BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS122F02

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631450.1|  PREDICTED: transketolase, chloroplastic-like     92.4    5e-20   Nicotiana tomentosiformis
ref|XP_009596626.1|  PREDICTED: transketolase, chloroplastic          97.1    6e-20   Nicotiana tomentosiformis
gb|ACF60500.1|  plastid transketolase                                 97.1    6e-20   Nicotiana tabacum [American tobacco]
ref|XP_009780210.1|  PREDICTED: transketolase, chloroplastic          96.3    1e-19   Nicotiana sylvestris
ref|XP_009781082.1|  PREDICTED: transketolase, chloroplastic          94.0    7e-19   Nicotiana sylvestris
ref|XP_010524370.1|  PREDICTED: transketolase-1, chloroplastic-like   93.6    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010692960.1|  PREDICTED: transketolase, chloroplastic-like     93.2    1e-18   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY68196.1|  BnaAnng26460D                                        92.8    2e-18   Brassica napus [oilseed rape]
gb|EYU31980.1|  hypothetical protein MIMGU_mgv1a001876mg              92.4    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_006345515.1|  PREDICTED: transketolase, chloroplastic-like     92.0    3e-18   Solanum tuberosum [potatoes]
ref|XP_004240048.1|  PREDICTED: transketolase, chloroplastic-like     91.7    5e-18   Solanum lycopersicum
gb|AAL09768.1|  At2g45290/F4L23.20                                    91.3    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497357.1|  PREDICTED: transketolase, chloroplastic-like     91.3    6e-18   
emb|CDX74726.1|  BnaA05g04720D                                        90.9    8e-18   
ref|NP_566041.2|  transketolase                                       90.9    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37327.1|  hypothetical protein AALP_AA4G242300                  90.9    1e-17   Arabis alpina [alpine rockcress]
dbj|BAB62078.1|  transketolase                                        90.5    1e-17   Persicaria tinctoria
ref|XP_006293747.1|  hypothetical protein CARUB_v10022709mg           90.5    1e-17   Capsella rubella
ref|XP_008354845.1|  PREDICTED: transketolase, chloroplastic          90.5    1e-17   
ref|XP_008344551.1|  PREDICTED: transketolase, chloroplastic          90.1    2e-17   
ref|XP_003592793.1|  Transketolase                                    89.7    2e-17   Medicago truncatula
gb|AAO33154.1|  putative transketolase                                89.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
sp|O20250.1|TKTC_SPIOL  RecName: Full=Transketolase, chloroplasti...  89.7    2e-17   Spinacia oleracea
emb|CAA75777.1|  transketolase 1                                      89.7    2e-17   Capsicum annuum
ref|XP_004248560.1|  PREDICTED: transketolase, chloroplastic          89.4    3e-17   Solanum lycopersicum
ref|XP_003536788.1|  PREDICTED: transketolase, chloroplastic-like     89.4    3e-17   Glycine max [soybeans]
gb|EPS59053.1|  hypothetical protein M569_15757                       86.7    3e-17   Genlisea aurea
ref|NP_001275202.1|  transketolase, chloroplastic                     89.4    3e-17   Solanum tuberosum [potatoes]
ref|XP_010506468.1|  PREDICTED: transketolase-2, chloroplastic        89.4    3e-17   Camelina sativa [gold-of-pleasure]
gb|EAZ35729.1|  hypothetical protein OsJ_20020                        89.0    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010671991.1|  PREDICTED: transketolase, chloroplastic          89.4    3e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN37298.1|  Transketolase, chloroplastic                          89.4    3e-17   Glycine soja [wild soybean]
ref|XP_006397707.1|  hypothetical protein EUTSA_v10001334mg           89.0    3e-17   
ref|XP_011093362.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...  89.0    4e-17   Sesamum indicum [beniseed]
dbj|BAJ33959.1|  unnamed protein product                              89.0    4e-17   Eutrema halophilum
ref|NP_001056711.1|  Os06g0133800                                     89.0    4e-17   
gb|EAY99538.1|  hypothetical protein OsI_21507                        89.0    4e-17   Oryza sativa Indica Group [Indian rice]
dbj|BAD67886.1|  putative transketolase 1                             88.6    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011090550.1|  PREDICTED: transketolase, chloroplastic          89.0    4e-17   Sesamum indicum [beniseed]
ref|XP_002511690.1|  transketolase, putative                          88.6    5e-17   Ricinus communis
ref|XP_009143123.1|  PREDICTED: transketolase-2, chloroplastic        88.2    6e-17   Brassica rapa
tpg|DAA38385.1|  TPA: hypothetical protein ZEAMMB73_245271            87.8    7e-17   
ref|XP_003557240.1|  PREDICTED: transketolase, chloroplastic          88.2    8e-17   Brachypodium distachyon [annual false brome]
ref|XP_008669591.1|  PREDICTED: LOW QUALITY PROTEIN: transketolas...  88.2    8e-17   
ref|XP_007142668.1|  hypothetical protein PHAVU_007G006600g           87.8    9e-17   Phaseolus vulgaris [French bean]
sp|Q42676.1|TKTC_CRAPL  RecName: Full=Transketolase, chloroplasti...  87.4    9e-17   Craterostigma plantagineum
ref|XP_010544646.1|  PREDICTED: transketolase-1, chloroplastic is...  87.8    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_010053907.1|  PREDICTED: transketolase, chloroplastic-like     87.8    1e-16   Eucalyptus grandis [rose gum]
gb|ABK92500.1|  unknown                                               87.8    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010264166.1|  PREDICTED: transketolase, chloroplastic          87.4    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006402546.1|  hypothetical protein EUTSA_v100058921mg          86.7    1e-16   
ref|NP_001267600.1|  transketolase                                    87.4    1e-16   Cucumis sativus [cucumbers]
gb|KDO85801.1|  hypothetical protein CISIN_1g004509mg                 87.0    2e-16   Citrus sinensis [apfelsine]
gb|KDO85800.1|  hypothetical protein CISIN_1g004509mg                 87.0    2e-16   Citrus sinensis [apfelsine]
gb|KDO85798.1|  hypothetical protein CISIN_1g004509mg                 87.0    2e-16   Citrus sinensis [apfelsine]
ref|XP_006445277.1|  hypothetical protein CICLE_v10018991mg           87.0    2e-16   Citrus clementina [clementine]
ref|XP_003556551.1|  PREDICTED: transketolase, chloroplastic          87.0    2e-16   Glycine max [soybeans]
ref|XP_011034130.1|  PREDICTED: transketolase, chloroplastic          87.0    2e-16   Populus euphratica
gb|AGH33875.1|  transketolase                                         86.7    2e-16   Camellia sinensis [black tea]
ref|XP_009386531.1|  PREDICTED: transketolase, chloroplastic-like     83.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010544644.1|  PREDICTED: transketolase-1, chloroplastic is...  86.7    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_003605140.1|  Transketolase                                    86.3    3e-16   Medicago truncatula
ref|XP_001769997.1|  predicted protein                                85.9    4e-16   
gb|ABK95795.1|  unknown                                               85.9    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006652140.1|  PREDICTED: transketolase, chloroplastic-like     85.9    4e-16   Oryza brachyantha
ref|XP_001769987.1|  predicted protein                                85.9    4e-16   
ref|XP_006827830.1|  hypothetical protein AMTR_s00009p00268850        85.9    4e-16   Amborella trichopoda
ref|XP_009391858.1|  PREDICTED: transketolase, chloroplastic          85.9    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT08283.1|  Transketolase, chloroplastic                          85.9    4e-16   
ref|XP_008232640.1|  PREDICTED: transketolase, chloroplastic          85.9    5e-16   Prunus mume [ume]
ref|XP_002266494.2|  PREDICTED: transketolase, chloroplastic          85.9    5e-16   Vitis vinifera
ref|XP_004506536.1|  PREDICTED: transketolase, chloroplastic-like     85.5    6e-16   Cicer arietinum [garbanzo]
gb|KHG01555.1|  Transketolase, chloroplastic                          85.5    7e-16   Gossypium arboreum [tree cotton]
ref|XP_002301278.1|  transketolase family protein                     85.5    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003605141.1|  Transketolase                                    85.1    7e-16   
ref|XP_010053906.1|  PREDICTED: transketolase, chloroplastic          85.5    7e-16   Eucalyptus grandis [rose gum]
gb|KJB09912.1|  hypothetical protein B456_001G174600                  85.1    8e-16   Gossypium raimondii
ref|XP_010276861.1|  PREDICTED: transketolase, chloroplastic          85.1    8e-16   Nelumbo nucifera [Indian lotus]
gb|EMS63024.1|  Transketolase, chloroplastic                          84.7    9e-16   Triticum urartu
ref|XP_002446209.1|  hypothetical protein SORBIDRAFT_06g004280        85.1    9e-16   Sorghum bicolor [broomcorn]
ref|XP_007220240.1|  hypothetical protein PRUPE_ppa001865mg           85.1    9e-16   Prunus persica
ref|XP_001764998.1|  predicted protein                                84.7    9e-16   
gb|EMT02862.1|  Transketolase, chloroplastic                          84.7    1e-15   
dbj|BAJ93658.1|  predicted protein                                    84.7    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656605.1|  PREDICTED: transketolase, chloroplastic-like     84.7    1e-15   
ref|XP_004970575.1|  PREDICTED: transketolase, chloroplastic-like     84.7    1e-15   Setaria italica
emb|CDO97702.1|  unnamed protein product                              84.7    1e-15   Coffea canephora [robusta coffee]
gb|ABK22156.1|  unknown                                               81.3    1e-15   Picea sitchensis
emb|CAN60522.1|  hypothetical protein VITISV_005988                   84.3    1e-15   Vitis vinifera
ref|XP_004145002.1|  PREDICTED: transketolase, chloroplastic-like     84.3    2e-15   Cucumis sativus [cucumbers]
gb|KDP28769.1|  hypothetical protein JCGZ_14540                       84.3    2e-15   Jatropha curcas
ref|XP_008460106.1|  PREDICTED: transketolase, chloroplastic          84.0    2e-15   Cucumis melo [Oriental melon]
ref|XP_004160671.1|  PREDICTED: transketolase, chloroplastic-like     84.0    2e-15   
dbj|BAH19845.1|  AT3G60750                                            83.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876580.1|  hypothetical protein ARALYDRAFT_486548           83.6    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_008813030.1|  PREDICTED: transketolase, chloroplastic          83.6    3e-15   Phoenix dactylifera
dbj|BAJ91301.1|  predicted protein                                    83.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO29950.1|  Unknown protein                                       83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62766.1|  transketolase-like protein                            83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190145.1|  transketolase                                    83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567103.1|  transketolase                                       83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87979.1|  predicted protein                                    83.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008438176.1|  PREDICTED: transketolase, chloroplastic          83.6    3e-15   Cucumis melo [Oriental melon]
ref|XP_011017481.1|  PREDICTED: transketolase, chloroplastic          83.6    3e-15   Populus euphratica
emb|CAB82679.1|  transketolase-like protein                           83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007052090.1|  Transketolase                                    83.6    3e-15   
dbj|BAD93859.1|  putative transketolase precursor                     77.4    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02687.1|  Transketolase, chloroplastic                          83.2    3e-15   Gossypium arboreum [tree cotton]
ref|NP_001145984.1|  hypothetical protein                             83.2    3e-15   Zea mays [maize]
gb|KJB49328.1|  hypothetical protein B456_008G113500                  83.2    4e-15   Gossypium raimondii
ref|XP_010513752.1|  PREDICTED: transketolase-1, chloroplastic-like   83.2    4e-15   
ref|XP_010469147.1|  PREDICTED: transketolase-1, chloroplastic-li...  83.2    4e-15   Camelina sativa [gold-of-pleasure]
gb|KHG17602.1|  Transketolase, chloroplastic                          83.2    4e-15   Gossypium arboreum [tree cotton]
gb|ACF88120.1|  unknown                                               82.8    4e-15   Zea mays [maize]
gb|KHG02686.1|  Transketolase, chloroplastic                          82.8    4e-15   Gossypium arboreum [tree cotton]
sp|Q7SIC9.1|TKTC_MAIZE  RecName: Full=Transketolase, chloroplasti...  82.8    5e-15   Zea mays [maize]
gb|KJB41095.1|  hypothetical protein B456_007G090400                  82.8    5e-15   Gossypium raimondii
ref|XP_002437762.1|  hypothetical protein SORBIDRAFT_10g002220        82.8    5e-15   
gb|KHG30158.1|  Transketolase, chloroplastic                          83.2    5e-15   Gossypium arboreum [tree cotton]
ref|XP_008658482.1|  PREDICTED: hypothetical protein isoform X1       82.8    5e-15   
gb|KJB41094.1|  hypothetical protein B456_007G090400                  82.8    5e-15   Gossypium raimondii
gb|AAN65341.1|  thioredoxin/transketolase fusion protein              82.8    5e-15   synthetic construct
ref|XP_010098926.1|  Transketolase                                    82.8    6e-15   Morus notabilis
ref|XP_002439367.1|  hypothetical protein SORBIDRAFT_09g005230        82.4    6e-15   
ref|XP_007153461.1|  hypothetical protein PHAVU_003G037400g           82.4    6e-15   Phaseolus vulgaris [French bean]
gb|EAY93323.1|  hypothetical protein OsI_15126                        82.4    6e-15   Oryza sativa Indica Group [Indian rice]
emb|CAH66254.1|  OSIGBa0139I12.3                                      82.4    6e-15   Oryza sativa [red rice]
ref|NP_001052335.1|  Os04g0266900                                     82.4    7e-15   
ref|XP_004964445.1|  PREDICTED: transketolase, chloroplastic-like     82.4    8e-15   
gb|KHN35634.1|  Transketolase, chloroplastic                          82.0    9e-15   Glycine soja [wild soybean]
gb|EAY93325.1|  hypothetical protein OsI_15128                        78.2    1e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_003581128.1|  PREDICTED: transketolase, chloroplastic-like     82.0    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_006844816.1|  hypothetical protein AMTR_s00058p00047610        82.0    1e-14   Amborella trichopoda
ref|XP_003521870.1|  PREDICTED: transketolase, chloroplastic          82.0    1e-14   Glycine max [soybeans]
ref|XP_010413521.1|  PREDICTED: transketolase-1, chloroplastic        81.6    1e-14   
ref|XP_011469144.1|  PREDICTED: transketolase, chloroplastic          81.6    1e-14   Fragaria vesca subsp. vesca
ref|XP_009418330.1|  PREDICTED: transketolase, chloroplastic-like     81.6    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39962.1|  unknown                                               81.3    2e-14   Picea sitchensis
ref|XP_009138817.1|  PREDICTED: transketolase-1, chloroplastic        80.9    2e-14   Brassica rapa
emb|CDX89074.1|  BnaA04g01120D                                        80.9    2e-14   
emb|CDY48374.1|  BnaC04g22010D                                        80.9    2e-14   Brassica napus [oilseed rape]
ref|XP_010941046.1|  PREDICTED: transketolase, chloroplastic          80.9    3e-14   Elaeis guineensis
emb|CDX71785.1|  BnaC08g30890D                                        80.9    3e-14   
ref|XP_009116754.1|  PREDICTED: transketolase-1, chloroplastic-like   80.5    3e-14   Brassica rapa
ref|XP_002991248.1|  hypothetical protein SELMODRAFT_161534           80.5    3e-14   
emb|CDY41143.1|  BnaA09g38720D                                        80.5    3e-14   Brassica napus [oilseed rape]
gb|KFK35277.1|  hypothetical protein AALP_AA5G264000                  80.5    3e-14   Arabis alpina [alpine rockcress]
ref|XP_002991185.1|  hypothetical protein SELMODRAFT_161485           80.5    3e-14   
ref|XP_006290638.1|  hypothetical protein CARUB_v10016731mg           80.5    3e-14   Capsella rubella
ref|XP_001701881.1|  transketolase                                    80.5    3e-14   Chlamydomonas reinhardtii
ref|XP_009411523.1|  PREDICTED: transketolase, chloroplastic-like     79.7    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN44824.1|  Transketolase, chloroplastic                          78.6    8e-14   Glycine soja [wild soybean]
ref|XP_004964449.1|  PREDICTED: transketolase, chloroplastic-like...  79.0    9e-14   
ref|XP_004964448.1|  PREDICTED: transketolase, chloroplastic-like...  79.3    9e-14   
ref|XP_008803984.1|  PREDICTED: transketolase, chloroplastic-like     79.0    1e-13   Phoenix dactylifera
gb|KFK30590.1|  hypothetical protein AALP_AA6G001400                  79.0    1e-13   Arabis alpina [alpine rockcress]
emb|CDX67840.1|  BnaA07g18800D                                        78.2    1e-13   
ref|XP_004964450.1|  PREDICTED: transketolase, chloroplastic-like...  79.0    1e-13   
ref|XP_010456321.1|  PREDICTED: transketolase, chloroplastic-like     79.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010934663.1|  PREDICTED: transketolase, chloroplastic-like     78.6    1e-13   Elaeis guineensis
ref|XP_010419543.1|  PREDICTED: transketolase, chloroplastic-like     78.6    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002872970.1|  chloroplast transketolase                        78.6    1e-13   Arabidopsis lyrata subsp. lyrata
sp|Q42677.1|TKT7_CRAPL  RecName: Full=Transketolase 7; Short=TK       77.8    2e-13   Craterostigma plantagineum
ref|XP_010426578.1|  PREDICTED: transketolase, chloroplastic-like     77.8    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010541872.1|  PREDICTED: transketolase, chloroplastic-like     77.4    3e-13   Tarenaya hassleriana [spider flower]
gb|KJB49327.1|  hypothetical protein B456_008G113400                  77.0    4e-13   Gossypium raimondii
ref|XP_005643257.1|  transketolase 7                                  77.0    5e-13   Coccomyxa subellipsoidea C-169
gb|ADG38646.1|  AT3G60750-like protein                                73.2    7e-13   Neslia paniculata [ball mustard]
ref|XP_006588227.1|  PREDICTED: transketolase, chloroplastic-like     72.4    2e-12   
ref|XP_002280760.1|  PREDICTED: transketolase, chloroplastic          74.7    3e-12   Vitis vinifera
sp|Q42675.1|TKTA_CRAPL  RecName: Full=Transketolase 10; Short=TK      74.3    3e-12   Craterostigma plantagineum
ref|XP_002953691.1|  hypothetical protein VOLCADRAFT_75893            73.6    7e-12   Volvox carteri f. nagariensis
gb|ADG38640.1|  AT3G60750-like protein                                70.1    7e-12   Capsella grandiflora
gb|AEN82255.1|  AT3G60750-like protein                                70.1    7e-12   Capsella rubella
ref|XP_002437765.1|  hypothetical protein SORBIDRAFT_10g002250        72.4    1e-11   Sorghum bicolor [broomcorn]
emb|CAN72939.1|  hypothetical protein VITISV_026323                   70.9    6e-11   Vitis vinifera
ref|XP_009786436.1|  PREDICTED: transketolase, chloroplastic-like     70.5    7e-11   Nicotiana sylvestris
ref|WP_018002836.1|  hypothetical protein                             70.5    7e-11   
ref|XP_009591814.1|  PREDICTED: transketolase, chloroplastic-like     70.1    8e-11   Nicotiana tomentosiformis
ref|WP_026167108.1|  transketolase                                    69.3    2e-10   Balneola vulgaris
ref|XP_011396515.1|  Transketolase, chloroplastic                     69.3    2e-10   Auxenochlorella protothecoides
ref|WP_011243295.1|  MULTISPECIES: transketolase                      68.9    2e-10   Synechococcus
ref|XP_002886031.1|  predicted protein                                62.8    4e-10   
ref|XP_004228780.1|  PREDICTED: transketolase, chloroplastic-like     67.8    5e-10   Solanum lycopersicum
ref|WP_018283020.1|  hypothetical protein                             66.6    1e-09   
ref|XP_004256009.1|  transketolase, putative                          66.6    1e-09   Entamoeba invadens IP1
ref|WP_041596407.1|  transketolase                                    66.2    2e-09   Halothece sp. PCC 7418
gb|AFZ42754.1|  transketolase                                         66.2    2e-09   Halothece sp. PCC 7418
ref|XP_002531681.1|  transketolase, putative                          66.2    2e-09   Ricinus communis
ref|XP_003061196.1|  predicted protein                                65.9    2e-09   Micromonas pusilla CCMP1545
ref|XP_007508375.1|  transketolase                                    65.9    3e-09   Bathycoccus prasinos
ref|XP_001776961.1|  predicted protein                                65.5    3e-09   
ref|WP_040667523.1|  transketolase                                    65.1    3e-09   
gb|KDO46241.1|  hypothetical protein CISIN_1g0068162mg                64.7    4e-09   Citrus sinensis [apfelsine]
ref|WP_015956023.1|  transketolase                                    65.1    4e-09   Cyanothece sp. PCC 7424
ref|XP_005847082.1|  hypothetical protein CHLNCDRAFT_48880            65.1    4e-09   Chlorella variabilis
emb|CCF84447.1|  Transketolase                                        65.1    4e-09   Nitrolancea hollandica Lb
ref|WP_016783748.1|  hypothetical protein                             60.5    5e-09   
ref|WP_034232066.1|  transketolase                                    64.7    5e-09   Lachnospiraceae bacterium AC2029
ref|WP_019778167.1|  hypothetical protein                             60.5    5e-09   
ref|WP_026797090.1|  transketolase                                    64.7    6e-09   Planktothrix
ref|WP_026794557.1|  MULTISPECIES: transketolase                      64.3    6e-09   Planktothrix
gb|ABB00047.1|  transketolase 1                                       59.7    6e-09   Nicotiana tabacum [American tobacco]
ref|WP_042153329.1|  transketolase                                    64.3    6e-09   Planktothrix agardhii
ref|WP_026788829.1|  MULTISPECIES: transketolase                      64.3    7e-09   Planktothrix
ref|XP_001739882.1|  transketolase                                    63.5    7e-09   Entamoeba dispar SAW760
ref|XP_001733372.1|  transketolase                                    63.5    8e-09   Entamoeba dispar SAW760
ref|XP_001737773.1|  transketolase                                    63.9    8e-09   Entamoeba dispar SAW760
ref|XP_010032172.1|  PREDICTED: transketolase, chloroplastic-like     63.9    1e-08   
gb|KCW51576.1|  hypothetical protein EUGRSUZ_J01078                   63.9    1e-08   Eucalyptus grandis [rose gum]
ref|WP_019774508.1|  hypothetical protein                             60.1    1e-08   Streptococcus sobrinus
ref|WP_019778950.1|  hypothetical protein                             60.5    1e-08   
ref|XP_002315311.1|  hypothetical protein POPTR_0010s23150g           63.5    1e-08   
ref|WP_027117664.1|  transketolase                                    63.5    1e-08   Lachnospiraceae bacterium YSB2008
ref|WP_005965607.1|  MULTISPECIES: transketolase                      63.5    1e-08   sulfur-oxidizing symbionts
ref|WP_017063200.1|  transketolase                                    60.5    1e-08   
ref|WP_011610305.1|  transketolase                                    63.2    1e-08   Trichodesmium erythraeum
ref|WP_017070460.1|  hypothetical protein                             60.5    2e-08   
ref|XP_011041028.1|  PREDICTED: transketolase, chloroplastic-like     63.2    2e-08   Populus euphratica
ref|WP_018290169.1|  hypothetical protein                             63.2    2e-08   
ref|WP_017066021.1|  hypothetical protein                             60.1    2e-08   
ref|XP_001418785.1|  predicted protein                                63.2    2e-08   Ostreococcus lucimarinus CCE9901
emb|CDO99755.1|  unnamed protein product                              63.2    2e-08   Coffea canephora [robusta coffee]
ref|WP_043041038.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_043039378.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_043030096.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_012680022.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_012516187.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_016800368.1|  transketolase                                    62.8    2e-08   Vibrio cyclitrophicus
