BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS121F03

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   5e-40   Nicotiana tomentosiformis
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            152   1e-39   Nicotiana sylvestris
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     147   9e-38   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    147   1e-37   Eucalyptus grandis [rose gum]
gb|KJB65824.1|  hypothetical protein B456_010G114900                    144   9e-37   Gossypium raimondii
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      144   1e-36   Gossypium arboreum [tree cotton]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    143   2e-36   Gossypium raimondii
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       142   4e-36   Solanum tuberosum [potatoes]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             142   5e-36   Populus trichocarpa [western balsam poplar]
emb|CBI21043.3|  unnamed protein product                                141   6e-36   Vitis vinifera
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       142   8e-36   Vitis vinifera
gb|KJB82811.1|  hypothetical protein B456_013G215000                    141   1e-35   Gossypium raimondii
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   1e-35   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   1e-35   Populus euphratica
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      140   4e-35   Gossypium arboreum [tree cotton]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   7e-35   Sesamum indicum [beniseed]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             138   1e-34   Citrus clementina [clementine]
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             137   2e-34   Phaseolus vulgaris [French bean]
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             137   4e-34   
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   6e-34   Populus euphratica
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  136   6e-34   Cucumis sativus [cucumbers]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         136   8e-34   Jatropha curcas
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       134   3e-33   Citrus sinensis [apfelsine]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       134   4e-33   
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    134   5e-33   Glycine max [soybeans]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            134   6e-33   Glycine soja [wild soybean]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    134   6e-33   
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                133   1e-32   Erythranthe guttata [common monkey flower]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    132   2e-32   Gossypium raimondii
ref|XP_002308665.2|  grr1 family protein                                131   4e-32   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       131   5e-32   Populus euphratica
ref|XP_002524506.1|  grr1, plant, putative                              130   8e-32   Ricinus communis
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   1e-31   Fragaria vesca subsp. vesca
emb|CAN82790.1|  hypothetical protein VITISV_030601                     129   7e-31   Vitis vinifera
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   1e-30   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   2e-30   Populus euphratica
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       125   5e-30   Vitis vinifera
ref|XP_007011864.1|  EIN3-binding F box protein 1                       125   1e-29   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            124   2e-29   Cucumis melo [Oriental melon]
ref|XP_002515516.1|  grr1, plant, putative                              124   2e-29   Ricinus communis
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   3e-29   Cucumis sativus [cucumbers]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   4e-29   Cucumis sativus [cucumbers]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             123   5e-29   
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             122   5e-29   Prunus persica
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   6e-29   Cicer arietinum [garbanzo]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   6e-29   Cucumis melo [Oriental melon]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   7e-29   
emb|CBI28209.3|  unnamed protein product                                121   8e-29   Vitis vinifera
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   9e-29   
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    122   1e-28   Glycine max [soybeans]
ref|XP_003588766.1|  Ein3-binding f-box protein                         121   2e-28   Medicago truncatula
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    120   3e-28   Prunus mume [ume]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            120   5e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            120   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002880682.1|  ein3-binding F box protein 1                       119   8e-28   
ref|NP_565597.1|  EIN3-binding F-box protein 1                          119   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    119   9e-28   Gossypium raimondii
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         119   1e-27   Jatropha curcas
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             119   1e-27   Capsella rubella
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    119   2e-27   
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       119   2e-27   
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      117   3e-27   Gossypium arboreum [tree cotton]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            117   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             117   6e-27   Phaseolus vulgaris [French bean]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            117   7e-27   Sesamum indicum [beniseed]
gb|KJB54023.1|  hypothetical protein B456_009G017100                    117   7e-27   Gossypium raimondii
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    116   1e-26   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    116   1e-26   
gb|AFT92041.1|  EIN3 binding F-box 1                                    116   1e-26   Malus domestica [apple tree]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   1e-26   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   2e-26   
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    115   2e-26   Arabis alpina [alpine rockcress]
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   3e-26   
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             114   5e-26   Phaseolus vulgaris [French bean]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       114   8e-26   
gb|KHN07078.1|  EIN3-binding F-box protein 1                            113   1e-25   Glycine soja [wild soybean]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             111   5e-25   Eutrema salsugineum [saltwater cress]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   8e-25   Glycine max [soybeans]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   1e-24   Glycine max [soybeans]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          110   1e-24   Amborella trichopoda
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   2e-24   Solanum tuberosum [potatoes]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       108   5e-24   Tarenaya hassleriana [spider flower]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             108   6e-24   Eutrema salsugineum [saltwater cress]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             108   9e-24   Phaseolus vulgaris [French bean]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   1e-23   Solanum lycopersicum
ref|XP_010086585.1|  hypothetical protein L484_002248                   107   2e-23   Morus notabilis
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       107   2e-23   Cicer arietinum [garbanzo]
gb|EPS63879.1|  f-box family protein                                    107   3e-23   Genlisea aurea
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             106   3e-23   Phaseolus vulgaris [French bean]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   7e-23   Eucalyptus grandis [rose gum]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    105   7e-23   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    105   7e-23   
emb|CDX76980.1|  BnaC04g37750D                                          105   7e-23   
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             105   8e-23   Capsella rubella
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   1e-22   Nicotiana tomentosiformis
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                104   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   3e-22   Nicotiana sylvestris
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            103   5e-22   Tarenaya hassleriana [spider flower]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   5e-22   Sesamum indicum [beniseed]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       102   6e-22   Brassica rapa
emb|CDY19807.1|  BnaA09g04600D                                          102   1e-21   Brassica napus [oilseed rape]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     101   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   4e-21   Solanum tuberosum [potatoes]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       100   5e-21   Solanum lycopersicum
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   5e-21   Phoenix dactylifera
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            100   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002874252.1|  ein3-binding F box protein 2                       100   6e-21   
emb|CDY35358.1|  BnaA04g14890D                                          100   7e-21   Brassica napus [oilseed rape]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          99.8    9e-21   Brassica rapa
emb|CAN83761.1|  hypothetical protein VITISV_043743                   99.8    9e-21   Vitis vinifera
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.0    2e-20   Elaeis guineensis
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     98.6    2e-20   Elaeis guineensis
emb|CDP10419.1|  unnamed protein product                              98.6    2e-20   Coffea canephora [robusta coffee]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like     98.6    2e-20   Glycine max [soybeans]
gb|KJB07737.1|  hypothetical protein B456_001G042600                  98.2    3e-20   Gossypium raimondii
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     97.8    4e-20   Nicotiana tomentosiformis
emb|CDX87090.1|  BnaC09g04050D                                        97.4    5e-20   
gb|AES73649.2|  EIN3-binding F-box-like protein                       97.4    6e-20   Medicago truncatula
ref|XP_003603398.1|  Ein3-binding f-box protein                       97.1    6e-20   
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    97.1    7e-20   Gossypium arboreum [tree cotton]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg           97.1    8e-20   
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.3    1e-19   Phoenix dactylifera
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.5    2e-19   
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     95.5    2e-19   Nicotiana sylvestris
gb|ACB59221.1|  F-box protein                                         95.5    2e-19   Brassica oleracea
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.1    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     94.7    5e-19   
gb|AFU61111.1|  F-box protein                                         93.6    1e-18   Capsicum annuum
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     93.6    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     93.2    2e-18   Cucumis sativus [cucumbers]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.8    2e-18   Cucumis melo [Oriental melon]
gb|KEH32122.1|  EIN3-binding F-box-like protein                       92.0    4e-18   Medicago truncatula
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           92.0    4e-18   
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 91.7    5e-18   Citrus sinensis [apfelsine]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.7    5e-18   Fragaria vesca subsp. vesca
ref|NP_197917.1|  EIN3-binding F-box protein 2                        91.7    6e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AES91540.2|  EIN3-binding F-box-like protein                       91.7    6e-18   Medicago truncatula
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     91.7    6e-18   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          91.3    7e-18   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                        91.3    7e-18   
dbj|BAH20224.1|  AT2G25490                                            90.5    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.1    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.7    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     89.4    3e-17   Camelina sativa [gold-of-pleasure]
gb|KEH32121.1|  EIN3-binding F-box-like protein                       88.6    6e-17   Medicago truncatula
gb|ABK25485.1|  unknown                                               87.0    2e-16   Picea sitchensis
ref|XP_003609344.1|  Ein3-binding f-box protein                       87.4    2e-16   
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     87.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003609343.1|  Ein3-binding f-box protein                       87.4    3e-16   
emb|CDX80503.1|  BnaC07g29410D                                        86.3    4e-16   
gb|KJB07621.1|  hypothetical protein B456_001G033400                  85.9    4e-16   Gossypium raimondii
emb|CDP13515.1|  unnamed protein product                              80.9    9e-16   Coffea canephora [robusta coffee]
gb|AEK81539.1|  EIN3 binding F-box 1                                  85.1    1e-15   Dianthus caryophyllus [carnation]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              84.0    2e-15   Erythranthe guttata [common monkey flower]
gb|EPS63568.1|  ein3-binding f-box protein 3                          82.8    5e-15   Genlisea aurea
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     73.9    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.9    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.9    2e-10   Tarenaya hassleriana [spider flower]
ref|NP_001237471.1|  grr1 protein                                     68.9    3e-10   
dbj|BAD15849.1|  putative F-box protein                               66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                        65.9    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          65.1    4e-09   Brachypodium distachyon [annual false brome]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     65.1    5e-09   Brachypodium distachyon [annual false brome]
dbj|BAJ88579.1|  predicted protein                                    63.5    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19526.1|  hypothetical protein F775_07091                       63.5    2e-08   
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    2e-08   Setaria italica
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  60.8    1e-07   
gb|EAZ01599.1|  hypothetical protein OsI_23635                        58.2    9e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAD35544.1|  putative F-box protein Fbl2                          57.8    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147557.1|  LOC100281166                                     57.4    1e-06   Zea mays [maize]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        55.8    4e-06   
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.5    5e-06   Oryza brachyantha
ref|XP_004240647.1|  PREDICTED: pentatricopeptide repeat-containi...  53.5    2e-05   Solanum lycopersicum
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     51.6    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        51.2    1e-04   Sorghum bicolor [broomcorn]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  50.8    2e-04   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  49.3    6e-04   



