGGEVQL  564



>ref|XP_002559611.1| Pc13g11940 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP92263.1| Pc13g11940 [Penicillium rubens Wisconsin 54-1255]
Length=435

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (51%), Gaps = 7/79 (9%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMD-----WTEKG--WVSEMELKGGEPVEFKFVIVGKDK  508
            YG+++ + GS  +LGSW  +  +      +T     W + ++L  G   E+KF   G D 
Sbjct  346  YGQNVFLTGSISQLGSWSTSSAIALSADLYTSSNPLWTASIDLPAGTTFEYKFFKKGSDG  405

Query  509  NLLWETGDNRVLKLPAGGS  565
            ++ WE+  NR   +P G S
Sbjct  406  SITWESDPNRSYTVPTGCS  424



>gb|EWM63158.1| alpha-amylase [Micromonospora sp. M42]
Length=722

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            YG+++ ++G+   LG W     +  +      W + ++L     VE+K+V    D  + W
Sbjct  640  YGQNVFVVGNIPALGGWNPAAAVALSSAAYPVWRATVDLPANTAVEYKYVKKNPDGTVTW  699

Query  521  ETGDNRVLKLPAGGS  565
            E+G NR L  PAGG+
Sbjct  700  ESGANRTLTTPAGGT  714



>ref|XP_006576540.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X5 [Glycine max]
Length=217

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = +2

Query  254  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  427
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  428  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  544
            E   W  E+++  G+  ++KF++ G+  +++W+   +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPRLDRLI  172



>ref|WP_041648945.1| glycosidase [Arthrobacter arilaitensis]
Length=572

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (49%), Gaps = 3/92 (3%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  478
            +   + + +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVSVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            +K+V   +  N  WE+G NR+  + A GS  +
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNL  566



>dbj|GAM26669.1| hypothetical protein SAMD00019534_098440 [Acytostelium subglobosum 
LB1]
Length=207

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = +2

Query  317  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  487
            K++ W  H V +G+ I ++GS ++LG+W  +K   + +++   W  ++ L     +E+K+
Sbjct  110  KVRFWTKHHVPFGQQIKVIGSCEQLGNWDAQKAFPLTFSQGDTWEGDVLLGQAGRIEYKY  169

Query  488  VIVGKDKNLL--WETGDNRVLKLPAGGSFK  571
            +I   +   L  WE+G NRV  +    +F+
Sbjct  170  IITNFETGELIGWESGSNRVFMVSGILNFR  199



>emb|CBT76664.1| glycosyl hydrolase, family 13 [Arthrobacter arilaitensis Re117]
Length=569

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (49%), Gaps = 3/92 (3%)
 Frame = +2

Query  308  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  478
            +   + + +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  472  DTADVSVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  531

Query  479  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  574
            +K+V   +  N  WE+G NR+  + A GS  +
Sbjct  532  YKYVKYDQSGNATWESGANRIATVNADGSLNL  563



>gb|KJB36893.1| hypothetical protein B456_006G181700 [Gossypium raimondii]
Length=415

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (51%), Gaps = 4/102 (4%)
 Frame = +2

Query  251  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDW  424
            S VE   VE +  E+    + + ++  L+ +  +GEH  I+G    LG W  +  V + W
Sbjct  108  SQVELETVETQ-PEQEIPSKTVNVRFQLEKECSFGEHFFIVGDHPMLGLWDPENAVPLTW  166

Query  425  TE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  547
            +E   W  E+++     ++FKF++     NLLW+   +R+ +
Sbjct  167  SEGHVWTVELDVPVRVSIQFKFILKTSTGNLLWQPDPDRIFE  208



>ref|WP_043323282.1| alpha-amylase [Micromonospora sp. M42]
Length=736

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query  350  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  520
            YG+++ ++G+   LG W     +  +      W + ++L     VE+K+V    D  + W
Sbjct  654  YGQNVFVVGNIPALGGWNPAAAVALSSAAYPVWRATVDLPANTAVEYKYVKKNPDGTVTW  713

Query  521  ETGDNRVLKLPAGGS  565
            E+G NR L  PAGG+
Sbjct  714  ESGANRTLTTPAGGT  728



>ref|WP_012807740.1| alpha-amylase [Halomicrobium mukohataei]
 ref|YP_003176054.1| alpha amylase [Halomicrobium mukohataei DSM 12286]
 gb|ACV46347.1| alpha amylase catalytic region [Halomicrobium mukohataei DSM 
12286]
Length=741

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 58/133 (44%), Gaps = 10/133 (8%)
 Frame = +2

Query  185  GIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH------ENLKLKIWLDHQV  346
            G P ++++     +++      + +    VEK G+   +A       E +++   ++ + 
Sbjct  593  GTPANVVSNSATRMTATVPDGPAGLVDVVVEKNGQTSNAAKYDILTDEPVQVIFHVEAET  652

Query  347  EYGEHIAIMGSTKELGSWK----KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  514
            E GE I ++G   ELGSW         M+     W   + +      EFKFV + +  N+
Sbjct  653  EPGETIHVVGDPPELGSWDALSGSESFMNPDYPEWFLPVSVPKDTTFEFKFVKIDESDNV  712

Query  515  LWETGDNRVLKLP  553
             WE+G NR    P
Sbjct  713  TWESGSNRTFTSP  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985