ref|WP_042530756.1|  transketolase                                    62.8    2e-08   Corynebacterium singulare
ref|WP_004225435.1|  transketolase                                    62.8    2e-08   Streptococcus criceti
gb|ERK13722.1|  Transketolase                                         59.7    2e-08   Pantoea sp. AS-PWVM4
ref|WP_043052330.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_021321083.1|  transketolase                                    62.8    2e-08   Streptococcus equi
gb|AJI78869.1|  transketolase                                         62.8    2e-08   Corynebacterium singulare
ref|WP_042671209.1|  transketolase                                    62.8    2e-08   Streptococcus equi
ref|WP_043053375.1|  transketolase                                    62.8    2e-08   
ref|WP_036626426.1|  transketolase                                    59.7    2e-08   
ref|WP_003044835.1|  transketolase                                    62.8    2e-08   Streptococcus canis
ref|WP_012677467.1|  transketolase                                    62.8    2e-08   Streptococcus equi
emb|CAF24238.1|  probable transketolase                               62.8    2e-08   
ref|XP_011077266.1|  PREDICTED: transketolase, chloroplastic-like     62.8    2e-08   Sesamum indicum [beniseed]
ref|WP_044045188.1|  transketolase                                    62.8    2e-08   
ref|WP_042282387.1|  transketolase                                    62.8    2e-08   
gb|ABG77187.1|  transketolase 1                                       60.8    2e-08   Candidatus Endoriftia persephone str. Hot96_1+Hot96_2
ref|WP_027969208.1|  hypothetical protein                             60.5    2e-08   
gb|KHN48843.1|  Transketolase, chloroplastic                          62.4    2e-08   Glycine soja [wild soybean]
ref|WP_023071196.1|  transketolase                                    62.8    2e-08   Leptolyngbya sp. Heron Island J
ref|WP_017649153.1|  transketolase                                    59.7    2e-08   
ref|WP_017739732.1|  transketolase                                    62.4    3e-08   Scytonema hofmannii
ref|WP_031264638.1|  hypothetical protein                             59.7    3e-08   Streptococcus agalactiae
gb|EPU27211.1|  transketolase                                         59.7    3e-08   Streptococcus agalactiae MRI Z1-039
gb|EAO62850.1|  transketolase                                         59.7    3e-08   Streptococcus agalactiae 18RS21
ref|WP_038119913.1|  transketolase                                    62.4    3e-08   
ref|WP_017082013.1|  transketolase                                    60.5    3e-08   
ref|WP_016783760.1|  transketolase                                    60.5    3e-08   
ref|WP_021145885.1|  Transketolase                                    62.4    3e-08   
ref|WP_017090531.1|  hypothetical protein                             60.1    3e-08   
ref|WP_019826242.1|  transketolase                                    60.8    3e-08   
gb|KDD75405.1|  thiamine diphosphate binding domain of transkelotase  62.4    3e-08   Helicosporidium sp. ATCC 50920
ref|WP_002887578.1|  transketolase                                    62.0    4e-08   Streptococcus salivarius
ref|WP_004183062.1|  transketolase                                    62.0    4e-08   Streptococcus salivarius
emb|CEF98870.1|  Transketolase-like, C-terminal                       62.0    4e-08   Ostreococcus tauri
gb|EJO16551.1|  Transketolase                                         62.0    4e-08   Streptococcus salivarius K12
ref|WP_016786688.1|  transketolase                                    60.5    4e-08   
ref|XP_003080530.1|  Transketolase (ISS)                              62.0    4e-08   
gb|KHN21709.1|  Transketolase, chloroplastic                          61.2    4e-08   Glycine soja [wild soybean]
ref|WP_016786506.1|  hypothetical protein                             60.5    4e-08   
ref|WP_042657968.1|  transketolase                                    62.0    4e-08   Aeromonas allosaccharophila
ref|WP_042058494.1|  transketolase                                    62.0    4e-08   Aeromonas allosaccharophila
ref|WP_016797349.1|  transketolase                                    62.0    4e-08   Vibrio cyclitrophicus
ref|WP_028458018.1|  transketolase                                    62.0    4e-08   Chloroflexus sp. Y-396-1
ref|WP_043135579.1|  transketolase                                    62.0    4e-08   Aeromonas bestiarum
ref|WP_037597503.1|  transketolase                                    62.0    4e-08   Streptococcus salivarius
ref|WP_014633379.1|  transketolase                                    61.6    4e-08   
ref|WP_039695919.1|  transketolase                                    61.6    4e-08   Streptococcus equinus
ref|WP_014634012.1|  transketolase                                    61.6    4e-08   Streptococcus salivarius
ref|WP_038675476.1|  transketolase                                    61.6    4e-08   Streptococcus
ref|WP_037601959.1|  transketolase                                    61.6    4e-08   Streptococcus salivarius
ref|WP_024344627.1|  transketolase                                    61.6    5e-08   
ref|WP_010430445.1|  transketolase                                    61.6    5e-08   
ref|WP_013991006.1|  transketolase                                    61.6    5e-08   
ref|WP_014633490.1|  transketolase                                    61.6    5e-08   
ref|WP_021144579.1|  MULTISPECIES: Transketolase                      61.6    5e-08   
ref|WP_008486989.1|  transketolase                                    61.6    5e-08   
ref|WP_025861238.1|  transketolase                                    61.6    5e-08   
ref|WP_017647647.1|  hypothetical protein                             59.7    5e-08   
ref|WP_008533967.1|  transketolase                                    61.6    5e-08   
ref|WP_002885962.1|  transketolase                                    61.6    5e-08   
ref|WP_029406467.1|  transketolase                                    61.6    5e-08   
ref|WP_016790044.1|  transketolase                                    61.6    5e-08   
ref|WP_016788327.1|  transketolase                                    61.6    5e-08   
emb|CAV25977.1|  Transketolase                                        61.6    5e-08   
ref|WP_041473066.1|  transketolase                                    61.6    5e-08   
ref|WP_029225583.1|  transketolase                                    61.6    5e-08   
ref|WP_004731573.1|  transketolase                                    61.6    5e-08   
ref|WP_017103729.1|  transketolase                                    61.6    5e-08   
ref|WP_016798778.1|  transketolase                                    61.6    5e-08   
ref|WP_016798249.1|  transketolase                                    61.6    5e-08   
ref|WP_016792827.1|  transketolase                                    61.6    5e-08   
ref|WP_010435685.1|  transketolase                                    61.6    5e-08   
ref|WP_029222433.1|  transketolase                                    61.6    5e-08   
ref|WP_017629558.1|  transketolase                                    61.6    5e-08   
ref|WP_016795286.1|  transketolase                                    61.6    5e-08   
ref|WP_016790285.1|  transketolase                                    61.6    5e-08   
ref|WP_042027908.1|  transketolase                                    61.6    5e-08   
ref|WP_021759994.1|  putative transketolase                           61.6    5e-08   
ref|WP_005035206.1|  transketolase                                    61.6    5e-08   
ref|WP_006515947.1|  transketolase                                    61.6    5e-08   
ref|WP_006915002.1|  transketolase                                    61.6    5e-08   
ref|WP_022835747.1|  transketolase                                    61.6    5e-08   
ref|WP_022496580.1|  MULTISPECIES: transketolase                      61.6    5e-08   
ref|WP_015187816.1|  transketolase                                    61.6    5e-08   
gb|ABF13328.1|  transketolase                                         61.6    5e-08   
ref|WP_031460942.1|  transketolase                                    61.6    5e-08   
ref|WP_017645095.1|  hypothetical protein                             60.1    6e-08   
ref|XP_001913894.1|  transketolase, chloroplast                       58.9    6e-08   
gb|EFR95481.1|  transketolase                                         59.7    6e-08   
gb|EMS17587.1|  transketolase                                         58.9    6e-08   
ref|WP_018380075.1|  transketolase                                    61.2    6e-08   
ref|WP_004869798.1|  transketolase                                    61.2    6e-08   
ref|WP_032798738.1|  transketolase                                    60.5    6e-08   
gb|KIZ05366.1|  transketolase                                         61.6    6e-08   
gb|ACI61582.1|  Transketolase                                         61.2    6e-08   
ref|WP_012910538.1|  transketolase                                    61.2    6e-08   
ref|WP_018716469.1|  transketolase                                    61.2    6e-08   
ref|WP_002994256.1|  transketolase                                    61.2    7e-08   
gb|ESU92531.1|  transketolase                                         61.2    7e-08   
gb|ESU90219.1|  transketolase                                         61.2    7e-08   
gb|ERL16225.1|  transketolase                                         61.2    7e-08   
gb|AIQ01837.1|  Transketolase                                         61.2    7e-08   
gb|ESU89194.1|  transketolase                                         61.2    7e-08   
gb|ESA54052.1|  transketolase                                         61.2    7e-08   
gb|ESA51619.1|  transketolase                                         61.2    7e-08   
gb|ESA45645.1|  transketolase                                         61.2    7e-08   
gb|EFM33931.1|  transketolase                                         61.2    7e-08   
gb|AGQ28004.1|  transketolase                                         61.2    7e-08   
gb|AAX72528.1|  transketolase                                         61.2    7e-08   
ref|WP_023077735.1|  transketolase                                    61.2    7e-08   
gb|EQL79268.1|  transketolase                                         61.2    7e-08   
ref|WP_015838157.1|  transketolase                                    61.2    7e-08   
dbj|BAH82218.1|  transketolase                                        61.2    7e-08   
gb|ABF34558.1|  Transketolase                                         61.2    7e-08   
gb|AAK34434.1|  putative transketolase                                61.2    7e-08   
ref|WP_008932519.1|  transketolase                                    61.2    7e-08   
ref|WP_042765846.1|  transketolase                                    61.2    7e-08   
ref|WP_041789220.1|  transketolase                                    61.2    7e-08   
ref|WP_017040409.1|  transketolase                                    57.8    7e-08   
ref|WP_002736729.1|  transketolase                                    61.2    7e-08   
ref|WP_002789441.1|  transketolase                                    61.2    7e-08   
ref|WP_002775984.1|  transketolase                                    61.2    7e-08   
gb|ESU88336.1|  transketolase                                         61.2    7e-08   
ref|WP_042361559.1|  transketolase                                    61.2    7e-08   
ref|WP_032465545.1|  transketolase                                    61.2    7e-08   
ref|WP_038431740.1|  transketolase                                    61.2    7e-08   
ref|WP_003052233.1|  transketolase                                    61.2    7e-08   
sp|Q8NZX4.1|TKT_STRP8  RecName: Full=Transketolase; Short=TK          61.2    7e-08   
dbj|BAM61683.1|  transketolase                                        61.2    7e-08   
ref|WP_004162374.1|  transketolase                                    61.2    7e-08   
ref|WP_002768496.1|  transketolase                                    61.2    7e-08   
gb|KGE59119.1|  transketolase                                         61.2    7e-08   
ref|WP_008538731.1|  transketolase                                    61.2    7e-08   
sp|Q5XAK5.1|TKT_STRP6  RecName: Full=Transketolase; Short=TK          61.2    7e-08   
ref|WP_043335737.1|  transketolase                                    61.2    7e-08   
dbj|GAL95388.1|  transketolase                                        61.2    8e-08   
ref|WP_004159434.1|  transketolase                                    61.2    8e-08   
ref|WP_002754495.1|  transketolase                                    61.2    8e-08   
ref|WP_012264879.1|  transketolase                                    61.2    8e-08   
ref|WP_002748986.1|  transketolase                                    61.2    8e-08   
dbj|BAM30771.2|  transketolase                                        61.2    8e-08   
ref|WP_016515556.1|  Transketolase                                    61.2    8e-08   
ref|WP_004268410.1|  transketolase                                    61.2    8e-08   
ref|WP_008203199.1|  transketolase                                    61.2    8e-08   
ref|WP_003135592.1|  transketolase                                    61.2    8e-08   
gb|ABF32560.1|  transketolase                                         61.2    8e-08   
ref|WP_024968611.1|  transketolase                                    61.2    8e-08   
ref|WP_032467313.1|  transketolase                                    60.8    8e-08   
ref|WP_032466518.1|  transketolase                                    60.8    8e-08   
ref|WP_032467461.1|  transketolase                                    60.8    8e-08   
ref|WP_011285064.1|  transketolase                                    60.8    8e-08   
ref|WP_011888655.1|  transketolase                                    60.8    8e-08   
ref|WP_002538352.1|  Transketolase                                    60.8    8e-08   
ref|WP_015562846.1|  MULTISPECIES: transketolase                      60.8    8e-08   
ref|WP_032466987.1|  transketolase                                    60.8    8e-08   
ref|WP_022555059.1|  transketolase                                    60.8    8e-08   
ref|WP_014612523.1|  transketolase                                    60.8    8e-08   
ref|WP_011054904.1|  transketolase                                    60.8    8e-08   
ref|WP_011018079.1|  transketolase                                    60.8    8e-08   
ref|WP_022498206.1|  transketolase                                    58.5    8e-08   
ref|WP_026840063.1|  transketolase                                    60.8    8e-08   
ref|WP_042358075.1|  transketolase                                    60.8    8e-08   
ref|WP_030127293.1|  transketolase                                    60.8    8e-08   
ref|WP_030126338.1|  transketolase                                    60.8    8e-08   
ref|WP_021299077.1|  transketolase                                    60.8    8e-08   
ref|WP_014407766.1|  transketolase                                    60.8    8e-08   
ref|WP_014635634.1|  transketolase                                    60.8    8e-08   
ref|WP_003061224.1|  transketolase                                    60.8    8e-08   
ref|WP_011184842.1|  transketolase                                    60.8    8e-08   
ref|WP_038502484.1|  transketolase                                    60.8    8e-08   
ref|WP_010922560.1|  transketolase                                    60.8    8e-08   
ref|WP_032463409.1|  transketolase                                    60.8    8e-08   
ref|WP_032465873.1|  transketolase                                    60.8    8e-08   
ref|WP_032460248.1|  transketolase                                    60.8    8e-08   
ref|WP_003059127.1|  transketolase                                    60.8    8e-08   
gb|AFY56075.1|  transketolase                                         60.8    8e-08   
ref|WP_038434365.1|  transketolase                                    60.8    8e-08   
ref|WP_031488488.1|  transketolase                                    60.8    8e-08   
ref|WP_032462367.1|  transketolase                                    60.8    8e-08   
ref|WP_002988876.1|  transketolase                                    60.8    8e-08   
ref|WP_002798627.1|  transketolase                                    60.8    8e-08   
ref|WP_034932765.1|  transketolase                                    60.8    9e-08   
emb|CCK19908.1|  Transketolase                                        60.8    9e-08   
ref|WP_039998984.1|  transketolase                                    60.8    9e-08   
ref|WP_040526039.1|  transketolase                                    60.8    9e-08   
gb|EGG76701.1|  Transketolase                                         60.8    9e-08   
ref|WP_022942542.1|  transketolase                                    60.8    9e-08   
ref|WP_011528876.1|  transketolase                                    60.8    9e-08   
ref|WP_044291986.1|  transketolase                                    60.8    1e-07   
ref|WP_019783067.1|  transketolase                                    60.8    1e-07   
ref|WP_022949026.1|  transketolase                                    60.8    1e-07   
gb|AGS05358.1|  transketolase                                         59.3    1e-07   
ref|WP_013851505.1|  transketolase                                    60.8    1e-07   
ref|WP_003063475.1|  MULTISPECIES: transketolase                      60.8    1e-07   
ref|WP_012529809.1|  transketolase                                    60.8    1e-07   
ref|WP_020916278.1|  transketolase                                    60.5    1e-07   
ref|WP_003067411.1|  transketolase                                    60.5    1e-07   
ref|WP_019788183.1|  transketolase                                    60.5    1e-07   
ref|WP_009531698.1|  transketolase                                    60.5    1e-07   
ref|WP_021141750.1|  MULTISPECIES: Transketolase                      60.5    1e-07   
ref|WP_022989734.1|  transketolase                                    60.5    1e-07   
ref|WP_025252880.1|  transketolase                                    60.5    1e-07   
ref|WP_009528229.1|  transketolase                                    60.5    1e-07   
ref|WP_025387569.1|  transketolase                                    60.5    1e-07   
ref|WP_009631538.1|  transketolase                                    60.5    1e-07   
ref|WP_006823737.1|  transketolase                                    60.5    1e-07   
ref|WP_036329810.1|  transketolase                                    60.5    1e-07   
ref|WP_011416163.1|  transketolase                                    60.5    1e-07   
ref|WP_022606300.1|  hypothetical protein                             57.0    1e-07   
ref|WP_017753850.1|  transketolase                                    60.5    1e-07   
ref|WP_012961453.1|  transketolase                                    60.5    1e-07   
ref|WP_036377656.1|  transketolase                                    60.5    1e-07   
ref|WP_018373652.1|  transketolase                                    60.5    1e-07   
ref|WP_009853471.1|  transketolase                                    60.5    1e-07   
ref|WP_013642716.1|  transketolase                                    60.5    1e-07   
ref|WP_042788381.1|  transketolase                                    60.5    1e-07   
ref|WP_004096381.1|  transketolase                                    60.5    1e-07   
ref|WP_039693328.1|  transketolase                                    60.5    1e-07   
ref|WP_017071361.1|  hypothetical protein                             57.8    1e-07   
ref|WP_039670496.1|  transketolase                                    60.5    1e-07   
ref|WP_014294033.1|  transketolase                                    60.5    1e-07   
ref|WP_019792861.1|  transketolase                                    60.1    1e-07   
ref|WP_017109139.1|  transketolase                                    58.2    1e-07   
ref|WP_027970360.1|  transketolase                                    60.5    1e-07   
ref|WP_014800472.1|  transketolase                                    60.5    1e-07   
ref|WP_039675258.1|  transketolase                                    60.5    1e-07   
ref|WP_034825842.1|  transketolase                                    60.5    1e-07   
ref|WP_016791297.1|  transketolase                                    60.5    1e-07   
ref|WP_016785967.1|  transketolase                                    60.5    1e-07   
ref|WP_019784313.1|  transketolase                                    60.1    1e-07   
ref|WP_016786955.1|  transketolase                                    60.1    1e-07   
ref|WP_043320171.1|  transketolase                                    60.1    1e-07   
ref|WP_015229323.1|  transketolase                                    60.1    1e-07   
ref|WP_004738988.1|  transketolase                                    60.1    1e-07   
ref|WP_038194996.1|  hypothetical protein                             56.6    1e-07   
ref|WP_016768178.1|  transketolase                                    60.1    1e-07   
ref|WP_017065582.1|  hypothetical protein                             57.4    1e-07   
ref|WP_038194329.1|  hypothetical protein                             56.6    1e-07   
ref|WP_024604068.1|  transketolase                                    60.1    1e-07   
ref|WP_034943910.1|  transketolase                                    60.1    1e-07   
ref|WP_012861002.1|  transketolase                                    60.1    1e-07   
ref|WP_016785942.1|  transketolase                                    60.1    1e-07   
gb|KIC71008.1|  Transketolase                                         60.1    1e-07   
ref|WP_039486703.1|  MULTISPECIES: transketolase                      60.1    1e-07   
ref|WP_017084330.1|  transketolase                                    58.5    1e-07   
ref|WP_032552751.1|  transketolase                                    60.1    1e-07   
ref|WP_004737206.1|  transketolase                                    60.1    1e-07   
dbj|GAK53954.1|  transketolase                                        60.1    1e-07   
ref|WP_039360231.1|  transketolase                                    60.1    1e-07   
ref|WP_021152228.1|  Transketolase                                    60.1    2e-07   
ref|WP_012629867.1|  transketolase                                    60.1    2e-07   
ref|WP_010235882.1|  transketolase                                    60.1    2e-07   
dbj|GAL12115.1|  transketolase                                        60.1    2e-07   
ref|WP_008135324.1|  transketolase                                    60.1    2e-07   
ref|WP_004742527.1|  transketolase                                    60.1    2e-07   
ref|WP_008216279.1|  transketolase                                    60.1    2e-07   
ref|WP_004747747.1|  transketolase                                    60.1    2e-07   
ref|WP_043405971.1|  transketolase                                    60.1    2e-07   
ref|WP_039657387.1|  MULTISPECIES: transketolase                      60.1    2e-07   
ref|WP_029224002.1|  transketolase                                    60.1    2e-07   
ref|WP_008223578.1|  transketolase                                    60.1    2e-07   
ref|WP_034916284.1|  transketolase                                    60.1    2e-07   
ref|WP_007229991.1|  transketolase                                    60.1    2e-07   
ref|WP_042867433.1|  transketolase                                    60.1    2e-07   
ref|WP_008078783.1|  transketolase                                    60.1    2e-07   
ref|WP_003629293.1|  transketolase                                    60.1    2e-07   
ref|WP_003623568.1|  transketolase                                    60.1    2e-07   
ref|WP_020580226.1|  transketolase                                    60.1    2e-07   
ref|WP_014457448.1|  transketolase                                    60.1    2e-07   
ref|WP_015751300.1|  transketolase                                    60.1    2e-07   
ref|WP_013793690.1|  transketolase                                    60.1    2e-07   