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   153 bits (387),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG   F PG  +YPS K+S  FLSL   VD YFPPCKR+R+  P++  E  + 
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTE--KQ  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            KK P+I+VLPDECLFEVFRRV DGKERSACAC SKRWLMLLSS+R DE
Sbjct  59   KKLPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDE  106



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   152 bits (384),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG + F PGG +YPS K+S  FLSL   VD YFPPCKR+RV  P++  E  + 
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTE--KQ  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLR  536
            KK P+I+VLPDECLFEV RRV DGKERSACAC SKRWLMLLSS+R
Sbjct  59   KKLPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIR  103



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   147 bits (370),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R DE+
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDEL  110



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R DE+
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDEL  110



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   144 bits (363),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEI  107



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   144 bits (363),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG ++F PGG +YP+ K+S  F   +P  D YFPPCKR RV +P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFF--YPNQDVYFPPCKRCRVSSPFVFAGGKFE  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP+IE+LPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI
Sbjct  59   QKKPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEI  107



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEI  107



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   142 bits (359),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 68/108 (63%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG + F+ GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTE--KK  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K  +I+VLPDECLFEV RR+ DGKERSA AC SKRWLMLLSS+  DE
Sbjct  59   QKLSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDE  106



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   142 bits (358),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   141 bits (356),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEI  110



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   142 bits (357),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEI  110