>ref|XP_009631450.1| PREDICTED: transketolase, chloroplastic-like [Nicotiana tomentosiformis]
Length=168

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++QPADYKE+VLP  VTARVSIEA +TFG  KIVG KGKAIGID F
Sbjct  81   KAVRVVSFVCWELFNEQPADYKESVLPESVTARVSIEAASTFGRQKIVGDKGKAIGIDGF  140

Query  330  gASAPAGKIYKEYGI  286
            GASAPAG IYKE+GI
Sbjct  141  GASAPAGTIYKEFGI  155



>ref|XP_009596626.1| PREDICTED: transketolase, chloroplastic [Nicotiana tomentosiformis]
Length=743

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q ADYKE+VLPS VTARVSIEAG+TFGW K VG+KGKAIGID++
Sbjct  656  KAVRVVSFVCWELFEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRW  715

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  716  GASAPAGKIYKEYGIT  731



>gb|ACF60500.1| plastid transketolase [Nicotiana tabacum]
Length=744

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q ADYKE+VLPS VTARVSIEAG+TFGW K VG+KGKAIGID++
Sbjct  657  KAVRVVSFVCWELFEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRW  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  717  GASAPAGKIYKEYGIT  732



>ref|XP_009780210.1| PREDICTED: transketolase, chloroplastic [Nicotiana sylvestris]
Length=743

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELFD+QPADYKE+VLP  VTARVSIEA +TFGW KIVG KGKAIGID F
Sbjct  656  KAVRVVSFVCWELFDEQPADYKESVLPESVTARVSIEAASTFGWQKIVGDKGKAIGIDGF  715

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  716  GASAPAGKIYKEFGIT  731



>ref|XP_009781082.1| PREDICTED: transketolase, chloroplastic [Nicotiana sylvestris]
Length=741

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q ADYKE+VLPS VTARVSIEAG+TFGW K VG+KGKAIGID++
Sbjct  654  KAVRVVSFVCWELFEEQSADYKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRW  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  714  GASAPAGIIYKEYGIT  729



>ref|XP_010524370.1| PREDICTED: transketolase-1, chloroplastic-like [Tarenaya hassleriana]
Length=740

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAGTTFGW KIVG+KGKAIGID F
Sbjct  653  KAVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGTTFGWEKIVGSKGKAIGIDSF  712

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG++YKE+GIT
Sbjct  713  GASAPAGRLYKEFGIT  728



>ref|XP_010692960.1| PREDICTED: transketolase, chloroplastic-like [Beta vulgaris subsp. 
vulgaris]
Length=740

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD QP  YKE+VLPSDVTARVSIEAG+TFGW K VG+KGKAIGID+F
Sbjct  653  KAVRVVSFVSWELFDAQPDSYKESVLPSDVTARVSIEAGSTFGWLKYVGSKGKAIGIDRF  712

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  713  GASAPAGKIYKEFGIT  728



>emb|CDY68196.1| BnaAnng26460D [Brassica napus]
Length=736

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+QP  YKE+VLPSDV+ARVSIEAG+TFGWGK+VG KGK+IGID F
Sbjct  649  KNVRVVSFVCWELFDEQPDAYKESVLPSDVSARVSIEAGSTFGWGKVVGGKGKSIGIDSF  708

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+Y+E+GIT
Sbjct  709  GASAPAGKLYEEFGIT  724



>gb|EYU31980.1| hypothetical protein MIMGU_mgv1a001876mg [Erythranthe guttata]
Length=745

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELF+DQ A+YKE+VLPS VTARVSIEAGTTFGW KIVG+KGKAIGIDKF
Sbjct  658  KKVRVVSFVSWELFEDQSAEYKESVLPSAVTARVSIEAGTTFGWHKIVGSKGKAIGIDKF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKEYGIT EAV+AAAKEVC
Sbjct  718  GASAPAGKIYKEYGITAEAVIAAAKEVC  745



>ref|XP_006345515.1| PREDICTED: transketolase, chloroplastic-like [Solanum tuberosum]
Length=746

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q A+YKE+VLP+ VTARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  659  KAVRVVSFVSWELFDEQSAEYKESVLPAAVTARVSIEAGTTFGWAKIVGSKGKAIGIDRF  718

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  719  GASAPAGKIYKEFGIT  734



>ref|XP_004240048.1| PREDICTED: transketolase, chloroplastic-like [Solanum lycopersicum]
Length=746

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q A+YKE+VLP+ VTARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  659  KAVRVVSFVSWELFDEQSAEYKESVLPAAVTARVSIEAGTTFGWEKIVGSKGKAIGIDRF  718

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  719  GASAPAGKIYKEFGIT  734



>gb|AAL09768.1| At2g45290/F4L23.20 [Arabidopsis thaliana]
 gb|AAB82634.2| putative transketolase precursor [Arabidopsis thaliana]
Length=634

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KGK+IGID F
Sbjct  547  KSVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  607  GASAPAGKLYKEFGIT  622



>ref|XP_004497357.1| PREDICTED: transketolase, chloroplastic-like [Cicer arietinum]
Length=739

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFDDQ  +YKE+VLPS VTARVSIEAG+TFGW KIVG+KGK IGID+F
Sbjct  652  KAVRVVSFVSWELFDDQSDEYKESVLPSSVTARVSIEAGSTFGWHKIVGSKGKTIGIDRF  711

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  712  GASAPAGKIYKEFGIT  727



>emb|CDX74726.1| BnaA05g04720D [Brassica napus]
Length=736

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSFVCWELFD+Q   YKE+VLPS+V+ARVSIEAG+TFGWGK+VG KGK+IGID F
Sbjct  649  KSVRVVSFVCWELFDEQTDAYKESVLPSEVSARVSIEAGSTFGWGKVVGGKGKSIGIDSF  708

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  709  GASAPAGKLYKEFGIT  724



>ref|NP_566041.2| transketolase [Arabidopsis thaliana]
 sp|F4IW47.1|TKTC2_ARATH RecName: Full=Transketolase-2, chloroplastic; Short=TK; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEC10535.1| transketolase [Arabidopsis thaliana]
Length=741

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KGK+IGID F
Sbjct  654  KSVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  714  GASAPAGKLYKEFGIT  729



>gb|KFK37327.1| hypothetical protein AALP_AA4G242300 [Arabis alpina]
Length=734

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KGK+IGID F
Sbjct  647  KTVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDSF  706

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  707  GASAPAGKLYKEFGIT  722



>dbj|BAB62078.1| transketolase [Polygonum tinctorium]
Length=620

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q  +YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  533  KAVRVVSFVCWELFEEQSDEYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  592

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKEYGIT
Sbjct  593  GASAPAGRIYKEYGIT  608



>ref|XP_006293747.1| hypothetical protein CARUB_v10022709mg [Capsella rubella]
 gb|EOA26645.1| hypothetical protein CARUB_v10022709mg [Capsella rubella]
Length=739

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KG++IGID F
Sbjct  652  KTVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGRSIGIDTF  711

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  712  GASAPAGKLYKEFGIT  727



>ref|XP_008354845.1| PREDICTED: transketolase, chloroplastic [Malus domestica]
Length=747

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFDDQ  DYKE+VLP+ VTARVS+EAG+TFGW KIVG+KGK IGIDKF
Sbjct  659  KTVRVVSFVSWELFDDQSDDYKESVLPAAVTARVSLEAGSTFGWHKIVGSKGKVIGIDKF  718

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  719  GASAPAGKIYKEYGIT  734



>ref|XP_008344551.1| PREDICTED: transketolase, chloroplastic, partial [Malus domestica]
Length=667

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFDDQ  DYKE+VLP+ VTARVS+EAG+TFGW KIVG+KGK IGIDKF
Sbjct  579  KTVRVVSFVSWELFDDQSDDYKESVLPAAVTARVSLEAGSTFGWHKIVGSKGKVIGIDKF  638

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  639  GASAPAGKIYKEYGIT  654



>ref|XP_003592793.1| Transketolase [Medicago truncatula]
 ref|XP_003614796.1| Transketolase [Medicago truncatula]
 gb|AES63044.1| plastid transketolase [Medicago truncatula]
 gb|AES97754.1| plastid transketolase [Medicago truncatula]
Length=735

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFDDQ  +YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGK IGID+F
Sbjct  648  KTVRVVSFVSWELFDDQSDEYKESVLPASVTARVSIEAGSTFGWHKIVGSKGKTIGIDRF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  708  GASAPAGKIYKEYGIT  723



>gb|AAO33154.1| putative transketolase [Oryza sativa Japonica Group]
Length=743

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q A+YKE+VLP  VTARVS+EAG+T GW K VG+KGKAIGIDKF
Sbjct  657  KTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  717  GASAPAGKIYQEYGIT  732



>sp|O20250.1|TKTC_SPIOL RecName: Full=Transketolase, chloroplastic; Short=TK; Flags: 
Precursor [Spinacia oleracea]
 gb|AAD10219.1| transketolase [Spinacia oleracea]
Length=741

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELF+ Q  +YKE+VLPSDVTARVSIEAG+TFGW KIVG+KGKAIGIDKF
Sbjct  654  KAVRVVSFVSWELFEKQSDEYKESVLPSDVTARVSIEAGSTFGWHKIVGSKGKAIGIDKF  713

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIY+EYGITVEAVV AAK VC
Sbjct  714  GASAPAGKIYQEYGITVEAVVEAAKSVC  741



>emb|CAA75777.1| transketolase 1 [Capsicum annuum]
Length=744

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q A+YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  657  KAVRVVSLVSWELFDEQSAEYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  717  GASAPAGKIYKEYGIT  732



>ref|XP_004248560.1| PREDICTED: transketolase, chloroplastic [Solanum lycopersicum]
Length=741

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWEL+D+Q A+YKE+VLPS VTARVSIEAG+TFGW K VG KGKAIG+D F
Sbjct  654  KTVRVVSFVCWELYDEQSAEYKESVLPSSVTARVSIEAGSTFGWQKFVGDKGKAIGVDGF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIYKE+GIT
Sbjct  714  GASAPADKIYKEFGIT  729



>ref|XP_003536788.1| PREDICTED: transketolase, chloroplastic-like [Glycine max]
Length=742

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  655  KAVRVVSFVSWELFDEQSDEYKESVLPASVTARVSIEAGSTFGWHKIVGSKGKAIGIDRF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  715  GASAPAGKIYKEFGIT  730



>gb|EPS59053.1| hypothetical protein M569_15757, partial [Genlisea aurea]
Length=319

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q  +Y+E+VLP  VTARVSIEAGTTFGW KIVG KG AIGID+F
Sbjct  232  KAVRVVSLVSWELFDEQSDEYRESVLPEGVTARVSIEAGTTFGWEKIVGGKGTAIGIDRF  291

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  292  GASAPAGKIYKEFGIT  307



>ref|NP_001275202.1| transketolase, chloroplastic [Solanum tuberosum]
 sp|Q43848.1|TKTC_SOLTU RecName: Full=Transketolase, chloroplastic; Short=TK; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA90427.1| transketolase precursor [Solanum tuberosum]
Length=741

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWEL+D+Q A+YKE+VLPS VTARVSIEAG+TFGW K VG KGKAIGID F
Sbjct  654  KTVRVVSFVCWELYDEQSAEYKESVLPSSVTARVSIEAGSTFGWQKFVGDKGKAIGIDGF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIYKE+GIT
Sbjct  714  GASAPADKIYKEFGIT  729



>ref|XP_010506468.1| PREDICTED: transketolase-2, chloroplastic [Camelina sativa]
Length=739

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KGK+IGID F
Sbjct  652  KTVRVVSFVCWELFDEQSNAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTF  711

Query  330  gASAPAGKIYKEYGIT  283
            GASAP GK+YKE+GIT
Sbjct  712  GASAPTGKLYKEFGIT  727



>gb|EAZ35729.1| hypothetical protein OsJ_20020 [Oryza sativa Japonica Group]
Length=589

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q A+YKE+VLP  VTARVS+EAG+T GW K VG+KGKAIGIDKF
Sbjct  503  KTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKF  562

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  563  GASAPAGKIYQEYGIT  578



>ref|XP_010671991.1| PREDICTED: transketolase, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSFV WELFD Q  +YKE+VLP+ VTARVSIEAGTTFGW KIVG+KGKAIGIDKF
Sbjct  652  KSVRVVSFVSWELFDQQSDEYKESVLPAAVTARVSIEAGTTFGWQKIVGSKGKAIGIDKF  711

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            G SAPAGKIYKEYGIT EAV+ AAK VC
Sbjct  712  GQSAPAGKIYKEYGITAEAVIEAAKSVC  739



>gb|KHN37298.1| Transketolase, chloroplastic [Glycine soja]
Length=742

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  655  KAVRVVSFVSWELFDEQSDEYKESVLPASVTARVSIEAGSTFGWHKIVGSKGKAIGIDRF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  715  GASAPAGKIYKEFGIT  730



>ref|XP_006397707.1| hypothetical protein EUTSA_v10001334mg [Eutrema salsugineum]
 gb|ESQ39160.1| hypothetical protein EUTSA_v10001334mg [Eutrema salsugineum]
Length=709

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGW KIVG KGK+IGID F
Sbjct  622  KTVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWEKIVGGKGKSIGIDSF  681

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+G T
Sbjct  682  GASAPAGKLYKEFGFT  697



>ref|XP_011093362.1| PREDICTED: LOW QUALITY PROTEIN: transketolase, chloroplastic 
[Sesamum indicum]
Length=739

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VTARVSIEAGTTFGWGKIVGAKGKAIGID+F
Sbjct  652  KAVRVVSFVSWELFDEQSDEYKESVLPAAVTARVSIEAGTTFGWGKIVGAKGKAIGIDRF  711

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GITVEAV+AAAKEVC
Sbjct  712  GASAPAGKIYKEFGITVEAVIAAAKEVC  739



>dbj|BAJ33959.1| unnamed protein product [Thellungiella halophila]
Length=736

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGW KIVG KGK+IGID F
Sbjct  649  KTVRVVSFVCWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWEKIVGGKGKSIGIDSF  708

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+G T
Sbjct  709  GASAPAGKLYKEFGFT  724



>ref|NP_001056711.1| Os06g0133800 [Oryza sativa Japonica Group]
 dbj|BAF18625.1| Os06g0133800, partial [Oryza sativa Japonica Group]
Length=678

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q A+YKE+VLP  VTARVS+EAG+T GW K VG+KGKAIGIDKF
Sbjct  592  KTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKF  651

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  652  GASAPAGKIYQEYGIT  667



>gb|EAY99538.1| hypothetical protein OsI_21507 [Oryza sativa Indica Group]
Length=628

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q A+YKE+VLP  VTARVS+EAG+T GW K VG+KGKAIGIDKF
Sbjct  542  KTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKF  601

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  602  GASAPAGKIYQEYGIT  617



>dbj|BAD67886.1| putative transketolase 1 [Oryza sativa Japonica Group]
 dbj|BAD68864.1| putative transketolase 1 [Oryza sativa Japonica Group]
Length=633

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q A+YKE+VLP  VTARVS+EAG+T GW K VG+KGKAIGIDKF
Sbjct  547  KTVRVVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  607  GASAPAGKIYQEYGIT  622



>ref|XP_011090550.1| PREDICTED: transketolase, chloroplastic [Sesamum indicum]
Length=735

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VTARVSIEAG+TFGW KIVGAKGKAIGID+F
Sbjct  648  KAVRVVSFVSWELFDEQSDEYKESVLPAAVTARVSIEAGSTFGWEKIVGAKGKAIGIDRF  707

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+AAAKE+C
Sbjct  708  GASAPAGKIYKEFGITAEAVIAAAKELC  735



>ref|XP_002511690.1| transketolase, putative [Ricinus communis]
 gb|EEF50359.1| transketolase, putative [Ricinus communis]
Length=752

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 73/88 (83%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW KIVG KGKAIGID+F
Sbjct  665  KAVRVVSFVSWELFDEQSDAYKESVLPAAVTARVSIEAGSTFGWQKIVGGKGKAIGIDRF  724

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKEYGIT EAV+AAAKE+C
Sbjct  725  GASAPAGKIYKEYGITAEAVIAAAKELC  752



>ref|XP_009143123.1| PREDICTED: transketolase-2, chloroplastic [Brassica rapa]
Length=736

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSFVCWELFD+Q   YKE+VLPS+ +ARVSIEAG+TFGWGK+VG KGK+IGID F
Sbjct  649  KSVRVVSFVCWELFDEQTDAYKESVLPSEGSARVSIEAGSTFGWGKVVGGKGKSIGIDSF  708

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  709  GASAPAGKLYKEFGIT  724



>tpg|DAA38385.1| TPA: hypothetical protein ZEAMMB73_245271 [Zea mays]
Length=633

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCWELF++QP +YKE+VLPS+VT+R+SIEAG TFGW K +G KGKAIGID+F
Sbjct  547  RTVRVVSLVCWELFEEQPEEYKESVLPSEVTSRISIEAGVTFGWEKYIGQKGKAIGIDRF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE G+T
Sbjct  607  GASAPAGKIYKELGLT  622



>ref|XP_003557240.1| PREDICTED: transketolase, chloroplastic [Brachypodium distachyon]
Length=741

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFDDQ  +YKE+VLP  VTAR+SIEAG+T GW K VG+KGK IGIDKF
Sbjct  655  KTVRVVSFVCWELFDDQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  715  GASAPAGIIYKEYGIT  730



>ref|XP_008669591.1| PREDICTED: LOW QUALITY PROTEIN: transketolase, chloroplastic-like 
[Zea mays]
Length=724

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCWELF++QP +YKE+VLPS+VT+R+SIEAG TFGW K +G KGKAIGID+F
Sbjct  638  RTVRVVSLVCWELFEEQPEEYKESVLPSEVTSRISIEAGVTFGWEKYIGQKGKAIGIDRF  697

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE G+T
Sbjct  698  GASAPAGKIYKELGLT  713



>ref|XP_007142668.1| hypothetical protein PHAVU_007G006600g [Phaseolus vulgaris]
 gb|ESW14662.1| hypothetical protein PHAVU_007G006600g [Phaseolus vulgaris]
Length=740

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  653  KAVRVVSFVSWELFDEQSDEYKESVLPASVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  712

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  713  GASAPAGKIYKEFGLT  728



>sp|Q42676.1|TKTC_CRAPL RecName: Full=Transketolase, chloroplastic; Short=TK, partial 
[Craterostigma plantagineum]
 emb|CAA86607.1| transketolase [Craterostigma plantagineum]
Length=519

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLPS VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  432  KGVRVVSFVSWELFDEQSKEYKESVLPSSVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  491

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+E+GIT
Sbjct  492  GASAPAGKIYEEFGIT  507



>ref|XP_010544646.1| PREDICTED: transketolase-1, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=739

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF +Q   YKE+VLPSDV+ARVSIEAG+TFGW K+VG+KGKAIGID F
Sbjct  652  KAVRVVSFVCWELFAEQSDAYKESVLPSDVSARVSIEAGSTFGWEKVVGSKGKAIGIDSF  711

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+GIT
Sbjct  712  GASAPAGLLYKEFGIT  727



>ref|XP_010053907.1| PREDICTED: transketolase, chloroplastic-like [Eucalyptus grandis]
 gb|KCW78285.1| hypothetical protein EUGRSUZ_D02467 [Eucalyptus grandis]
Length=748

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFDDQ A+YKE+VLP+ V+ARVSIEAG+TFGW KIVG+ GKAIGID+F
Sbjct  661  KAVRVVSFVSWELFDDQSAEYKESVLPAAVSARVSIEAGSTFGWSKIVGSGGKAIGIDRF  720

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKE+GIT
Sbjct  721  GASAPAGIIYKEFGIT  736



>gb|ABK92500.1| unknown [Populus trichocarpa]
Length=744

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW K+VGAKGKAIGID+F
Sbjct  657  KAVRVVSFVSWELFDEQSVAYKESVLPAAVTARVSIEAGSTFGWQKLVGAKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  717  GASAPAGKIYKEFGIT  732



>ref|XP_010264166.1| PREDICTED: transketolase, chloroplastic [Nelumbo nucifera]
Length=747

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  659  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRF  718

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  719  GASAPAGKIYKEFGIT  734



>ref|XP_006402546.1| hypothetical protein EUTSA_v100058921mg, partial [Eutrema salsugineum]
 gb|ESQ43999.1| hypothetical protein EUTSA_v100058921mg, partial [Eutrema salsugineum]
Length=486

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEAG+TFGWGK+VG+KGK+IG++ F
Sbjct  399  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAGSTFGWGKLVGSKGKSIGVNSF  458

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  459  GASAPAPLLYKEFGIT  474



>ref|NP_001267600.1| transketolase [Cucumis sativus]
 ref|XP_004155784.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 gb|AEQ59483.1| chloroplast transketolase [Cucumis sativus]
 gb|KGN56609.1| hypothetical protein Csa_3G126240 [Cucumis sativus]
Length=742

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFDDQ   YKE+VLP  VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  655  KAVRVVSFVSWELFDDQSDAYKESVLPEAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  715  GASAPAGKIYKEFGLT  730



>gb|KDO85801.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=721

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  634  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  693

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+ AAKEVC
Sbjct  694  GASAPAGKIYKEFGITAEAVITAAKEVC  721



>gb|KDO85800.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=719

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  632  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  691

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+ AAKEVC
Sbjct  692  GASAPAGKIYKEFGITAEAVITAAKEVC  719



>gb|KDO85798.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
 gb|KDO85799.1| hypothetical protein CISIN_1g004509mg [Citrus sinensis]
Length=748

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  661  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  720

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+ AAKEVC
Sbjct  721  GASAPAGKIYKEFGITAEAVITAAKEVC  748



>ref|XP_006445277.1| hypothetical protein CICLE_v10018991mg [Citrus clementina]
 ref|XP_006490909.1| PREDICTED: transketolase-2, chloroplastic-like [Citrus sinensis]
 gb|ESR58517.1| hypothetical protein CICLE_v10018991mg [Citrus clementina]
Length=748

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  661  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  720

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+ AAKEVC
Sbjct  721  GASAPAGKIYKEFGITAEAVITAAKEVC  748



>ref|XP_003556551.1| PREDICTED: transketolase, chloroplastic [Glycine max]
 gb|KHN27089.1| Transketolase, chloroplastic [Glycine soja]
Length=740

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q  +YKE+VLP+ VT RVSIEAG+TFGW KIVG++GKAIGID+F
Sbjct  653  KAVRVVSFVSWELFDEQSDEYKESVLPASVTVRVSIEAGSTFGWQKIVGSQGKAIGIDRF  712

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  713  GASAPAGKIYKEFGIT  728



>ref|XP_011034130.1| PREDICTED: transketolase, chloroplastic [Populus euphratica]
Length=744

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW K+VG+KGKAIGID+F
Sbjct  657  KAVRVVSFVSWELFDEQSDAYKESVLPAAVTARVSIEAGSTFGWQKLVGSKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  717  GASAPAGKIYKEFGIT  732



>gb|AGH33875.1| transketolase [Camellia sinensis]
Length=747

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YK++VLP+ VTARVSIEAG+TFGW K +G+KGKAIGID+F
Sbjct  660  KAVRVVSFVSWELFDEQSDAYKDSVLPAAVTARVSIEAGSTFGWTKHIGSKGKAIGIDRF  719

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+GIT EAV+AAAK +C
Sbjct  720  GASAPAGKIYKEFGITAEAVIAAAKSLC  747



>ref|XP_009386531.1| PREDICTED: transketolase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=222

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCWELFD+Q  ++KE+V P+ VTARVSIEAG T GWGK +G+KGKAIGID+F
Sbjct  136  KAVRVVSLVCWELFDEQSDEFKESVFPAAVTARVSIEAGATLGWGKYIGSKGKAIGIDRF  195

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  196  GASAPAGRIYKEFGIT  211



>ref|XP_010544644.1| PREDICTED: transketolase-1, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=767

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF +Q   YKE+VLPSDV+ARVSIEAG+TFGW K+VG+KGKAIGID F
Sbjct  680  KAVRVVSFVCWELFAEQSDAYKESVLPSDVSARVSIEAGSTFGWEKVVGSKGKAIGIDSF  739

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+GIT
Sbjct  740  GASAPAGLLYKEFGIT  755



>ref|XP_003605140.1| Transketolase [Medicago truncatula]
 gb|AES87337.1| plastid transketolase [Medicago truncatula]
Length=735

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  648  KAVRVVSFVSWELFDEQSQAYKESVLPTAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKE+GIT
Sbjct  708  GASAPAGTIYKEFGIT  723



>ref|XP_001769997.1| predicted protein [Physcomitrella patens]
 gb|EDQ65173.1| predicted protein [Physcomitrella patens]
Length=715

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV+SFVCWELF++Q A+YKE++LPSDVTARVS+EAG TFGW + VG +G+AIG+D F
Sbjct  627  KTVRVISFVCWELFEEQSAEYKESLLPSDVTARVSVEAGATFGWERFVGLEGRAIGVDHF  686

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  687  GASAPANILYKEFGIT  702



>gb|ABK95795.1| unknown [Populus trichocarpa]
Length=744

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V ARVSIEAG+TFGW KIVG KGKAIGID+F
Sbjct  657  KAVRVVSFVSWELFDEQSDAYKESVLPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  717  GASAPAGKIYKEYGIT  732



>ref|XP_006652140.1| PREDICTED: transketolase, chloroplastic-like [Oryza brachyantha]
Length=711

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCWELF++Q  +YKE+VLP +VTAR+S+EAG TFGW K VG KGKAIG+D+F
Sbjct  625  KAVRVVSLVCWELFEEQSEEYKESVLPCEVTARISVEAGVTFGWEKYVGQKGKAIGVDRF  684

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE G+T
Sbjct  685  GSSAPAGKIYKELGLT  700



>ref|XP_001769987.1| predicted protein [Physcomitrella patens]
 gb|EDQ65163.1| predicted protein [Physcomitrella patens]
Length=692

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV+SFVCWELF++Q A+YKE++LPSDVTARVS+EAG TFGW + VG +G+AIG+D F
Sbjct  604  KTVRVISFVCWELFEEQSAEYKESLLPSDVTARVSVEAGATFGWERFVGLEGRAIGVDHF  663

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  664  GASAPANILYKEFGIT  679



>ref|XP_006827830.1| hypothetical protein AMTR_s00009p00268850 [Amborella trichopoda]
 gb|ERM95246.1| hypothetical protein AMTR_s00009p00268850 [Amborella trichopoda]
Length=751

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q  DYKE+VLP++VTARVS+EAG+TFGW KIVG+KGK+IGID+F
Sbjct  664  KAVRVVSLVSWELFDEQSDDYKESVLPAEVTARVSVEAGSTFGWEKIVGSKGKSIGIDRF  723

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+GIT
Sbjct  724  GASAPAGTLYKEFGIT  739



>ref|XP_009391858.1| PREDICTED: transketolase, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=751

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELFD+QP +YKE+V P+ VTAR+SIEAG T GW K VG+KGKAIGID+F
Sbjct  665  KTVRVVSLVCWELFDEQPDEYKESVFPAAVTARISIEAGVTLGWEKYVGSKGKAIGIDRF  724

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  725  GASAPAGRIYKEFGIT  740



>gb|EMT08283.1| Transketolase, chloroplastic [Aegilops tauschii]
Length=752

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVS VCWELF++QP +YKE+VLPS+VT+R+SIEAG T GW K +G KGKAIGID+F
Sbjct  666  KSVRVVSLVCWELFEEQPEEYKESVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRF  725

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAG+IYKE G+T
Sbjct  726  GSSAPAGRIYKELGLT  741



>ref|XP_008232640.1| PREDICTED: transketolase, chloroplastic [Prunus mume]
Length=752

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW K++G+KGKAIGID F
Sbjct  665  KAVRVVSFVSWELFDEQSDAYKESVLPAAVTARVSIEAGSTFGWEKLLGSKGKAIGIDHF  724

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  725  GASAPAGKIYKEFGLT  740



>ref|XP_002266494.2| PREDICTED: transketolase, chloroplastic [Vitis vinifera]
Length=729

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFDDQ   YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  642  KTVRVVSLVSWELFDDQSDAYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  701

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  702  GASAPAGKIYKEFGIT  717



>ref|XP_004506536.1| PREDICTED: transketolase, chloroplastic-like [Cicer arietinum]
Length=735

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  648  KAVRVVSFVSWELFDEQSEAYKESVLPAAVSARVSIEAGSTFGWHKIVGSKGKAIGIDRF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  708  GASAPAGRIYKEFGIT  723



>gb|KHG01555.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG27093.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=743

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  656  KTVRVVSFVSWELFDEQSDAYKESVLPSAVSARVSIEAGSTFGWAKIVGSKGKAIGIDRF  715

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+G+T EAVVAAAKE+C
Sbjct  716  GASAPAGKIYKEFGLTPEAVVAAAKELC  743



>ref|XP_002301278.1| transketolase family protein [Populus trichocarpa]
 gb|EEE80551.1| transketolase family protein [Populus trichocarpa]
Length=744

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V ARVSIEAG+TFGW KIVG KGKAIGID+F
Sbjct  657  KAVRVVSFVSWELFDEQSDAYKESVLPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  717  GASAPAGKIYKEYGIT  732



>ref|XP_003605141.1| Transketolase [Medicago truncatula]
 gb|AES87338.1| plastid transketolase [Medicago truncatula]
Length=581

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  494  KAVRVVSFVSWELFDEQSQAYKESVLPTAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  553

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKE+GIT
Sbjct  554  GASAPAGTIYKEFGIT  569