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG + FFPGG +YP+ K+S  F SL   VD YFP  KR+R+  P+V       
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK P+IE+LPDECLFE+FRR+  G+ERS+CAC SKRWL L+S++ RDEI
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEI  109



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   140 bits (352),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG ++F PGG MYP+ K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R DEI
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEI  109



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   139 bits (350),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F+F G ++F PGG +Y + K++G FL L   VD YFPP KR+R+  P V   G+  
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVV-SGV-A  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            K++P+IE+LPDECLFEVFRR+  G ERSACAC SKRWLMLLSS+ RDEI
Sbjct  59   KQQPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEI  107



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ RDEI
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEI  109



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   137 bits (346),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+  FSG ++F PGG +Y + K++  FL L P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ +DEI
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEI  110



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   137 bits (344),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +E + GG +Y +S D G   S+  RVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR+E
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNE  109



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   136 bits (343),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +E + GG  Y +S D G   S+ PRVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
               +P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR+E
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNE  109



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   136 bits (343),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K   +IE+LPDECLFE+FRR+ DGKERSACA  SKRWLMLLS++   E+
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL  110



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   136 bits (342),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            MSK+F F+G ++F PGGP+Y + K++   LSL   VD YFP  KR+R+  P V+  E  E
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ RDE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDEL  110



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS++ RDEI
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEI  109



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   134 bits (337),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG +    GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDH----GGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSE--KK  54

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             K  +I+VLPDECLFEV RR+ DGK+RSA AC SKRWLMLLSS+R DE
Sbjct  55   HKLSSIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDE  102



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   134 bits (336),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+  FSG ++F P G +Y + K++  FLSL P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ + EI
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEI  110



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   134 bits (336),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+  FSG ++F P G +Y + K++  FL L P+VD YFPP KR+RV TP V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K K ++E LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ ++EI
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEI  110



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   134 bits (336),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++   E+
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL  110



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS++ +FSG N F P   +Y + K+S  FLSL   V+ YF P KR+R+  P +     EP
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSG--EP  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            K+KP+IE+LPDECLFEVFRR+  G+ERSACA  SKRWLMLLSS+ +DEI
Sbjct  59   KQKPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEI  107



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+F FSG ++F PGG +Y + K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R +EI
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEI  109



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   131 bits (330),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IE LPDECLFE+FRR+  G ER ACAC SKRWL LLS++ +DE+
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDEL  110



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   131 bits (329),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G ER ACAC SK WL LLS++ +DE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDEL  110



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   130 bits (328),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +EF+ GG +  +  D G + S+   VD Y PPCKRAR+ +P +      E
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K+P+I+VLPDECLFE+FRR+  GKERSACAC SKRWL LLSS+RR E+
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAEL  110



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   130 bits (326),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+F F+G ++F PGG +Y + K++G FLSL  RVD Y+PP KR+R   P V   E  E
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+ +I+VLP+ECLFE+F+R+  G+ERSACAC SK+WL LLS++ RDE
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDE  109



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   129 bits (323),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +3

Query  246  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIE  422
            G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E K++ +I+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  423  VLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEI  210



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  398
            MSK+  F+G  +F+ G  +Y S K++  FLSL   VD YFPP KR+R+  P V  E L E
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             K++ TIEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++  +E
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNE  109



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+ TP +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR E
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSE  109



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   126 bits (316),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V  C+  E
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL+LLSS+RR EI
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEI  110



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   125 bits (315),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +3

Query  216  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  392
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  393  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR EI
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEI  112



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  425
            G ++F PGG +YP+ K+S  FLSL   VD YFP  K++R+  P V       +KKP+I+V
Sbjct  56   GSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDV  115

Query  426  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LPDECLFE+FRR+  G+ERSACAC SKRWL L+S++R+DEI
Sbjct  116  LPDECLFEIFRRLPGGQERSACACVSKRWLTLVSNIRKDEI  156



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V   +  E
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
             KK+ +IEVLPDECLFE+FRR+  G+ERS CAC SKRWL LLSS+RR E++
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVY  111



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +3

Query  222  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  395
            M+KIF F+     +FFP  P+YP+ KD+  FLSL P VD Y+P  KR+RV  P V    +
Sbjct  1    MAKIFGFTLKESEDFFPA-PIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEI  59

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
              KK+ +IEVLPDECLFE+F+R+ D + RS CAC SKRWLMLLSS+  +E +
Sbjct  60   LKKKEASIEVLPDECLFEIFKRLPDRETRSLCACVSKRWLMLLSSISGNEFY  111



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            MSK+  F+G ++F PGG +Y + K+ G FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             KK+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS+L RDE+
Sbjct  61   KKKQASIEVLPDECLFEIFRRL-PGEERSACAGVSKRWLGLLSNLSRDEL  109



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  222  MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  395
            M+KIF F+     +FFPG P+YP+ KD+  FLSL  +VD Y+P  KR+RV  P V   G 
Sbjct  1    MAKIFGFTLTESEDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVP-SGE  59

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
              KK+ +IEVLPDECLFE+F+R+ + + RS CAC SKRWLMLLSS+  +E +
Sbjct  60   ILKKEASIEVLPDECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFY  111



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   123 bits (309),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G+PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+ EI
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEI  110



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   123 bits (308),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+  P +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
               +P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR E
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSE  109



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   122 bits (307),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MSK+  F+G+++F PGG +Y + K+   FLS     D +F P KR+R+  P V + EG E
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SKRWL LLS++ RDE
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDE  109



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   122 bits (307),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MS++F FSG N F P G +Y + K++  F SL  +VD YFPP KR+RV  P V   E   
Sbjct  1    MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K+K +IE LPDECLFE+FRR+  G+ERS+CAC SKRWLMLLS++ + EI
Sbjct  60   QKQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEI  109



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   122 bits (307),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+ EI
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEI  110