>ref|XP_010053906.1| PREDICTED: transketolase, chloroplastic [Eucalyptus grandis]
 gb|KCW78284.1| hypothetical protein EUGRSUZ_D02466 [Eucalyptus grandis]
Length=753

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV SF+ WELFD+Q  +YKE+VLPS VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  666  KTVRVASFISWELFDEQSPEYKESVLPSGVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  725

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGK+YKE+GIT
Sbjct  726  GASAPAGKLYKEFGIT  741



>gb|KJB09912.1| hypothetical protein B456_001G174600 [Gossypium raimondii]
Length=745

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  658  KTVRVVSFVSWELFDEQSDAYKESVLPSAVSARVSIEAGSTFGWAKIVGSKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAGKIYKE+G+T EAVVAAAKE+C
Sbjct  718  GASAPAGKIYKEFGLTPEAVVAAAKELC  745



>ref|XP_010276861.1| PREDICTED: transketolase, chloroplastic [Nelumbo nucifera]
Length=744

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  657  KAVRVVSFVSWELFDEQSDAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  717  GASAPAGRIYKEFGIT  732



>gb|EMS63024.1| Transketolase, chloroplastic [Triticum urartu]
Length=628

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLP  VTAR+SIEAG+T GW K VG+KGK IGIDKF
Sbjct  542  KTVRVVSFVCWELFDEQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKF  601

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIYKEYGIT
Sbjct  602  GASAPAPKIYKEYGIT  617



>ref|XP_002446209.1| hypothetical protein SORBIDRAFT_06g004280 [Sorghum bicolor]
 gb|EES10537.1| hypothetical protein SORBIDRAFT_06g004280 [Sorghum bicolor]
Length=726

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCWELF++QP +YKE+VLP++VT+R+SIEAG TFGW K +G KGKAIGID+F
Sbjct  640  RTVRVVSLVCWELFEEQPEEYKESVLPNEVTSRISIEAGVTFGWEKYIGQKGKAIGIDRF  699

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAGKIY+E G+T
Sbjct  700  GVSAPAGKIYEELGLT  715



>ref|XP_007220240.1| hypothetical protein PRUPE_ppa001865mg [Prunus persica]
 gb|EMJ21439.1| hypothetical protein PRUPE_ppa001865mg [Prunus persica]
Length=752

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD Q   YKE+VLP+ VTARVSIEAG+TFGW K+VG+KGKAIGID F
Sbjct  665  KAVRVVSFVSWELFDGQSDAYKESVLPAAVTARVSIEAGSTFGWQKLVGSKGKAIGIDHF  724

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  725  GASAPAGKIYKEFGLT  740



>ref|XP_001764998.1| predicted protein [Physcomitrella patens]
 gb|EDQ70214.1| predicted protein [Physcomitrella patens]
Length=636

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWEL+++Q A+YKE+VLP  VTARVSIEAG+TFGW + VG KGK+IGID+F
Sbjct  547  KTVRVVSFVCWELYEEQSAEYKESVLPKAVTARVSIEAGSTFGWERYVGLKGKSIGIDRF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+G T
Sbjct  607  GASAPAGTLYKEFGFT  622



>gb|EMT02862.1| Transketolase, chloroplastic [Aegilops tauschii]
Length=633

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLP  VTAR+SIEAG+T GW K VG+KGK IGIDKF
Sbjct  547  KTVRVVSFVCWELFDEQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIYKEYGIT
Sbjct  607  GASAPAPKIYKEYGIT  622



>dbj|BAJ93658.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=679

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLP  VTAR+SIEAG+T GW K VG+KGK IGIDKF
Sbjct  593  KTVRVVSFVCWELFDEQSDEYKESVLPEAVTARISIEAGSTLGWQKYVGSKGKTIGIDKF  652

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIYKEYGIT
Sbjct  653  GASAPAPKIYKEYGIT  668



>ref|XP_006656605.1| PREDICTED: transketolase, chloroplastic-like, partial [Oryza 
brachyantha]
Length=674

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLP  VT R+SIEAG+T GW K VG+KGKAIGIDKF
Sbjct  588  KTVRVVSFVCWELFDEQSDEYKESVLPEAVTGRISIEAGSTLGWQKYVGSKGKAIGIDKF  647

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGI+
Sbjct  648  GASAPAGKIYQEYGIS  663



>ref|XP_004970575.1| PREDICTED: transketolase, chloroplastic-like [Setaria italica]
Length=719

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCWELF++QP  YKE+VLPS+VT+R+SIEAG TFGW K +G KGKAIGID F
Sbjct  633  RTVRVVSLVCWELFEEQPEKYKESVLPSEVTSRISIEAGVTFGWEKYIGQKGKAIGIDSF  692

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAGKI+KE G+T
Sbjct  693  GISAPAGKIFKELGLT  708



>emb|CDO97702.1| unnamed protein product [Coffea canephora]
Length=745

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q A+YKE+V P+ VTARVSIEAG+TFGW KIVG KGKAIGID+F
Sbjct  658  KAVRVVSLVSWELFDEQSAEYKESVFPAAVTARVSIEAGSTFGWEKIVGPKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE GIT
Sbjct  718  GASAPAGKIYKELGIT  733



>gb|ABK22156.1| unknown [Picea sitchensis]
Length=224

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q  +YKE+VLP+ V ARVS+EAG+TFGW + +G+KGKA+GID+F
Sbjct  136  KAVRVVSFVCWELFEEQTPEYKESVLPAAVAARVSVEAGSTFGWERYLGSKGKAVGIDRF  195

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G +YKE+G+T
Sbjct  196  GASAPIGILYKEFGLT  211



>emb|CAN60522.1| hypothetical protein VITISV_005988 [Vitis vinifera]
Length=680

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFDDQ   YKE+VLP+ VTARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  593  KTVRVVSLVSWELFDDQSDAYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRF  652

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  653  GASAPAGKIYKEFGIT  668



>ref|XP_004145002.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 ref|XP_004154093.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
 gb|KGN46249.1| hypothetical protein Csa_6G077460 [Cucumis sativus]
Length=745

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVR+VSFV WELF++Q   YKE+VLP+ V+ARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  658  KAVRLVSFVSWELFNEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  718  GASAPAGKIYKEFGIT  733



>gb|KDP28769.1| hypothetical protein JCGZ_14540 [Jatropha curcas]
Length=751

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V ARVSIEAG+TFGW KIVGAKGKAIGID+F
Sbjct  664  KAVRVVSFVSWELFDEQSEAYKESVLPAAVEARVSIEAGSTFGWQKIVGAKGKAIGIDRF  723

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  724  GASAPAGKIYKEFGLT  739



>ref|XP_008460106.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
 ref|XP_008460107.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
Length=745

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVR+VSFV WELF++Q   YKE+VLP+ V+ARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  658  KAVRLVSFVSWELFNEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  718  GASAPAGKIYKEFGIT  733



>ref|XP_004160671.1| PREDICTED: transketolase, chloroplastic-like [Cucumis sativus]
Length=745

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVR+VSFV WELF++Q   YKE+VLP+ V+ARVSIEAGTTFGW KIVG+KGKAIGID+F
Sbjct  658  KAVRLVSFVSWELFNEQSDAYKESVLPAAVSARVSIEAGTTFGWEKIVGSKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  718  GASAPAGKIYKEFGIT  733



>dbj|BAH19845.1| AT3G60750 [Arabidopsis thaliana]
Length=570

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  483  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  542

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  543  GASAPAPLLYKEFGIT  558



>ref|XP_002876580.1| hypothetical protein ARALYDRAFT_486548 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52839.1| hypothetical protein ARALYDRAFT_486548 [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  654  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  714  GASAPAPLLYKEFGIT  729



>ref|XP_008813030.1| PREDICTED: transketolase, chloroplastic [Phoenix dactylifera]
Length=746

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELFD+Q  +YKE++LP+ VTARVSIEAG T GW K +G KGKAIGID+F
Sbjct  660  KTVRVVSLVCWELFDEQSNEYKESILPASVTARVSIEAGATLGWEKFLGTKGKAIGIDRF  719

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+G+T
Sbjct  720  GASAPAGRIYKEFGLT  735



>dbj|BAJ91301.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q  +YKE+VLPS+VT+R+SIEAG T GW K +G KGKAIGID+F
Sbjct  621  KFVRVVSLVCWELFEEQSEEYKESVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRF  680

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE+G+T
Sbjct  681  GSSAPAGKIYKEFGLT  696



>gb|AAO29950.1| Unknown protein [Arabidopsis thaliana]
Length=741

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  654  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  714  GASAPAPLLYKEFGIT  729



>gb|AAM62766.1| transketolase-like protein [Arabidopsis thaliana]
Length=741

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  654  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  714  GASAPAPLLYKEFGIT  729



>ref|NP_001190145.1| transketolase [Arabidopsis thaliana]
 gb|AEE80104.1| transketolase [Arabidopsis thaliana]
Length=740

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  653  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  712

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  713  GASAPAPLLYKEFGIT  728



>ref|NP_567103.1| transketolase [Arabidopsis thaliana]
 sp|Q8RWV0.1|TKTC1_ARATH RecName: Full=Transketolase-1, chloroplastic; Short=TK; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM14045.1| putative transketolase [Arabidopsis thaliana]
 gb|AAM91794.1| putative transketolase [Arabidopsis thaliana]
 gb|AEE80103.1| transketolase [Arabidopsis thaliana]
Length=741

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  654  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  714  GASAPAPLLYKEFGIT  729



>dbj|BAJ87979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q  +YKE+VLPS+VT+R+SIEAG T GW K +G KGKAIGID+F
Sbjct  621  KFVRVVSLVCWELFEEQSEEYKESVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRF  680

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE+G+T
Sbjct  681  GSSAPAGKIYKEFGLT  696



>ref|XP_008438176.1| PREDICTED: transketolase, chloroplastic [Cucumis melo]
Length=742

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELF++Q   YKE+VLP  V+ARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  655  KAVRVVSFVSWELFEEQSDAYKESVLPEAVSARVSIEAGSTFGWGKIVGSKGKAIGIDRF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  715  GASAPAGKIYKEFGIT  730



>ref|XP_011017481.1| PREDICTED: transketolase, chloroplastic [Populus euphratica]
Length=745

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELFD+Q   YKE+VLP+ V ARVSIEAG+TFGW KIVG KGKAIGID+F
Sbjct  658  KAVRVVSFVSWELFDEQSDAYKESVLPAAVEARVSIEAGSTFGWEKIVGDKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+G+T
Sbjct  718  GASAPAGKIYKEFGLT  733



>emb|CAB82679.1| transketolase-like protein [Arabidopsis thaliana]
Length=754

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  667  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSF  726

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  727  GASAPAPLLYKEFGIT  742



>ref|XP_007052090.1| Transketolase [Theobroma cacao]
 gb|EOX96247.1| Transketolase [Theobroma cacao]
Length=745

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGK+IGID+F
Sbjct  658  KAVRVVSLVSWELFDEQSDAYKESVLPSAVSARVSIEAGSTFGWEKIVGSKGKSIGIDRF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG+IYKE+G+T EAVV AAKE+C
Sbjct  718  GASAPAGRIYKEFGLTPEAVVTAAKELC  745



>dbj|BAD93859.1| putative transketolase precursor [Arabidopsis thaliana]
Length=79

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  483  CWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgASAPAGKI  304
            CWELFD+Q   YKE+VLPSDV+ARVSIEAG+TFGWGKIVG KGK+IGID FGASAPAGK+
Sbjct  1    CWELFDEQSDAYKESVLPSDVSARVSIEAGSTFGWGKIVGGKGKSIGIDTFGASAPAGKL  60

Query  303  YKEYGIT  283
            YKE+GIT
Sbjct  61   YKEFGIT  67



>gb|KHG02687.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG17603.1| Transketolase, chloroplastic [Gossypium arboreum]
 gb|KHG30020.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=634

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  547  KAVRVVSLVSWELFDNQSDAYKESVLPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  606

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG++YKE+G+T EAVVAAAKE+C
Sbjct  607  GASAPAGRLYKEFGLTPEAVVAAAKELC  634



>ref|NP_001145984.1| hypothetical protein [Zea mays]
 gb|ACL52980.1| unknown [Zea mays]
 gb|AFW85982.1| hypothetical protein ZEAMMB73_050344 [Zea mays]
Length=621

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  535  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  594

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  595  GASAPAGTIYKEYGIT  610



>gb|KJB49328.1| hypothetical protein B456_008G113500 [Gossypium raimondii]
Length=739

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  652  KAVRVVSLVSWELFDNQSDAYKESVLPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  711

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG++YKE+G+T EAVVAAAKE+C
Sbjct  712  GASAPAGRLYKEFGLTPEAVVAAAKELC  739



>ref|XP_010513752.1| PREDICTED: transketolase-1, chloroplastic-like [Camelina sativa]
Length=777

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLP+DV+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  655  KTVRVVSFVCWELFDEQSDEYKESVLPADVSARVSIEAASTFGWGKIVGGKGKSIGINSF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  715  GASAPAPLLYKEFGIT  730



>ref|XP_010469147.1| PREDICTED: transketolase-1, chloroplastic-like isoform X1 [Camelina 
sativa]
 ref|XP_010469148.1| PREDICTED: transketolase-1, chloroplastic-like isoform X2 [Camelina 
sativa]
Length=742

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TFGW KIVG KGK+IGI+ F
Sbjct  655  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWEKIVGGKGKSIGINSF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  715  GASAPAPFLYKEFGIT  730



>gb|KHG17602.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=731

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  644  KAVRVVSLVSWELFDNQSDAYKESVLPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  703

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG++YKE+G+T EAVVAAAKE+C
Sbjct  704  GASAPAGRLYKEFGLTPEAVVAAAKELC  731



>gb|ACF88120.1| unknown [Zea mays]
Length=628

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  542  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  601

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  602  GASAPAGTIYKEYGIT  617



>gb|KHG02686.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=710

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+VLPS V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  623  KAVRVVSLVSWELFDNQSDAYKESVLPSGVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  682

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG++YKE+G+T EAVVAAAKE+C
Sbjct  683  GASAPAGRLYKEFGLTPEAVVAAAKELC  710



>sp|Q7SIC9.1|TKTC_MAIZE RecName: Full=Transketolase, chloroplastic; Short=TK [Zea mays]
 pdb|1ITZ|A Chain A, Maize Transketolase In Complex With Tpp
 pdb|1ITZ|B Chain B, Maize Transketolase In Complex With Tpp
 pdb|1ITZ|C Chain C, Maize Transketolase In Complex With Tpp
Length=675

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  589  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  648

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  649  GASAPAGTIYKEYGIT  664



>gb|KJB41095.1| hypothetical protein B456_007G090400 [Gossypium raimondii]
Length=717

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V PS VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  630  KAVRVVSLVSWELFDEQSDAYKESVFPSAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  689

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG+IYKE+G+T EAV+AAAKE+C
Sbjct  690  GASAPAGRIYKEFGLTPEAVIAAAKELC  717



>ref|XP_002437762.1| hypothetical protein SORBIDRAFT_10g002220 [Sorghum bicolor]
 gb|EER89129.1| hypothetical protein SORBIDRAFT_10g002220 [Sorghum bicolor]
Length=633

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  547  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  607  GASAPAGTIYKEYGIT  622



>gb|KHG30158.1| Transketolase, chloroplastic [Gossypium arboreum]
Length=823

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V PS VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  736  KAVRVVSLVSWELFDEQSDAYKESVFPSAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  795

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG+IYKE+G+T EAV+AAAKE+C
Sbjct  796  GASAPAGRIYKEFGLTPEAVIAAAKELC  823



>ref|XP_008658482.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW85983.1| transketolase isoform 1 [Zea mays]
 gb|AFW85984.1| transketolase isoform 2 [Zea mays]
Length=633

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  547  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  607  GASAPAGTIYKEYGIT  622



>gb|KJB41094.1| hypothetical protein B456_007G090400 [Gossypium raimondii]
Length=745

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V PS VTARVSIEAG+TFGWGKIVG+KGKAIGID+F
Sbjct  658  KAVRVVSLVSWELFDEQSDAYKESVFPSAVTARVSIEAGSTFGWGKIVGSKGKAIGIDRF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPAG+IYKE+G+T EAV+AAAKE+C
Sbjct  718  GASAPAGRIYKEFGLTPEAVIAAAKELC  745



>gb|AAN65341.1| thioredoxin/transketolase fusion protein [synthetic construct]
Length=804

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  718  KTVRVVSFVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKF  777

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG IYKEYGIT
Sbjct  778  GASAPAGTIYKEYGIT  793



>ref|XP_010098926.1| Transketolase [Morus notabilis]
 gb|EXB76228.1| Transketolase [Morus notabilis]
Length=746

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V P+ V+ARVSIEAG+TFGW KIVG+KGKAIGI+ F
Sbjct  659  KAVRVVSLVSWELFDEQSDAYKESVFPAAVSARVSIEAGSTFGWEKIVGSKGKAIGINSF  718

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  719  GASAPAGKIYKEFGIT  734



>ref|XP_002439367.1| hypothetical protein SORBIDRAFT_09g005230 [Sorghum bicolor]
 gb|EES17797.1| hypothetical protein SORBIDRAFT_09g005230 [Sorghum bicolor]
Length=633

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K +RVVSFV WELF++Q  +YKE+VLP  VTAR+SIEAG+T GW K +GA+GKAIGIDKF
Sbjct  547  KTIRVVSFVSWELFEEQSDEYKESVLPEAVTARISIEAGSTLGWQKYIGAQGKAIGIDKF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKEYGIT
Sbjct  607  GASAPAGKIYKEYGIT  622



>ref|XP_007153461.1| hypothetical protein PHAVU_003G037400g [Phaseolus vulgaris]
 gb|ESW25455.1| hypothetical protein PHAVU_003G037400g [Phaseolus vulgaris]
Length=730

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFD+Q   YKE+VLP+ V+ARVSIEAG+TFGW KIVG+KGKAIGID+F
Sbjct  643  KTVRVVSLVSWELFDEQSEAYKESVLPAAVSARVSIEAGSTFGWEKIVGSKGKAIGIDRF  702

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIYKE+GIT
Sbjct  703  GASAPAGKIYKEFGIT  718



>gb|EAY93323.1| hypothetical protein OsI_15126 [Oryza sativa Indica Group]
Length=714

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q   YKE+V PS+VT+R+S+EAG TFGW K +G KGKAIG+D+F
Sbjct  628  KTVRVVSLVCWELFEEQSEKYKESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRF  687

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE G+T
Sbjct  688  GSSAPAGKIYKELGLT  703



>emb|CAH66254.1| OSIGBa0139I12.3 [Oryza sativa Indica Group]
Length=714

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q   YKE+V PS+VT+R+S+EAG TFGW K +G KGKAIG+D+F
Sbjct  628  KTVRVVSLVCWELFEEQSEKYKESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRF  687

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE G+T
Sbjct  688  GSSAPAGKIYKELGLT  703



>ref|NP_001052335.1| Os04g0266900 [Oryza sativa Japonica Group]
 emb|CAD39964.2| OSJNBa0072D08.7 [Oryza sativa Japonica Group]
 dbj|BAF14249.1| Os04g0266900 [Oryza sativa Japonica Group]
 dbj|BAG91438.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60633.1| hypothetical protein OsJ_14067 [Oryza sativa Japonica Group]
Length=714

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q   YKE+V PS+VT+R+S+EAG TFGW K +G KGKAIG+D+F
Sbjct  628  KTVRVVSLVCWELFEEQSEKYKESVFPSEVTSRISVEAGVTFGWEKYIGEKGKAIGVDRF  687

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE G+T
Sbjct  688  GSSAPAGKIYKELGLT  703



>ref|XP_004964445.1| PREDICTED: transketolase, chloroplastic-like [Setaria italica]
Length=743

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFV WELF++Q  +YKE+VLP+ V+AR+SIEAG+T GW K VGA+GKAIGIDKF
Sbjct  657  KTVRVVSFVSWELFEEQSDEYKESVLPASVSARISIEAGSTLGWQKYVGAQGKAIGIDKF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAGKIY+EYGIT
Sbjct  717  GASAPAGKIYQEYGIT  732



>gb|KHN35634.1| Transketolase, chloroplastic [Glycine soja]
Length=634

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V P+ V+ARVSIEAG+TFGW KIVGAKGKAIGID+F
Sbjct  547  KAVRVVSLVSWELFDEQSEAYKESVFPAAVSARVSIEAGSTFGWEKIVGAKGKAIGIDRF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  607  GASAPAGRIYKEFGIT  622



>gb|EAY93325.1| hypothetical protein OsI_15128 [Oryza sativa Indica Group]
Length=178

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q   YKE+V PS+VT+R+S+EAG TFGW K +G +GKAIG+D+ 
Sbjct  92   KTVRVVSLVCWELFEEQSEKYKESVFPSEVTSRISVEAGVTFGWEKYIGEQGKAIGVDRL  151

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPA KIY E G+T
Sbjct  152  GSSAPAAKIYNELGLT  167



>ref|XP_003581128.1| PREDICTED: transketolase, chloroplastic-like [Brachypodium distachyon]
Length=721

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q  +YK++VLPS+VT+R+SIEAG T GW K +G KGKAIGID+F
Sbjct  635  KTVRVVSLVCWELFEEQSEEYKDSVLPSEVTSRISIEAGVTLGWEKYIGQKGKAIGIDRF  694

Query  330  gASAPAGKIYKEYGIT  283
            G+SAPAGKIYKE G+T
Sbjct  695  GSSAPAGKIYKELGLT  710



>ref|XP_006844816.1| hypothetical protein AMTR_s00058p00047610 [Amborella trichopoda]
 gb|ERN06491.1| hypothetical protein AMTR_s00058p00047610 [Amborella trichopoda]
Length=701

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q  +YKE+VLP+ V+ARVS+EAG+TFGW KIVG+KGK+IGID+F
Sbjct  614  KAVRVVSLVSWELFDEQSDEYKESVLPAGVSARVSVEAGSTFGWEKIVGSKGKSIGIDRF  673

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+GIT
Sbjct  674  GASAPAGTLYKEFGIT  689



>ref|XP_003521870.1| PREDICTED: transketolase, chloroplastic [Glycine max]
Length=731

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q   YKE+V P+ V+ARVSIEAG+TFGW KIVGAKGKAIGID+F
Sbjct  644  KAVRVVSLVSWELFDEQSEAYKESVFPAAVSARVSIEAGSTFGWEKIVGAKGKAIGIDRF  703

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  704  GASAPAGRIYKEFGIT  719



>ref|XP_010413521.1| PREDICTED: transketolase-1, chloroplastic [Camelina sativa]
Length=742

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS VTARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  655  KTVRVVSFVCWELFDEQSDEYKESVLPSAVTARVSIEAASTFGWGKIVGGKGKSIGINSF  714

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  715  GASAPAPLLYKEFGIT  730



>ref|XP_011469144.1| PREDICTED: transketolase, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=743

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFV WELF+DQ   YKE+VLP+ VTARVSIEAG+TFGW KI+G KGKAIGID+F
Sbjct  656  KAVRVVSFVSWELFEDQSDAYKESVLPAAVTARVSIEAGSTFGWHKIIGTKGKAIGIDRF  715

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  IYKEYGITVEAV+AAAKEVC
Sbjct  716  GASAPAPIIYKEYGITVEAVIAAAKEVC  743



>ref|XP_009418330.1| PREDICTED: transketolase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFD+Q  +YKE+V P+ VTAR+SIEAGTT GW K VG+KGKAIGID+F
Sbjct  666  KTVRVVSLVSWELFDEQSDEYKESVFPASVTARISIEAGTTLGWEKFVGSKGKAIGIDRF  725

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  726  GASAPAGRIYKEFGIT  741



>gb|ACN39962.1| unknown [Picea sitchensis]
Length=751

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVSFVCWELF++Q  +YKE+VLP+ V ARVS+EAG+TFGW + +G+KGKA+GID+F
Sbjct  663  KAVRVVSFVCWELFEEQTPEYKESVLPAAVAARVSVEAGSTFGWERYLGSKGKAVGIDRF  722

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G +YKE+G+T
Sbjct  723  GASAPIGILYKEFGLT  738



>ref|XP_009138817.1| PREDICTED: transketolase-1, chloroplastic [Brassica rapa]
Length=735

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  648  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  708  GASAPAPLLYKEFGIT  723



>emb|CDX89074.1| BnaA04g01120D [Brassica napus]
Length=735

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  648  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  708  GASAPAPLLYKEFGIT  723



>emb|CDY48374.1| BnaC04g22010D [Brassica napus]
Length=735

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  648  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGKGKSIGINSF  707

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  708  GASAPAPLLYKEFGIT  723



>ref|XP_010941046.1| PREDICTED: transketolase, chloroplastic [Elaeis guineensis]
Length=743

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFD+Q  +YKE+VLP+ VTAR+SIEAG+T GW K VG KGKAIGID+F
Sbjct  657  KTVRVVSLVSWELFDEQSDEYKESVLPAAVTARISIEAGSTLGWEKFVGTKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  717  GASAPAGRIYKEFGIT  732



>emb|CDX71785.1| BnaC08g30890D [Brassica napus]
Length=739

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG +GK+IGI+ F
Sbjct  652  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSF  711

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  712  GASAPAPLLYKEFGIT  727



>ref|XP_009116754.1| PREDICTED: transketolase-1, chloroplastic-like [Brassica rapa]
Length=738

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG +GK+IGI+ F
Sbjct  651  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSF  710

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  711  GASAPAPLLYKEFGIT  726



>ref|XP_002991248.1| hypothetical protein SELMODRAFT_161534 [Selaginella moellendorffii]
 gb|EFJ07676.1| hypothetical protein SELMODRAFT_161534 [Selaginella moellendorffii]
Length=634

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSF CWELF+ Q  +YKE+V PS+VTARVS+EAG+TFGWGK VG++G AIG+D+F
Sbjct  547  KSVRVVSFPCWELFEKQSDEYKESVFPSEVTARVSVEAGSTFGWGKYVGSRGVAIGLDRF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+G T
Sbjct  607  GASAPAGTLYKEFGFT  622



>emb|CDY41143.1| BnaA09g38720D [Brassica napus]
Length=738

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG +GK+IGI+ F
Sbjct  651  KTVRVVSFVCWELFDEQTDEYKESVLPSGVSARVSIEAASTFGWGKIVGGEGKSIGINSF  710

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  711  GASAPAPLLYKEFGIT  726



>gb|KFK35277.1| hypothetical protein AALP_AA5G264000 [Arabis alpina]
Length=732

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG +GK+IGI+ F
Sbjct  645  KTVRVVSFVCWELFDEQSDEYKESVLPSAVSARVSIEAASTFGWGKIVGGQGKSIGINSF  704

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  705  GASAPAPLLYKEFGIT  720



>ref|XP_002991185.1| hypothetical protein SELMODRAFT_161485 [Selaginella moellendorffii]
 gb|EFJ07729.1| hypothetical protein SELMODRAFT_161485 [Selaginella moellendorffii]
Length=634

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K+VRVVSF CWELF+ Q  +YKE+V PS+VTARVS+EAG+TFGWGK VG++G AIG+D+F
Sbjct  547  KSVRVVSFPCWELFEKQSDEYKESVFPSEVTARVSVEAGSTFGWGKYVGSRGVAIGLDRF  606

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG +YKE+G T
Sbjct  607  GASAPAGTLYKEFGFT  622



>ref|XP_006290638.1| hypothetical protein CARUB_v10016731mg [Capsella rubella]
 gb|EOA23536.1| hypothetical protein CARUB_v10016731mg [Capsella rubella]
Length=741

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TFGWGKIVG KGK+IGI+ F
Sbjct  654  KTVRVVSFVCWELFDEQSDEYKESVLPSAVSARVSIEAASTFGWGKIVGGKGKSIGINSF  713

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YKE+GIT
Sbjct  714  GASAPAPLLYKEFGIT  729



>ref|XP_001701881.1| transketolase [Chlamydomonas reinhardtii]
 gb|EDP06856.1| transketolase [Chlamydomonas reinhardtii]
Length=718

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSF CWELF++Q A+YKE+VLPSDVTARVS+EA T+FGW K +G KGK +GID F
Sbjct  629  KNVRVVSFPCWELFEEQSAEYKESVLPSDVTARVSVEAATSFGWAKYIGLKGKHVGIDTF  688

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +Y+++GIT
Sbjct  689  GASAPAPTLYEKFGIT  704



>ref|XP_009411523.1| PREDICTED: transketolase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=750

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q  +YKE+VLP+ VTA++SIEAG T GW K VG KGKAIGID+F
Sbjct  664  KTVRVVSLVCWELFEEQSDEYKESVLPAAVTAKISIEAGATLGWEKYVGGKGKAIGIDRF  723

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GI+
Sbjct  724  GASAPAGRIYKEFGIS  739



>gb|KHN44824.1| Transketolase, chloroplastic [Glycine soja]
Length=480

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAV +VSFV WELFD Q  +Y E+VLP+ VT RVSIE G+TFGW  IVG+KG A+GID+F
Sbjct  393  KAVTIVSFVSWELFDKQSDEYNESVLPTSVTTRVSIEVGSTFGWHNIVGSKGNAVGIDRF  452

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAGKIYKE+GIT
Sbjct  453  GESAPAGKIYKEFGIT  468



>ref|XP_004964449.1| PREDICTED: transketolase, chloroplastic-like isoform X2 [Setaria 
italica]
Length=784

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCWELF++Q  +YKE+VLP  VTAR+S+EAG T GW K VG KGK IGID+F
Sbjct  698  KAVRVVSLVCWELFEEQSDEYKESVLPESVTARISVEAGCTLGWQKYVGTKGKIIGIDRF  757

Query  330  gASAPAGKIYKEYGIT  283
            GASAP  KI++EYGIT
Sbjct  758  GASAPGEKIFEEYGIT  773



>ref|XP_004964448.1| PREDICTED: transketolase, chloroplastic-like isoform X1 [Setaria 
italica]
Length=818

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCWELF++Q  +YKE+VLP  VTAR+S+EAG T GW K VG KGK IGID+F
Sbjct  732  KAVRVVSLVCWELFEEQSDEYKESVLPESVTARISVEAGCTLGWQKYVGTKGKIIGIDRF  791

Query  330  gASAPAGKIYKEYGIT  283
            GASAP  KI++EYGIT
Sbjct  792  GASAPGEKIFEEYGIT  807



>ref|XP_008803984.1| PREDICTED: transketolase, chloroplastic-like [Phoenix dactylifera]
Length=743

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFD+Q  +YKE+VLP+ V AR+SIEAG+T GW K VG KGKAIGID+F
Sbjct  657  KTVRVVSLVSWELFDEQTDEYKESVLPAAVAARISIEAGSTLGWEKFVGTKGKAIGIDRF  716

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG+IYKE+GIT
Sbjct  717  GASAPAGRIYKEFGIT  732



>gb|KFK30590.1| hypothetical protein AALP_AA6G001400 [Arabis alpina]
Length=718

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            +AVRVVS V WELFD+Q  +YKE+VLPS+V+ARVSIEAG+TFGW K+VG+KGKAIG+D F
Sbjct  631  RAVRVVSLVSWELFDEQSQEYKESVLPSEVSARVSIEAGSTFGWEKMVGSKGKAIGVDSF  690

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  +YK++G+TV+AVVAAAK++C
Sbjct  691  GASAPADVLYKKFGLTVDAVVAAAKDLC  718



>emb|CDX67840.1| BnaA07g18800D [Brassica napus]
Length=504

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVSFVCWELF++Q  +YKE+VLPS VTARVSIEA +TFGWGKIVG +GK+IGI+ F
Sbjct  417  KTVRVVSFVCWELFEEQTDEYKESVLPSGVTARVSIEAASTFGWGKIVGGRGKSIGINSF  476

Query  330  gASAPAGKIYKEYGI  286
            GASAPA  +YKE+GI
Sbjct  477  GASAPAPLLYKEFGI  491



>ref|XP_004964450.1| PREDICTED: transketolase, chloroplastic-like isoform X3 [Setaria 
italica]
Length=774

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCWELF++Q  +YKE+VLP  VTAR+S+EAG T GW K VG KGK IGID+F
Sbjct  688  KAVRVVSLVCWELFEEQSDEYKESVLPESVTARISVEAGCTLGWQKYVGTKGKIIGIDRF  747

Query  330  gASAPAGKIYKEYGIT  283
            GASAP  KI++EYGIT
Sbjct  748  GASAPGEKIFEEYGIT  763



>ref|XP_010456321.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=733

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            +AVRVVS V WELFD+Q  +YKE+VLPS+V+ARVSIEAG+TFGW K+VG KGKAIG+D F
Sbjct  646  RAVRVVSLVSWELFDEQSEEYKESVLPSEVSARVSIEAGSTFGWEKMVGCKGKAIGVDSF  705

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  +YK++G+TV+AVVAAAKEVC
Sbjct  706  GASAPADVLYKKFGLTVDAVVAAAKEVC  733



>ref|XP_010934663.1| PREDICTED: transketolase, chloroplastic-like [Elaeis guineensis]
Length=746

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELFD+Q  +YKE++LP+ VTAR+SIEAG T GW K VGA GK+IGID+F
Sbjct  660  KTVRVVSLVSWELFDEQSDEYKESILPASVTARISIEAGATLGWEKFVGAGGKSIGIDRF  719

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G+IYKE+GIT
Sbjct  720  GASAPGGRIYKEFGIT  735



>ref|XP_010419543.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=730

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            +AVRVVS V WELFD+Q  +YKE+VLPS+V+ARVSIEAG+TFGW K+VG KGKAIG+D F
Sbjct  643  RAVRVVSLVSWELFDEQSEEYKESVLPSEVSARVSIEAGSTFGWEKMVGCKGKAIGVDSF  702

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  +YK++G+TV+AVVAAAKEVC
Sbjct  703  GASAPADVLYKKFGLTVDAVVAAAKEVC  730



>ref|XP_002872970.1| chloroplast transketolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49229.1| chloroplast transketolase [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            +AVRVVS V WELFD+Q  +YKE+VLPS+V+ARVSIEAG+TFGW K+VG+KGKAIG+D F
Sbjct  647  RAVRVVSLVSWELFDEQSEEYKESVLPSEVSARVSIEAGSTFGWEKMVGSKGKAIGVDSF  706

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  +YK++G+TV+AVVAAAK++C
Sbjct  707  GASAPADVLYKKFGLTVDAVVAAAKDLC  734



>sp|Q42677.1|TKT7_CRAPL RecName: Full=Transketolase 7; Short=TK [Craterostigma plantagineum]
 emb|CAA86609.1| transketolase [Craterostigma plantagineum]
Length=676

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF +Q   Y+E VLPS VTARVS+EAG+TFGW + +G KGKA+GID+F
Sbjct  589  KKVRVVSLVCWELFAEQSEKYRETVLPSGVTARVSVEAGSTFGWERFIGPKGKAVGIDRF  648

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA +++KE+GITVEAVVAAAKE+C
Sbjct  649  GASAPAERLFKEFGITVEAVVAAAKEIC  676



>ref|XP_010426578.1| PREDICTED: transketolase, chloroplastic-like [Camelina sativa]
Length=733

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            +AVRVVS V WELFD+Q  +YKE+VLPS+V+ARVSIEAG+TFGW K+VG KGKAIGID F
Sbjct  645  RAVRVVSLVSWELFDEQSEEYKESVLPSEVSARVSIEAGSTFGWEKMVGCKGKAIGIDSF  704

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +YK++G+T
Sbjct  705  GASAPADVLYKKFGLT  720



>ref|XP_010541872.1| PREDICTED: transketolase, chloroplastic-like [Tarenaya hassleriana]
Length=743

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 64/88 (73%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V WELFD+Q  +YKE++LP  V+ARVSIEAG+TFGW KIVG+KGK+IGID+F
Sbjct  656  KAVRVVSLVSWELFDEQSEEYKESILPRAVSARVSIEAGSTFGWEKIVGSKGKSIGIDRF  715

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA  +YKE+G+TV+ V+AAAKEVC
Sbjct  716  GASAPANVLYKEFGLTVDGVIAAAKEVC  743



>gb|KJB49327.1| hypothetical protein B456_008G113400 [Gossypium raimondii]
Length=562

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS + WELFD+Q   YKE+VLPS V++R+SIEAG+TFGW KIVG KGKAIGID F
Sbjct  476  KAVRVVSLISWELFDNQSNAYKESVLPSSVSSRLSIEAGSTFGWKKIVGLKGKAIGIDWF  535

Query  330  gASAPAGKIYKEYGIT  283
            GAS P G++YKE+G+T
Sbjct  536  GASTPTGRLYKEFGLT  551



>ref|XP_005643257.1| transketolase 7 [Coccomyxa subellipsoidea C-169]
 gb|EIE18713.1| transketolase 7 [Coccomyxa subellipsoidea C-169]
Length=736

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K  RVVS VCWELF+DQ   YK ++LP DVTARVS+EAG+TFGW + VG KGKAIG+D F
Sbjct  649  KVARVVSMVCWELFEDQDESYKNSILPPDVTARVSVEAGSTFGWERYVGQKGKAIGVDSF  708