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   122 bits (307),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  539
              KKP+I+VLPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRK  107



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +3

Query  216  IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  392
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  393  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR EI
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEI  112



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   122 bits (306),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +3

Query  255  EFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLEPKKKPTIEVLP  431
            +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E K   +IE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  432  DECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            DECLFE+FRR+ DGKERSACA  SKRWLMLLS++   E+
Sbjct  63   DECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL  101



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLE  398
            MSK+F F+G+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
             K K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++E +
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETY  111



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   121 bits (304),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            MS++F FSG N  F  G +Y + K++  FLSL P+VD Y+PP KR+RV  P V   E  E
Sbjct  1    MSQVFGFSGDN--FCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFE  58

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K+K +IE LPDECLFE+FRR+  G+ERSA AC SKRWLMLLS++ + EI
Sbjct  59   QKQKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEI  108



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE  59

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            KK+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  60   KKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDE  107



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV-GTPVVACEGLE  398
            MSK+    G+++F PGG +Y + K+   FLSL    D +F P KR+R+ GT V + EG E
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SK WL LLS++ RDE
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDE  109



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   120 bits (301),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P       E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFE-  59

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK  + +VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+
Sbjct  60   KKPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  108



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   120 bits (300),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLH--PRVDGYFPPCKRARVGTPVV-ACEG  392
            MS+IF+FSG+ EF+ GG +Y + K++GSFLSL     VD YFP  KRAR+  P+V   E 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  393  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  533
            LE KK+ +++VLPDECL+E+ RR+   +ERS+CA  SKRWLMLLSS+
Sbjct  60   LEQKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSI  106



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   120 bits (300),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K+ +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+
Sbjct  60   -KQVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  107



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   119 bits (298),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G N+F+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V   G E 
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVF-SGFE-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKEL  107



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   119 bits (298),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+IF F+G N+F+  G +YP+ KD+   LSL    D YFPP KR+RV  P +     E 
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL L+SS+R+ EI
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI  107



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   119 bits (298),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  398
            M  +  + G ++F+ GG  Y +S D G   S+  +VD Y+PP KRAR+  P V  E L E
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+ +I+VLPDECLFE+F+R+  G+ERS+CAC SK WLMLL S+R+ E
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGE  109



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   119 bits (298),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  398
            M  +  +SG +EF+ GG +  +S       S+   VD Y PPCKRAR  +P +      E
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFE  56

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K+P+I+VLPDECLFE+FRR+  GKERS+CAC SKRWL+LLSS++R EI
Sbjct  57   QNKQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEI  106



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   119 bits (297),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V       
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  402  KKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +KKP +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  107



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   119 bits (297),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 60/113 (53%), Positives = 74/113 (65%), Gaps = 8/113 (7%)
 Frame = +3

Query  213  PIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACE  389
            P P+S         +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E
Sbjct  55   PFPVSS-------EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGE  107

Query  390  GLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +E K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++   E+
Sbjct  108  EVESKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL  160



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   119 bits (297),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  249  HNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEV  425
            +++F PGGP+Y + KDS  FLSL   VD YFP  KR+R+  P V + E L+ KKK +I+V
Sbjct  59   NDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDV  118

Query  426  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LPDECLFE+FRR+   +ERSA AC SKRWLMLLS++R++E+
Sbjct  119  LPDECLFEIFRRL-PAEERSASACVSKRWLMLLSNIRQEEL  158



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+ E
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGE  109



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC-EGLE  398
            M  +  + G ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  539
              KKP+I+ LPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRK  107



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            M  +   SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRR  539
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLMLLSS+R+
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRK  107



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   117 bits (293),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K  +I+VLPDECLFE+FRR+   +ERS+CA  SK WL L+SS+R+ E+
Sbjct  60   -KPVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL  107



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   117 bits (292),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLS-LHPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +E +PGG   PS  + G   S +   +D Y+PP KR+R  + + A EG +
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR--SILEAIEGEQ  58

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              ++P IEVLPDECLFE+FRR+  GKERS CAC SKRWLML+SS+ +DEI
Sbjct  59   HYQEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEI  108



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS++F+F    +F PGG    + K S  FL L   VD YF P KR+R+  P V     EP
Sbjct  1    MSEVFDFKAVGKFCPGG-FLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSG--EP  57

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +++P+I+VLPDECLFEVFRR+  G+ERSACAC SKRWLML+SS+ RDEI
Sbjct  58   EQQPSIDVLPDECLFEVFRRLPGGQERSACACVSKRWLMLMSSIARDEI  106



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   117 bits (292),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+ E
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGE  109



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDE  106



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDE  106



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDE  106



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGY-F  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDE  106



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++  DE
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDE  106



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++  DE
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDE  106



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+IF FSG N+F+  G  YP+ KD    LSL   VD YFPPCKR+RV  P       E 
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEE-  59

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K  +I+VLP+ECLFE+FRR+   +ER+ACA  S+ WL L++S+R+ E+
Sbjct  60   -KPVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL  107



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   115 bits (288),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  398
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSL  533
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLML+SS+
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSI  105



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   114 bits (286),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  395
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YFP  KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            EPK+K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++E+
Sbjct  60   EPKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEV  110



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   114 bits (285),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +3

Query  243  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTI  419
            SG ++F+ GG  Y +S D G   S+  +VD Y PP KRAR+  P +  E   E  K+P+I
Sbjct  55   SGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNKQPSI  114

Query  420  EVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +VLP+ECLFE+F+R+  G+ERS+CAC SK WLMLL+S+R+ E
Sbjct  115  DVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSE  156



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +3

Query  240  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLEPKKKP-  413
            FSG+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E K+KP 
Sbjct  4    FSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQKPK  63

Query  414  -TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ + EI
Sbjct  64   TSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEI  109



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+IF F+G ++F P G +YP+ K++   LSL   VD YFPP K++RV  P+VA    E 
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLVA-RAFE-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            ++  +I+VLPDECLFE+FRR+   +ER ACA  SKRWL LLSS+ +DE+
Sbjct  59   QEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWLNLLSSIHQDEL  107



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+IF  +G N F P G +YP+ K++   LSL   VD YFPPCKR RV  P      +  
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAF--SVFE  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +   +I+VLPDECLFEVFRR+   +ERS CA  SKRWL LLS +R DE+
Sbjct  59   QDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWLNLLSGIRPDEL  107



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   111 bits (278),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDG-YFPPCKRARVGTPVVACEGLE  398
            MS+IF F+G N+F+  G +YP+ K++   LSL   VD  Y+PPCKR+RV     +     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L++S++++EI
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEI  110



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +3

Query  234  FEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKP  413
            +  +G ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   KK+ 
Sbjct  9    YWLAGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEV  67

Query  414  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE
Sbjct  68   SINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDE  111



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   111 bits (277),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPR--SIFEAIEREQ  58

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              + P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ +DEI
Sbjct  59   YYQDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEI  108



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPR--SIFEAIEREQ  58

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              ++P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ +DEI
Sbjct  59   YYQEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEI  108



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   110 bits (275),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSS-KDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-L  395
            MS + ++SG +    GGP+Y S   DS  FLSL P +D Y PP KR+RV  P V  E   
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              ++KP+++ LPDECLFE+ RRV+  ++RSACAC SK WLML S+++R E+
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEV  109



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 6/109 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P V     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLMLALG-HADIYCPVSKRARISGPFVV---EER  54

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P+IEVLP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R  +I
Sbjct  55   TKNPSIEVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI  103



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             ++  +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEI  110



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   108 bits (271),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS +F FSG  +FFPGG +Y         LS   ++D Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEDFFPGGSLY---------LSPGSQIDVYYPAHKRSRIAAPAIF-SGFE-  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + + +I+VLPDECLFE+FR +  G+ERSACAC SKRWL LLS++R +E+
Sbjct  50   QNQVSIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEV  98



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   108 bits (270),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FFPGG M+ S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFRFSGDEDFFPGGSMHLSPGSC-------PGV--YFPARKRLRIAAPSVQI-GFE-  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +IEVLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV  98



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   108 bits (269),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTP-VVACEGL  395
            M  +  +SG +E +PG     +  D G   +L   V+GY+  P KRAR+  P +     L
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
               +KP IEVLP+ECLFE+FRR+  GKERS+C+C SKRWLML+S + + EI+
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIY  112



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 6/109 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P +     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLILALG-HADIYCPVSKRARISGPFIV---EER  54

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P+IE+LP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R  +I
Sbjct  55   TKNPSIELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI  103



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 11/111 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--L  395
            M  +  +SG +EF+ GG   P         S+   VD Y PP KRAR+  P  A EG   
Sbjct  1    MPTLVNYSGDDEFYSGGSCSP--------YSIASHVDLYCPPSKRARISAPF-ALEGSFF  51

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            E  +KP+I+VLPDECLFE+ R V  GKER + AC SKRWLML+SS+RR E+
Sbjct  52   EQAEKPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEM  102



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +   SG +E +PGG M       G   ++   VD Y  P KRAR+  P      +E 
Sbjct  1    MPALVNSSGDDEMYPGGSM----DLGGCLYTISSNVDVYCSPTKRARISAPFTF-GAVEH  55

Query  402  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            K+  KP++E+LPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ + EI
Sbjct  56   KQDHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEI  106



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   107 bits (266),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MSK+  + G  E    G ++P S  S +F       + Y    KR R+  P VA  G E 
Sbjct  14   MSKVLGYGGVCEH-QAGMLFPRSDYSDTFFPFGNHFESYSLQRKRCRISAPFVA--GREV  70

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF  551
            K  P+IE+LPDECLFE+FRR+H  KE+S CAC SKRWLMLLSS+R+DE +
Sbjct  71   KLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKRWLMLLSSIRKDESY  120



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  395
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YF   KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            E K++ +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++EI
Sbjct  60   EQKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEI  110



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   105 bits (263),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEI  107



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   105 bits (263),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 55/121 (45%), Positives = 76/121 (63%), Gaps = 9/121 (7%)
 Frame = +3

Query  183  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  362
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  363  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRD  542
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RD
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRD  153

Query  543  E  545
            E
Sbjct  154  E  154



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   105 bits (263),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 55/121 (45%), Positives = 76/121 (63%), Gaps = 9/121 (7%)
 Frame = +3

Query  183  FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  362
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  363  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRD  542
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RD
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRD  153

Query  543  E  545
            E
Sbjct  154  E  154



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   105 bits (262),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV          E 
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEE  57

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K  +I+VLPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  58   EKPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  106



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   105 bits (262),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FF GG MY S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMYLSPGSC-------PGV--YFPAHKRLRIAAPSVF-SGFE-  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R+E+
Sbjct  50   QKQTSIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV  98



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  K+AR+  P V     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKKARISGPFVV---EE  53

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K P+IE+LPDECLFE+FRR+  G+ERSA AC SKRWLML S++R  EI
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEI  103



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS++F+FS  + F       P+SKDS    +L  RVD YF   KR+R+  P +A  G + 
Sbjct  1    MSEVFDFSDVHTF------CPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIA--GKKS  52

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            K + +IE LPDECLFE+ RR+  G+E +ACAC SKRWLMLLSS+++DE+
Sbjct  53   KMQSSIEALPDECLFEILRRLPRGRETNACACVSKRWLMLLSSMKKDEM  101



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   103 bits (258),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  KRAR+  P +     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKRARISGPFII---EE  53

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K P+IE+LPDECLFE+FRR+  G++RSA AC SKRWLML S++R  EI
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI  103