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +Y++YGIT
Sbjct  709  GASAPAPILYEKYGIT  724



>gb|ADG38646.1| AT3G60750-like protein, partial [Neslia paniculata]
Length=173

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTF  385
            K VRVVSFVCWELFD+Q  +YKE+VLPSDV+ARVSIEA +TF
Sbjct  115  KTVRVVSFVCWELFDEQSDEYKESVLPSDVSARVSIEAASTF  156



>ref|XP_006588227.1| PREDICTED: transketolase, chloroplastic-like [Glycine max]
Length=231

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K V VVSFV WELFD+Q  +Y E+VLP+ VTARVSIE  +TF W  I+G+KGKAIGID+F
Sbjct  144  KVVTVVSFVSWELFDEQSDEYNESVLPASVTARVSIEPESTFAWHNIIGSKGKAIGIDRF  203

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G IYKE+GIT
Sbjct  204  GASAPTGIIYKEFGIT  219



>ref|XP_002280760.1| PREDICTED: transketolase, chloroplastic [Vitis vinifera]
Length=745

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS VCW LFD+Q   YKE+VLP+ V+ARVS+EA +TFGW K VG+KGK+IGID+F
Sbjct  658  KAVRVVSLVCWALFDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA K+YKE G+T EAV+AAAK +C
Sbjct  718  GASAPALKLYKELGVTAEAVIAAAKSIC  745



>sp|Q42675.1|TKTA_CRAPL RecName: Full=Transketolase 10; Short=TK [Craterostigma plantagineum]
 emb|CAA86608.1| transketolase [Craterostigma plantagineum]
Length=679

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS V WELF +Q  +YKE VLPS+VTARVS+EAG+TFGW + VG KG+A+GID+F
Sbjct  592  KKVRVVSLVSWELFGEQSKEYKEMVLPSEVTARVSVEAGSTFGWERFVGLKGRAVGIDRF  651

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASA A ++YKE+GITVEAVVAAAKE+C
Sbjct  652  GASASAERLYKEFGITVEAVVAAAKELC  679



>ref|XP_002953691.1| hypothetical protein VOLCADRAFT_75893 [Volvox carteri f. nagariensis]
 gb|EFJ45315.1| hypothetical protein VOLCADRAFT_75893 [Volvox carteri f. nagariensis]
Length=715

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VR+VSF CWELF++Q A+YKE+VLP  V ARVS+EA T+FGW K +G KGK +GID F
Sbjct  627  KKVRIVSFPCWELFEEQSAEYKESVLPRSVEARVSVEAATSFGWAKYLGFKGKHVGIDDF  686

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  +Y++YGIT
Sbjct  687  GASAPAPVLYEKYGIT  702



>gb|ADG38640.1| AT3G60750-like protein, partial [Capsella grandiflora]
 gb|ADG38641.1| AT3G60750-like protein, partial [Capsella grandiflora]
 gb|ADG38642.1| AT3G60750-like protein, partial [Capsella grandiflora]
 gb|ADG38643.1| AT3G60750-like protein, partial [Capsella grandiflora]
 gb|ADG38644.1| AT3G60750-like protein, partial [Capsella grandiflora]
 gb|ADG38645.1| AT3G60750-like protein, partial [Capsella grandiflora]
Length=173

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTF  385
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TF
Sbjct  115  KTVRVVSFVCWELFDEQSDEYKESVLPSAVSARVSIEAASTF  156



>gb|AEN82255.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82256.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82257.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82258.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82259.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82260.1| AT3G60750-like protein, partial [Capsella rubella]
 gb|AEN82261.1| AT3G60750-like protein, partial [Capsella rubella]
Length=180

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTF  385
            K VRVVSFVCWELFD+Q  +YKE+VLPS V+ARVSIEA +TF
Sbjct  114  KTVRVVSFVCWELFDEQSDEYKESVLPSAVSARVSIEAASTF  155



>ref|XP_002437765.1| hypothetical protein SORBIDRAFT_10g002250 [Sorghum bicolor]
 gb|EER89132.1| hypothetical protein SORBIDRAFT_10g002250 [Sorghum bicolor]
Length=598

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCWELF++Q  +YKE+VLP  VTAR+SIEAG   GW K VG +GK I ID+F
Sbjct  512  KTVRVVSLVCWELFEEQSDEYKESVLPESVTARISIEAGCALGWQKYVGPRGKIIAIDRF  571

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA KIY E GIT
Sbjct  572  GASAPAEKIYMECGIT  587



>emb|CAN72939.1| hypothetical protein VITISV_026323 [Vitis vinifera]
Length=745

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS V W LFD+Q   YKE+VLP+ V+ARVS+EA +TFGW K VG+KGK+IGID+F
Sbjct  658  KAVRVVSLVSWALFDEQSDAYKESVLPAAVSARVSVEAASTFGWEKFVGSKGKSIGIDRF  717

Query  330  gASAPAGKIYKEYGITveavvaaakeVC  247
            GASAPA K+YKE G+T EAV+AAAK +C
Sbjct  718  GASAPALKLYKELGVTAEAVIAAAKSIC  745



>ref|XP_009786436.1| PREDICTED: transketolase, chloroplastic-like [Nicotiana sylvestris]
Length=757

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCW LFD QP DYKE VLPS+V+ RVS+EAG+  GW + VG +G  IGID F
Sbjct  668  RRVRVVSLVCWRLFDRQPRDYKELVLPSNVSKRVSVEAGSPLGWKEYVGDEGVVIGIDDF  727

Query  330  gASAPAGKIYKEYGIT  283
            GAS P  +++K+YG T
Sbjct  728  GASGPYSEVFKKYGFT  743



>ref|WP_018002836.1| hypothetical protein [zeta proteobacterium SCGC AB-604-O16]
Length=663

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  C E FD Q +DYKE+VLPS VTARV++EAG T  WGK VG  GK IGID F
Sbjct  576  KQVRVVSMPCTERFDAQDSDYKESVLPSSVTARVAVEAGVTGFWGKYVGLDGKVIGIDTF  635

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++KE+GIT
Sbjct  636  GESAPAGELFKEFGIT  651



>ref|XP_009591814.1| PREDICTED: transketolase, chloroplastic-like [Nicotiana tomentosiformis]
Length=763

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS VCW LFD QP DYKE VLPS+V+ RVS+EAG+  GW + VG +G  IG+D F
Sbjct  674  RRVRVVSLVCWRLFDRQPRDYKELVLPSNVSKRVSVEAGSPLGWKEYVGDEGFVIGVDDF  733

Query  330  gASAPAGKIYKEYGIT  283
            GAS P  +++K+YG T
Sbjct  734  GASGPYSEVFKKYGFT  749



>ref|WP_026167108.1| transketolase [Balneola vulgaris]
Length=666

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS  CWELF+ Q ADY E+VLP+ VT RVSIEAG+TFGW + +G  G AIGID FG 
Sbjct  580  VRVVSMPCWELFEQQDADYIESVLPTAVTNRVSIEAGSTFGWQRWIGNTGIAIGIDTFGE  639

Query  324  SAPAGKIYKEYGIT  283
            SAP  ++Y+ +GIT
Sbjct  640  SAPYEELYQHFGIT  653



>ref|XP_011396515.1| Transketolase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23641.1| Transketolase, chloroplastic [Auxenochlorella protothecoides]
Length=734

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVSF CWELF++Q   YK++VLP +V ARVSIEAG TFGW K VGAKG ++G+D FGAS
Sbjct  648  RVVSFPCWELFEEQEQSYKDSVLPPEVEARVSIEAGATFGWFKYVGAKGVSLGVDHFGAS  707

Query  321  APAGKIYKEYGIT  283
            APA  +Y++YG+T
Sbjct  708  APAPILYEKYGLT  720



>ref|WP_011243295.1| MULTISPECIES: transketolase [Synechococcus]
 dbj|BAD79173.1| transketolase [Synechococcus elongatus PCC 6301]
 gb|ABB56570.1| transketolase [Synechococcus elongatus PCC 7942]
 gb|AJD56388.1| transketolase [Synechococcus sp. UTEX 2973]
Length=668

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VR+VS  CWELFD+Q A+YKE+VLP  VTAR+++EAG++FGW + VG  G  I  D F
Sbjct  580  KKVRIVSMPCWELFDEQSAEYKESVLPKAVTARLAVEAGSSFGWHRYVGDAGATISTDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP   +++++G T
Sbjct  640  GASAPGNVMFEKFGFT  655



>ref|XP_002886031.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62290.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=59

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTF  385
            A+RVVS V WELFD Q  +YKE VLPS+V+ +VS EAG+TF
Sbjct  14   AMRVVSLVSWELFDKQSKEYKEKVLPSEVSGKVSTEAGSTF  54



>ref|XP_004228780.1| PREDICTED: transketolase, chloroplastic-like [Solanum lycopersicum]
Length=787

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS VCW LFD QP DYKE VLPS V+ RVS+EAG+  GW + VG +G  +GID FG+
Sbjct  674  VRVVSLVCWRLFDRQPRDYKECVLPSSVSKRVSVEAGSPLGWKEYVGDEGIVMGIDDFGS  733

Query  324  SAPAGKIYKEYGIT  283
            S P  +++ +YG T
Sbjct  734  SGPYSEVFNKYGFT  747



>ref|WP_018283020.1| hypothetical protein [zeta proteobacterium SCGC AB-137-C09]
Length=663

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KA+RVVS  C E FD Q A+YKE+VLP+ VTARV++EAG T  W K VG  GK +GID+F
Sbjct  576  KAIRVVSMPCTERFDAQSAEYKESVLPAAVTARVAVEAGVTGPWYKYVGLNGKVVGIDRF  635

Query  330  gASAPAGKIYKEYGIT  283
            G SAPA +++KE+GIT
Sbjct  636  GESAPAEELFKEFGIT  651



>ref|XP_004256009.1| transketolase, putative [Entamoeba invadens IP1]
 gb|ELP89238.1| transketolase, putative [Entamoeba invadens IP1]
Length=658

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS   WELF+ Q  +YKE+VLP  + ARVS+EAG TFGW K +G  G A+G++ FGAS
Sbjct  569  RVVSMPSWELFEQQTKEYKESVLPRSIRARVSVEAGATFGWEKYIGMDGVAVGMNSFGAS  628

Query  321  APAGKIYKEYGIT  283
            AP G +YK++GIT
Sbjct  629  APIGAVYKKFGIT  641



>ref|WP_041596407.1| transketolase [Halothece sp. PCC 7418]
Length=672

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT RV++EAGTTFGW + VGA+G+ IGID F
Sbjct  584  KNVRVVSMPCWELFEEQDAGYKESVLPQVVTKRVAVEAGTTFGWCRYVGAEGEVIGIDHF  643

Query  330  gASAPAGKIYKEYGIT  283
            GAS+P G   K +G T
Sbjct  644  GASSPGGVAMKNFGFT  659



>gb|AFZ42754.1| transketolase [Halothece sp. PCC 7418]
Length=701

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT RV++EAGTTFGW + VGA+G+ IGID F
Sbjct  613  KNVRVVSMPCWELFEEQDAGYKESVLPQVVTKRVAVEAGTTFGWCRYVGAEGEVIGIDHF  672

Query  330  gASAPAGKIYKEYGIT  283
            GAS+P G   K +G T
Sbjct  673  GASSPGGVAMKNFGFT  688



>ref|XP_002531681.1| transketolase, putative [Ricinus communis]
 gb|EEF30700.1| transketolase, putative [Ricinus communis]
Length=789

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGT  391
            + VRVVS VCW LFD QP +YKE+VLPS VT RVS+EAG+
Sbjct  700  RKVRVVSLVCWRLFDKQPPEYKEHVLPSSVTKRVSVEAGS  739



>ref|XP_003061196.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54846.1| predicted protein [Micromonas pusilla CCMP1545]
Length=706

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS  CWELF++Q  +YKE++ P D  A VSIEAG+TF          K+IG D FGAS
Sbjct  625  RVVSMPCWELFEEQSDEYKESIFPKDCKAIVSIEAGSTF---GWSKYAHKSIGRDDFGAS  681

Query  321  APAGKIYKEYGIT  283
            APAG +YKE+GIT
Sbjct  682  APAGILYKEFGIT  694



>ref|XP_007508375.1| transketolase [Bathycoccus prasinos]
 emb|CCO20479.1| transketolase [Bathycoccus prasinos]
Length=733

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q   Y+E+++PSD   RVSIEA +TF          K+IG D F
Sbjct  649  KKVRVVSMPCWELFEEQGDAYRESLIPSDCKCRVSIEAASTF---GWAKYAVKSIGRDGF  705

Query  330  gASAPAGKIYKEYGIT  283
            GASAPA  IYKE+GIT
Sbjct  706  GASAPAPTIYKEFGIT  721



>ref|XP_001776961.1| predicted protein [Physcomitrella patens]
 gb|EDQ58210.1| predicted protein [Physcomitrella patens]
Length=665

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS VCW+LFD QP +Y+E +LPS +  R+S+EAG+ FGW + VG+KGK + +  F
Sbjct  569  KKVRVVSLVCWQLFDQQPEEYREKILPSAMEKRISVEAGSPFGWREYVGSKGKILAVYTF  628

Query  330  gASAPAGKIYKEYGIT  283
            G S    K++++YG T
Sbjct  629  GCSGAYTKVFEKYGFT  644



>ref|WP_040667523.1| transketolase [Nitrolancea hollandica]
Length=682

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS  CWELFD QP +Y++ VLP  VTAR+++EAG+T GW +  G  G  IG+D FGAS
Sbjct  591  RVVSMPCWELFDRQPVEYRQAVLPDQVTARLAVEAGSTQGWCRYTGTHGDVIGVDTFGAS  650

Query  321  APAGKIYKEYGIT  283
            APA ++ K YG T
Sbjct  651  APAKEVLKHYGFT  663



>gb|KDO46241.1| hypothetical protein CISIN_1g0068162mg, partial [Citrus sinensis]
Length=398

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTT  388
            + VRVVS VCW LFD QPA+YKE VLPS V  RVS+EAG++
Sbjct  309  RRVRVVSLVCWRLFDRQPAEYKEKVLPSRVVKRVSVEAGSS  349



>ref|WP_015956023.1| transketolase [Cyanothece sp. PCC 7424]
 gb|ACK72438.1| transketolase [Cyanothece sp. PCC 7424]
Length=668

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  V  RV++EAGTTFGW +    +G  IGID F
Sbjct  580  KKVRVVSMPCWELFEEQDAAYKESVLPKAVRKRVAVEAGTTFGWCRYTTDEGVCIGIDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP     KE+G T
Sbjct  640  GASAPGEVALKEFGFT  655



>ref|XP_005847082.1| hypothetical protein CHLNCDRAFT_48880 [Chlorella variabilis]
 gb|EFN54980.1| hypothetical protein CHLNCDRAFT_48880 [Chlorella variabilis]
Length=671

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q  +YK++VL  +V ARVS+EAG+TFGW K VG KG++IGI++F
Sbjct  589  KKVRVVSMPCWELFEEQSQEYKDSVLLPEVKARVSVEAGSTFGWEKWVGDKGRSIGINEF  648

Query  330  gASAPAGKIYKEYGIT  283
            GASAP   +Y+++GIT
Sbjct  649  GASAPGPLLYEKFGIT  664



>emb|CCF84447.1| Transketolase [Nitrolancea hollandica Lb]
Length=704

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS  CWELFD QP +Y++ VLP  VTAR+++EAG+T GW +  G  G  IG+D FGAS
Sbjct  613  RVVSMPCWELFDRQPVEYRQAVLPDQVTARLAVEAGSTQGWCRYTGTHGDVIGVDTFGAS  672

Query  321  APAGKIYKEYGIT  283
            APA ++ K YG T
Sbjct  673  APAKEVLKHYGFT  685



>ref|WP_016783748.1| hypothetical protein, partial [Vibrio cyclitrophicus]
Length=96

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS    + FD Q A+Y+E+VLPSDVTAR+++EAG    W K VG  GK IG+  F
Sbjct  19   KAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIADFWYKYVGFGGKIIGMTTF  78

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++K +G T
Sbjct  79   GESAPAGELFKMFGFT  94



>ref|WP_034232066.1| transketolase [Lachnospiraceae bacterium AC2029]
Length=662

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS  C +LF+DQPA+YKE VLPS VT RV +EA T+FGW + +G  GK +G+  FGAS
Sbjct  578  RVVSMPCMDLFNDQPAEYKEQVLPSAVTVRVGVEALTSFGWERYIGLTGKFVGMTGFGAS  637

Query  321  APAGKIYKEYGIT  283
             P GK+++ +GIT
Sbjct  638  GPGGKLFEYFGIT  650



>ref|WP_019778167.1| hypothetical protein, partial [Streptococcus sobrinus]
Length=91

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A YKE+VLP+ VT R++IEAG++FGWGK VG  GK + I+ +GA
Sbjct  7    VRVVSMPAQNIFDEQDASYKESVLPAAVTKRLAIEAGSSFGWGKYVGLAGKTLTINTWGA  66

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  67   SAPGNRIFEEYGFT  80



>ref|WP_026797090.1| transketolase [Planktothrix prolifica]
Length=668

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT R+++EAG +FGW +  G++G +I ID F
Sbjct  580  KKVRVVSMPCWELFEEQDAAYKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G + +++G T
Sbjct  640  GASAPGGVLMEKFGYT  655



>ref|WP_026794557.1| MULTISPECIES: transketolase [Planktothrix]
Length=668

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT R+++EAG +FGW +  G++G +I ID F
Sbjct  580  KKVRVVSMPCWELFEEQDAAYKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G + +++G T
Sbjct  640  GASAPGGVLMEKFGYT  655



>gb|ABB00047.1| transketolase 1 [Nicotiana tabacum]
Length=69

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  453  DYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgASAPAGKIYKEYGIT  283
            D KE+VLPS VTARVSIEAG+TFGW K VG+KGKAIGID++GASAPAGKIYKEYGIT
Sbjct  1    DSKESVLPSSVTARVSIEAGSTFGWEKYVGSKGKAIGIDRWGASAPAGKIYKEYGIT  57



>ref|WP_042153329.1| transketolase [Planktothrix agardhii]
 gb|KEI66557.1| Tkt [Planktothrix agardhii NIVA-CYA 126/8]
Length=668

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT R+++EAG +FGW +  G++G +I ID F
Sbjct  580  KKVRVVSMPCWELFEEQDAAYKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G + +++G T
Sbjct  640  GASAPGGVLMEKFGYT  655



>ref|WP_026788829.1| MULTISPECIES: transketolase [Planktothrix]
Length=668

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+VLP  VT R+++EAG +FGW +  G++G +I ID F
Sbjct  580  KKVRVVSMPCWELFEEQDAAYKESVLPKAVTKRLAVEAGCSFGWQRYTGSEGDSISIDTF  639