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   103 bits (256),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 69/108 (64%), Gaps = 11/108 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS +F FSG   +FPGG M          LS    +  Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEGYFPGGSM---------CLSPGSNIGVYYPARKRSRISAPSLF-SGFE-  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            + + +IEVLPDECLFE+FRR+  G+ERS CAC SK+WL LLS++RR+E
Sbjct  50   RNQASIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREE  97



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   103 bits (256),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 3/109 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFP-GGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +    G ++F+  GG +   S DSG   S+   V+ Y PP KR+R+  P +    L 
Sbjct  1    MPALVNIRGDDDFYSEGGSL--CSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLF  58

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+I+VLPDECLFE+FRR+  G+ERSA AC SKRWL +LSS+R  E
Sbjct  59   EDKRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSE  107



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   102 bits (255),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 64/108 (59%), Gaps = 11/108 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  EFF GG MY S+               Y PP KR RV  P +       
Sbjct  1    MSGIFSFSGDEEFFNGGSMYLSTGSCSGV---------YLPPRKRLRVAAPSLYSSF--N  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++ +E
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 64/108 (59%), Gaps = 11/108 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF F+G  EFF GG MY S                Y PP KR RV TP +       
Sbjct  1    MSGIFSFNGDEEFFNGGSMYLSPGSCSGV---------YLPPRKRLRVSTPSLYSSF--N  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++ +E
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEI  107



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   100 bits (250),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+
Sbjct  51   QKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEV  99



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P++E+LPDECLFE+ RR+  G+ER A AC SKRWL +LSS+R  EI
Sbjct  55   SKDPSLEILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEI  103



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSLG-HADVYCPPRKRARISGPFVV---EDR  54

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P++EVLPDECLFE+ RR+  G+ER A AC SKRWL +LSS++  EI
Sbjct  55   SKDPSLEVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEI  103



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P V   G + 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  402  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +KP     +I+VLPDECLFE+ RR+   +ERS  AC SKRWLMLLSS+R  EI
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEI  114



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-  50

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+
Sbjct  51   EKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV  99



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 10/109 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FF GG        S  +LS       YFP  KR R+  P V   G E 
Sbjct  1    MSGIFRFSGDEDFFLGG--------SSMYLSPGSCPGVYFPARKRLRIAAPSVF-SGFE-  50

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+
Sbjct  51   EKQTSIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV  99



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   100 bits (248),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  395
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  395
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +3

Query  294  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHD  470
            DSG  +S+   +D Y PP KR+R+  P +  E  LE +K+P+I+VLPDECLFE+ RR+  
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  471  GKERSACACTSKRWLMLLSSLRRDEI  548
            G+ERS+CA  SKRWLMLLSS+RR EI
Sbjct  62   GQERSSCARVSKRWLMLLSSIRRTEI  87



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 70/115 (61%), Gaps = 6/115 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  389
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  390  GLEPKKKP--TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            G E +K+   +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEM  115



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 6/115 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  389
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  390  GLEPKKKPT--IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            G E +K+ +  I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLS++R  E+
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEM  115



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/109 (48%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  398
            M  +  + G ++F+ G  +   S DSG  LS+    D Y PP KR+RV  P  V      
Sbjct  1    MPALVNYGGDDDFYTGRSI--CSADSGLVLSI---ADVYCPPRKRSRVSAPYAVDSRLFN  55

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             ++ P+IE LPDECLFE+FRR+   +ERSA AC SKRWLMLLSS+R  E
Sbjct  56   KERNPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSE  104



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 4/112 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTPVVACE--G  392
            M  +  +SG +E + GG    +  D G   +    VD Y+  P KRAR+   + A E  G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINA-LDAFEFLG  59

Query  393  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             E  +KPTI+VLPDECLFEVFR +  GKERS+CA  SKRWLML+SS+ + EI
Sbjct  60   REQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEI  111



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  398
            M  +  +SG +EFF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDEFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+ E
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE  105



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 17/109 (16%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  +SG +EF+ GGP          F S     + Y PP KR R+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISGPFVV---EDR  43

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P++E+LPDECLFE+ RR+  G+ERSA AC SKRWLMLLSS+R  EI
Sbjct  44   SKDPSLEILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEI  92



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 11/108 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +FF GG M+ S           P V  Y PP KR RV  P  +      
Sbjct  1    MSGIFSFSGDEDFFNGGTMHLSPGSC-------PGV--YLPPRKRLRVAAP--SPYSAFN  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++ +E
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  395
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ ++EI
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI  111



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  395
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ ++EI
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI  111



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACE-GLE  398
            M  +  +SG ++FF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDDFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+ E
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE  105



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +3

Query  336  YFPPCKRARVGTPVVACEG--LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKR  509
            Y+PP KRAR  +   A EG   E  +KP+IEVLPDECLFE+FRR+  GKERS+CAC SK+
Sbjct  13   YYPPSKRARKDSQF-AFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGGKERSSCACVSKK  71

Query  510  WLMLLSSLRR  539
            WLMLLSS+R+
Sbjct  72   WLMLLSSIRK  81



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P +   G   
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  402  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +KP     +I+VLPDECLFE+ R +   +ERS  AC SKRWLMLLSS+R  EI
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEI  114



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 3/90 (3%)
 Frame = +3

Query  279  YPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFR  458
            YP+S+ S  FLS     +  FPP KR  V T   A +  E +  P+IE+L DECLF+VF+
Sbjct  6    YPTSRQSSLFLSRGQNRNVNFPPRKRICVTT---ASKNFEQRNHPSIEILLDECLFKVFK  62

Query  459  RVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +  GKERS CAC SKRWL LLSS+R+D+I
Sbjct  63   HLPSGKERSVCACVSKRWLTLLSSIRKDKI  92



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 17/109 (16%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +   SG +EF+ GGP          F S     + Y PP KR R+ +P V     + 
Sbjct  1    MPTLVNHSGDDEFYSGGP----------FCS----AEVYCPPRKRVRISSPFVV---EDR  43

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             K P++E+LPDECLFE+ RR+  G+ERSA AC SK WLMLLSS+R  EI
Sbjct  44   SKDPSLEILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEI  92



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS+IF F+    F  G     + KD+   LSL    D YFPP KR RV  P +     E 
Sbjct  1    MSQIFSFAVKTIFTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLF-SAFE-  58

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL  +SS+R+ EI
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTTVSSIRQKEI  107



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 5/113 (4%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  392
            M+ + ++ G+++  PG P Y +  DS   LSL  + D Y PPCKR RV  P++   G   
Sbjct  1    MAALVKYGGNDDICPG-PFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKV  59

Query  393  LEPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            ++ +K+P +I+ LPDECLFE+ RR+   KERS  AC SK WLML+SS+R  E+
Sbjct  60   IDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSEL  112



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +3

Query  246  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV---ACEGLEPKKKP-  413
            G ++    GP+  +  DS   LS+   VD +FPP KR+R+  P +     +G E +K+  
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  414  -TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEM  126



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  398
            M  +  +SG +E + GG     S D G  LSL H  V  Y PP KR+R+  P V     +
Sbjct  1    MPALVNYSGDDELYSGGSF--CSADLGLMLSLGHAEV--YCPPRKRSRISGPFVV---ED  53

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              K P+++ LPDECLFE+ RR+  G+ER A +C SKRWLMLLSS+R  EI
Sbjct  54   RSKGPSLDDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEI  103



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  392
            M+ +    G+++  PGGP++ +  DS   LSL   VD Y PP KR RV  P++   G   
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  393  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
             + K + +I+ LP+ECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSEL  112



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +     L  
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPISSRINVCFQPNKRFRTNLKI---PFLGD  52

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
              KP+I+ LPDECLFE+F+R+ +GK +S+CAC SKRWLMLLSS+R ++
Sbjct  53   DTKPSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRMEK  100



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 16/112 (14%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +       P
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPVSSRINVCFQPNKRVRANLKI-------P  48

Query  402  KKK----PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
             ++    P+I+ LPDECLFE+F+R+++GK +S+CAC SKRWLMLLSS+R +E
Sbjct  49   FRRDDTNPSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIRVEE  100



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = +3

Query  237  EFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--K  410
            +F G  E +PGG M     D+G    ++   D +  P KR R+  P  +   LE ++  K
Sbjct  2    DFPGDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEHEQDLK  53

Query  411  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            PTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I
Sbjct  54   PTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  99



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  306  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  482
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  12   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  71

Query  483  SACACTSKRWLMLLSSLRRDEI  548
            S  AC SK+WLM+L+S+R+ EI
Sbjct  72   SFAACVSKKWLMMLTSIRKAEI  93



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  306  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  482
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  70

Query  483  SACACTSKRWLMLLSSLRRDEI  548
            S  AC SK+WLM+L+S+R+ EI
Sbjct  71   SFAACVSKKWLMMLTSIRKAEI  92



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 69/115 (60%), Gaps = 15/115 (13%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGG------PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-V  380
            M  +  +SG +EF+ GG      PM     D G  LS+       +PP KRAR+ +   +
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPM-----DLGCLLSVGSNA---YPPSKRARISSQFDI  52

Query  381  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
                 E +KK +IEVLP+ECLFE+FRR+H GKER  CA  SK+WLMLLSS+R  E
Sbjct  53   RGSSFEQEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE  107



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 52/109 (48%), Positives = 64/109 (59%), Gaps = 11/109 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS IF FSG  +   GG MY S           P V  Y+P  KR RV        G E 
Sbjct  1    MSGIFRFSGDEDCLLGGSMYLSPGSC-------PGV--YYPARKRLRVAATSFY-SGFE-  49

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +K+ +I+VLP+ECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+
Sbjct  50   EKQTSIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV  98



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 64/109 (59%), Gaps = 19/109 (17%)
 Frame = +3

Query  243  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK-----  407
            SG++E  PG   Y  S +          VD +  P KR R+  P     G  P+      
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTF--GPLPRALEHGQ  55

Query  408  --KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
              KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+DEI
Sbjct  56   DLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI  104



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  306  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  482
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  109  LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  168

Query  483  SACACTSKRWLMLLSSLRRDEI  548
            S  AC SK+WLM+L+S+R+ EI
Sbjct  169  SFAACVSKKWLMMLTSIRKAEI  190



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  395
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  396  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  542
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ RD
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRD  102



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVACEGL  395
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  396  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  542
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ RD
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRD  102



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +3

Query  294  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDG  473
            D+   LSL    D YFPP KR+RV  P +     E KK  +I+VLPDECLFE+FRR+   
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-KKPVSIDVLPDECLFEIFRRLSGP  58

Query  474  KERSACACTSKRWLMLLSSLRRDEI  548
            +ERSACA  SK+WL L+SS+R+ EI
Sbjct  59   QERSACAFVSKQWLTLVSSIRQKEI  83



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 15/101 (15%)
 Frame = +3

Query  273  PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV---------VACEGLEPKKKPTIEV  425
            P++P S     FLS    VD Y PP KRARV  P+         VA E  +P+   +I+ 
Sbjct  15   PLFPGSS---RFLSPGRNVDVYCPPRKRARVIAPLGFSFRGREEVAAEKQQPR---SIDT  68

Query  426  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LPDECLFE+ RR+   KERS+CAC SKRWLMLL S+R  E+
Sbjct  69   LPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSEL  109



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC--EGL  395
            M+ +   +G+++  PGGP++ +  DS   LSL    D Y PP KR R+ + +     +  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  396  EPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + K++P +I+ LPDECLFE+ RR+   KERS  AC SKRWLMLL S+R  E+
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSEL  112