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G + +++G T
Sbjct  640  GASAPGGVLMEKFGYT  655



>ref|XP_001739882.1| transketolase [Entamoeba dispar SAW760]
 gb|EDR23724.1| transketolase, putative [Entamoeba dispar SAW760]
Length=413

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfg  328
             VRVVS   WELF+ QP +Y+E+VLP  + ARVS+EA +T GW K +G  G A+G+  FG
Sbjct  321  GVRVVSLPSWELFNQQPVEYRESVLPRKIHARVSVEASSTMGWEKFIGDCGVAVGMHSFG  380

Query  327  ASAPAGKIYKEYGIT  283
            ASAP  K+Y+++GIT
Sbjct  381  ASAPINKLYEKFGIT  395



>ref|XP_001733372.1| transketolase [Entamoeba dispar SAW760]
 gb|EDR26412.1| transketolase, putative [Entamoeba dispar SAW760]
Length=435

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfg  328
             VRVVS   WELF+ QP +Y+E+VLP  + ARVS+EA +T GW K +G  G A+G+  FG
Sbjct  343  GVRVVSLPSWELFNQQPVEYRESVLPRKIHARVSVEASSTMGWEKFIGDCGVAVGMHSFG  402

Query  327  ASAPAGKIYKEYGIT  283
            ASAP  K+Y+++GIT
Sbjct  403  ASAPINKLYEKFGIT  417



>ref|XP_001737773.1| transketolase [Entamoeba dispar SAW760]
 gb|EDR25864.1| transketolase, putative [Entamoeba dispar SAW760]
Length=661

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfg  328
             VRVVS   WELF+ QP +Y+E+VLP  + ARVS+EA +T GW K +G  G A+G+  FG
Sbjct  569  GVRVVSLPSWELFNQQPVEYRESVLPRKIHARVSVEASSTMGWEKFIGDCGVAVGMHSFG  628

Query  327  ASAPAGKIYKEYGIT  283
            ASAP  K+Y+++GIT
Sbjct  629  ASAPINKLYEKFGIT  643



>ref|XP_010032172.1| PREDICTED: transketolase, chloroplastic-like [Eucalyptus grandis]
Length=750

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGT  391
            + VRVVS VCW LFD QP +YKE VLPS+V  RVS+EAG+
Sbjct  661  RRVRVVSLVCWRLFDGQPREYKERVLPSNVVKRVSVEAGS  700



>gb|KCW51576.1| hypothetical protein EUGRSUZ_J01078 [Eucalyptus grandis]
Length=746

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGT  391
            + VRVVS VCW LFD QP +YKE VLPS+V  RVS+EAG+
Sbjct  657  RRVRVVSLVCWRLFDGQPREYKERVLPSNVVKRVSVEAGS  696



>ref|WP_019774508.1| hypothetical protein, partial [Streptococcus sobrinus]
Length=136

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A YKE+VLP+ VT R++IEAG++FGWGK VG  GK + I+ +GA
Sbjct  52   VRVVSMPAQNIFDEQDASYKESVLPAAVTKRLAIEAGSSFGWGKYVGLAGKTLTINTWGA  111

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  112  SAPGNRIFEEYGFT  125



>ref|WP_019778950.1| hypothetical protein [Streptococcus sobrinus]
Length=149

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A YKE+VLP+ VT R++IEAG++FGWGK VG  GK + I+ +GA
Sbjct  65   VRVVSMPAQNIFDEQDASYKESVLPAAVTKRLAIEAGSSFGWGKYVGLAGKTLTINTWGA  124

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  125  SAPGNRIFEEYGFT  138



>ref|XP_002315311.1| hypothetical protein POPTR_0010s23150g [Populus trichocarpa]
 gb|EEF01482.1| hypothetical protein POPTR_0010s23150g [Populus trichocarpa]
Length=656

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTT  388
            + VRVVS VCW+LF+ QP +YKE+VLPS V+ R+S+EAG++
Sbjct  566  RKVRVVSLVCWQLFNRQPKEYKEHVLPSSVSKRISVEAGSS  606



>ref|WP_027117664.1| transketolase [Lachnospiraceae bacterium YSB2008]
Length=660

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS  C +LF+DQP +YK  VLP DVT RVS+EA +TFGW +  G  GK IG+  FGA
Sbjct  576  VRVVSMPCMDLFEDQPDEYKNAVLPKDVTKRVSVEALSTFGWDRYTGLNGKTIGMTTFGA  635

Query  324  SAPAGKIYKEYGIT  283
            SAPAG+++  +G T
Sbjct  636  SAPAGELFPYFGFT  649



>ref|WP_005965607.1| MULTISPECIES: transketolase [sulfur-oxidizing symbionts]
 gb|EGV50259.1| NAD(P)H-quinone oxidoreductase chain 4 1 [endosymbiont of Riftia 
pachyptila (vent Ph05)]
 gb|EGW54334.1| transketolase 1 [endosymbiont of Tevnia jerichonana (vent Tica)]
Length=662

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  C  +FD Q ADYKE+VLP+  TARV++EA  T  W K VG  GK IG+D+F
Sbjct  574  KKVRVVSMPCTNVFDAQDADYKESVLPAACTARVAVEAAVTDSWYKYVGLNGKVIGVDRF  633

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++KE+G T
Sbjct  634  GESAPAGQLFKEFGFT  649



>ref|WP_017063200.1| transketolase, partial [Vibrio crassostreae]
Length=159

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS    + FD Q A+Y+E+VLPSDVTAR+++EAG    W K VG  GK IG+  F
Sbjct  71   KAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIADFWYKYVGFGGKIIGMTTF  130

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++K +G T
Sbjct  131  GESAPAGELFKMFGFT  146



>ref|WP_011610305.1| transketolase [Trichodesmium erythraeum]
 gb|ABG49909.1| transketolase [Trichodesmium erythraeum IMS101]
Length=672

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  CWELF++Q A YKE+V P+ V  R+++EAG +FGW + V  +G  + +D F
Sbjct  584  KKVRVVSMPCWELFEEQDAAYKESVFPASVKKRLAVEAGVSFGWHRYVTDEGATLSVDTF  643

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G + +++G T
Sbjct  644  GASAPGGVVLEKFGFT  659



>ref|WP_017070460.1| hypothetical protein, partial [Vibrio crassostreae]
Length=168

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS    + FD Q A+Y+E+VLPSDVTAR+++EAG    W K VG  GK IG+  F
Sbjct  80   KAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIADFWYKYVGFGGKIIGMTTF  139

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++K +G T
Sbjct  140  GESAPAGELFKMFGFT  155



>ref|XP_011041028.1| PREDICTED: transketolase, chloroplastic-like [Populus euphratica]
Length=764

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTT  388
            + VRVVS VCW+LF+ QP +YKE+VLPS V+ R+S+EAG++
Sbjct  674  RKVRVVSLVCWQLFNRQPKEYKEHVLPSSVSKRISVEAGSS  714



>ref|WP_018290169.1| hypothetical protein [Verrucomicrobium sp. 3C]
Length=664

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -3

Query  501  RVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgAS  322
            RVVS   WELF  QP  Y+E VLP+ V ARVS+EAG T  W + +G +G+A+GID +GAS
Sbjct  574  RVVSLPSWELFAQQPEAYREEVLPAKVRARVSVEAGVTLAWRRWLGLQGEAVGIDHYGAS  633

Query  321  APAGKIYKEYGIT  283
            AP   IYKE+G+T
Sbjct  634  APYATIYKEFGLT  646



>ref|WP_017066021.1| hypothetical protein, partial [Vibrio crassostreae]
Length=173

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS    + FD Q A+Y+E+VLPSDVTAR+++EAG    W K VG  GK IG+  F
Sbjct  85   KAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIADFWYKYVGFGGKIIGMTTF  144

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++K +G T
Sbjct  145  GESAPAGELFKMFGFT  160



>ref|XP_001418785.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97078.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=679

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTAR-VSIEAGTTFgwgkivgakgkaigidk  334
            K VRVVS  CWE F+ QPA Y+E+VLP+ + A+ VSIEAGTTF         G +IG D 
Sbjct  595  KKVRVVSMPCWEAFERQPAAYQESVLPAAMRAKTVSIEAGTTF---GWAKYAGASIGHDD  651

Query  333  fgASAPAGKIYKEYGIT  283
            FGASAPA  +YK++GIT
Sbjct  652  FGASAPAPILYKQFGIT  668



>emb|CDO99755.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGT  391
            + VRVVS VCW LFD QP +YKE+VLPS V+ R+S+EAG+
Sbjct  672  RRVRVVSLVCWRLFDRQPQEYKEDVLPSGVSKRLSVEAGS  711



>ref|WP_043041038.1| transketolase [Streptococcus equi]
 gb|KIS18320.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz35]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_043039378.1| transketolase [Streptococcus equi]
 gb|KIS12441.1| transketolase [Streptococcus equi subsp. zooepidemicus SzAM60]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_043030096.1| transketolase [Streptococcus equi]
 gb|KIQ75314.1| transketolase [Streptococcus equi subsp. zooepidemicus]
 gb|KIS10166.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz57]
 gb|KIS16137.1| transketolase [Streptococcus equi subsp. zooepidemicus SzAM35]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_012680022.1| transketolase [Streptococcus equi]
 emb|CAW94958.1| putative transketolase [Streptococcus equi subsp. equi 4047]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_012516187.1| transketolase [Streptococcus equi]
 gb|ACG62931.1| transketolase [Streptococcus equi subsp. zooepidemicus MGCS10565]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_016800368.1| transketolase [Vibrio cyclitrophicus]
Length=663

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            KAVRVVS    + FD Q A+Y+E+VLPSDVTAR+++EAG    W K VG  GK IG+  F
Sbjct  575  KAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIAVFWYKYVGFGGKIIGMTTF  634

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++K +G T
Sbjct  635  GESAPAGELFKMFGFT  650



>ref|WP_042530756.1| transketolase [Corynebacterium singulare]
Length=703

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfg  328
            A RVVS  C E FD+Q ADY+E+VLPS V ARVS+EAG +  W K  G+ G+ + ++ FG
Sbjct  611  ATRVVSAPCLEWFDEQDADYRESVLPSAVLARVSVEAGISMPWHKYTGSFGRTVSLEHFG  670

Query  327  ASAPAGKIYKEYGIT  283
            ASAPAG++++++G T
Sbjct  671  ASAPAGELFEKFGFT  685



>ref|WP_004225435.1| transketolase [Streptococcus criceti]
 gb|EHI73468.1| transketolase [Streptococcus criceti HS-6]
Length=661

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A YKE+VLP+ VT R++IEAG++FGWGK VG  GKA+ ID +GA
Sbjct  577  VRVVSMPAQNIFDEQEATYKESVLPAAVTKRLAIEAGSSFGWGKYVGLAGKALTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP GKI++EYG T
Sbjct  637  SAPGGKIFEEYGFT  650



>gb|ERK13722.1| Transketolase [Pantoea sp. AS-PWVM4]
Length=160

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            +RVVS  C ++FD Q A Y+E+VLPS V ARV++EAG T  W K VG  G  +G+  FG 
Sbjct  72   IRVVSLPCTDVFDKQEAAYRESVLPSGVKARVAVEAGITDYWFKYVGLDGSIVGMTTFGE  131

Query  324  SAPAGKIYKEYGIT  283
            SAPAGK++ E+G T
Sbjct  132  SAPAGKLFPEFGFT  145



>ref|WP_043052330.1| transketolase [Streptococcus equi]
 gb|KIS05600.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz16]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_021321083.1| transketolase [Streptococcus equi]
 gb|EQB23181.1| transketolase [Streptococcus equi subsp. zooepidemicus SzS31A1]
 gb|KIS04806.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz12is]
 gb|KIS06101.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz5]
 gb|KIS16602.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz4is]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>gb|AJI78869.1| transketolase [Corynebacterium singulare]
Length=733

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -3

Query  507  AVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfg  328
            A RVVS  C E FD+Q ADY+E+VLPS V ARVS+EAG +  W K  G+ G+ + ++ FG
Sbjct  641  ATRVVSAPCLEWFDEQDADYRESVLPSAVLARVSVEAGISMPWHKYTGSFGRTVSLEHFG  700

Query  327  ASAPAGKIYKEYGIT  283
            ASAPAG++++++G T
Sbjct  701  ASAPAGELFEKFGFT  715



>ref|WP_042671209.1| transketolase [Streptococcus equi]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_043053375.1| transketolase [Streptococcus equi]
 gb|KIS11806.1| transketolase [Streptococcus equi subsp. zooepidemicus Sz105]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_036626426.1| transketolase, partial [Pantoea sp. AS-PWVM4]
Length=163

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            +RVVS  C ++FD Q A Y+E+VLPS V ARV++EAG T  W K VG  G  +G+  FG 
Sbjct  75   IRVVSLPCTDVFDKQEAAYRESVLPSGVKARVAVEAGITDYWFKYVGLDGSIVGMTTFGE  134

Query  324  SAPAGKIYKEYGIT  283
            SAPAGK++ E+G T
Sbjct  135  SAPAGKLFPEFGFT  148



>ref|WP_003044835.1| transketolase [Streptococcus canis]
 gb|EIQ82485.1| transketolase [Streptococcus canis FSL Z3-227]
Length=661

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A+YKEN+LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQSAEYKENILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>ref|WP_012677467.1| transketolase [Streptococcus equi]
 emb|CAW98230.1| putative transketolase [Streptococcus equi subsp. zooepidemicus]
Length=662

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+QPA YKE +LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  577  VRVVSMPSQNIFDEQPASYKEEILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGA  636

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  637  SAPGNRIFEEYGFT  650



>emb|CAF24238.1| probable transketolase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=677

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV+S  CW LF+ QP DYKE++   D+  RVSIEAG   GW K +G  G AI ++ F
Sbjct  593  KNVRVISMPCWALFEKQPIDYKESLFGGDIGKRVSIEAGVDLGWHKYIGRDGIAICMEHF  652

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG + KE+G T
Sbjct  653  GASAPAGVLAKEFGFT  668



>ref|XP_011077266.1| PREDICTED: transketolase, chloroplastic-like [Sesamum indicum]
Length=749

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGT  391
            + VRVVS VCW LFD QPA+YKE VLP  V  RVS+EAG+
Sbjct  660  RRVRVVSLVCWRLFDQQPAEYKEEVLPPGVPRRVSVEAGS  699



>ref|WP_044045188.1| transketolase [Candidatus Protochlamydia amoebophila]
Length=673

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV+S  CW LF+ QP DYKE++   D+  RVSIEAG   GW K +G  G AI ++ F
Sbjct  589  KNVRVISMPCWALFEKQPIDYKESLFGGDIGKRVSIEAGVDLGWHKYIGRDGIAICMEHF  648

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG + KE+G T
Sbjct  649  GASAPAGVLAKEFGFT  664



>ref|WP_042282387.1| transketolase [Candidatus Protochlamydia sp. R18]
Length=673

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRV+S  CW LF+ QP DYKE++   D+  RVSIEAG   GW K +G  G AI ++ F
Sbjct  589  KNVRVISMPCWALFEKQPIDYKESLFGGDIGKRVSIEAGVDLGWHKYIGRDGIAICMEHF  648

Query  330  gASAPAGKIYKEYGIT  283
            GASAPAG + KE+G T
Sbjct  649  GASAPAGVLAKEFGFT  664



>gb|ABG77187.1| transketolase 1, partial [Candidatus Endoriftia persephone str. 
Hot96_1+Hot96_2]
Length=249

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS  C   FD Q ADYKE+VLP+  TARV++EA  T  W K VG  GK IG+D+F
Sbjct  161  KKVRVVSMPCTNAFDAQDADYKESVLPAACTARVAVEAAVTDSWYKYVGLNGKVIGVDRF  220

Query  330  gASAPAGKIYKEYGIT  283
            G SAPAG+++KE+G T
Sbjct  221  GESAPAGQLFKEFGFT  236



>ref|WP_027969208.1| hypothetical protein, partial [Streptococcus pyogenes]
Length=226

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A+YKE++LP+ VT R++IEAG++FGW K VG  GK + ID +GA
Sbjct  142  VRVVSMPSQNIFDEQSAEYKESILPAAVTKRLAIEAGSSFGWAKYVGLSGKTLTIDTWGA  201

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  202  SAPGNRIFEEYGFT  215



>gb|KHN48843.1| Transketolase, chloroplastic [Glycine soja]
Length=578

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTF  385
            K V VVSFV WELFD+Q  +Y ENVLP+ V ARVSIEAG+TF
Sbjct  521  KTVIVVSFVSWELFDEQTDEYDENVLPASVIARVSIEAGSTF  562



>ref|WP_023071196.1| transketolase [Leptolyngbya sp. Heron Island J]
 gb|ESA38068.1| transketolase [Leptolyngbya sp. Heron Island J]
Length=665

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            + VRVVS  CWELF+ Q A YKE+VLP  VT R+++EAG + GWGK  GA+G  I +D+F
Sbjct  579  QKVRVVSMPCWELFEAQDAAYKESVLPKAVTKRLAVEAGISMGWGKYYGAEGDIISVDRF  638

Query  330  gASAPAGKIYKEYGIT  283
            GASAP G+I +E+G T
Sbjct  639  GASAPGGRIMQEFGYT  654



>ref|WP_017649153.1| transketolase, partial [Streptococcus agalactiae]
 gb|EPX01457.1| transketolase, partial [Streptococcus agalactiae MRI Z1-209]
Length=184

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  504  VRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkfgA  325
            VRVVS     +FD+Q A Y+E VLPS VT R++IEAG++FGWGK VG  G  + ID +GA
Sbjct  100  VRVVSMPAQNIFDEQEASYQEQVLPSAVTKRLAIEAGSSFGWGKYVGLNGLTLTIDTWGA  159

Query  324  SAPAGKIYKEYGIT  283
            SAP  +I++EYG T
Sbjct  160  SAPGNRIFEEYGFT  173



>ref|WP_017739732.1| transketolase [Scytonema hofmanni]
Length=671

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  510  KAVRVVSFVCWELFDDQPADYKENVLPSDVTARVSIEAGTTFgwgkivgakgkaigidkf  331
            K VRVVS   WE+F++QPADY+E+VLP  +T R+++EA ++FGW + + ++G  I +++F
Sbjct  583  KKVRVVSLPSWEIFEEQPADYRESVLPKAITKRLAVEAASSFGWARYLSSEGAMISVERF  642

Query  330  gASAPAGKIYKEYGIT  283
            G SAP G   +++G T
Sbjct  643  GVSAPGGIAMEKFGYT  658



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115