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +3

Query  246  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  425
            G  +FF GG M+  S  S       P V  YFP  KR R+    V   G E +K+ +I+V
Sbjct  5    GDEDFFLGGSMHNLSPGSC------PGV--YFPARKRLRIAATSVF-SGFE-QKQTSIDV  54

Query  426  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            LPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+
Sbjct  55   LPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV  95



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  1    MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  52

Query  402  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I
Sbjct  53   EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  103



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            M  +  F G  +F  GGP +    D+  FLSL PR++   PP KR R G   +     +P
Sbjct  1    MPTLVSFRGDEDF--GGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLR-GNVTIPFRETKP  57

Query  402  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            K+  K  I +LPDECLFE+FR +   ++RS  AC SKRWLML SS+RR EI
Sbjct  58   KQEQKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEI  108



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  401
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  52   MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  103

Query  402  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I
Sbjct  104  EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  154



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +3

Query  336  YFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  512
            ++P CKRAR+  P V+  +  E +K+ +I VLPDECLFE+FR +  G+ERS CAC SK W
Sbjct  19   FYPSCKRARINAPFVLWGQESEQEKRSSINVLPDECLFEIFRHL-PGQERSNCACVSKHW  77

Query  513  LMLLSSLRRDEI  548
            L LLSS+RR E+
Sbjct  78   LTLLSSIRRAEM  89



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 64/107 (60%), Gaps = 15/107 (14%)
 Frame = +3

Query  243  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC---EGLEPKK--  407
            SG++E  PG   Y  S +          VD +  P KR R+  P         LE  +  
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTFGPLPRALEHGQDL  57

Query  408  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+DEI
Sbjct  58   KPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI  104



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 65/112 (58%), Gaps = 15/112 (13%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHP-RVDG-YFPPCKRARVGTPVVAC--E  389
            MS IF  SG +EFF GG         GS + L P    G Y P  KR RV +        
Sbjct  1    MSGIFRISGDDEFFTGG---------GSSMHLSPGSCPGVYLPARKRLRVASAAATSFYS  51

Query  390  GLEPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  542
              E +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ R+
Sbjct  52   SFE-EKQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIARN  102



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +3

Query  327  VDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSK  506
            +D YFP  KR+R      + E  E +KKP+IEVLPDECLFE+FR +  G+ERS+CAC SK
Sbjct  1    MDVYFPLSKRSRTSA---SGEKFE-QKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSK  56

Query  507  RWLMLLSSLRRDEI  548
            RWL+L+S++ + EI
Sbjct  57   RWLILVSNICKYEI  70



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  CLKSLNSVVTMSFSQGGLCTPVPRTRVPFCPFILVWMGIFLLARGLESVPLLLHVKDLSR  402
            CLK L SVVT +FS GG  T +PR+++ F P  L+WM  F LARGL S+P +  V+    
Sbjct  44   CLKCLISVVTRTFSLGGRYTQIPRSQICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLS  103

Query  403  RRSLQLKSFQMNASLRYSDVFMMAKKEVPVLVRPSVG  513
              S  LK FQMNASLR S V M  +++VPVLV  + G
Sbjct  104  GSSPPLKFFQMNASLRSSGVCMGVQRKVPVLVYLNAG  140



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 62/105 (59%), Gaps = 13/105 (12%)
 Frame = +3

Query  240  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KP  413
            FSG +E + G    PS+            VD Y PP KR RV  P V   G  P++  + 
Sbjct  8    FSGEDELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLW-GSNPEQNTRS  57

Query  414  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +I VLPDEC+FEVFRR+   +ERS CAC SK+WL +L+ +RR E+
Sbjct  58   SINVLPDECMFEVFRRL-PPQERSNCACVSKQWLTILTGIRRSEM  101



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +3

Query  288  SKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRV  464
            S DSG   S+    + Y PP KR+R+  P  +    L   K P+I+ LPDECLFE+F  +
Sbjct  21   SGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADDKTPSIDTLPDECLFEIFTHL  80

Query  465  HDGKERSACACTSKRWLMLLSSLRRDE  545
             +G+ERS  AC SKRWL +LSS+R  E
Sbjct  81   SNGRERSTSACVSKRWLSVLSSVRCSE  107



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  KRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSS  530
            KR RV  P VA    E K  P+I+ LPDECLFE+ RR+    E+SACAC SKRWLMLLSS
Sbjct  7    KRCRVNAPFVASR--EFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLMLLSS  64

Query  531  LRRDEIF  551
            + RDE +
Sbjct  65   ISRDESY  71



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 65/116 (56%), Gaps = 10/116 (9%)
 Frame = +3

Query  222  MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-------V  380
            M+ +    G ++   GG ++ +  DS   LSL   VD Y    KR RV  P+       V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  381  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            A +  +P+   +I+ LPDECLFE+ RR+   KERS  A  SKRWLMLLSS+R  E+
Sbjct  61   AYKKQQPR---SIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSEL  113



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query  336  YFPPCKRARVGTPVVACEGL-EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  512
            Y+PP KRAR+ + V++ E   E  ++ +IE+LPDECLFE+ RR+   KER    C SKRW
Sbjct  41   YYPPNKRARISSSVLSVESETEVSEQQSIEILPDECLFEILRRLPRVKERCLSLCVSKRW  100

Query  513  LMLLSSLRRDE  545
            L +L+S+R  E
Sbjct  101  LNVLTSMRLSE  111



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +3

Query  327  VDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSK  506
            VD Y+PP KRAR+          E   + +IE+LPDECLFE+ RR+   KER   +C S+
Sbjct  37   VDVYYPPGKRARLSE-----SEPEATDRSSIEILPDECLFEILRRLPGVKERCVSSCVSR  91

Query  507  RWLMLLSSLRRDE  545
            RWL +L+ +R  E
Sbjct  92   RWLSVLTMIRLSE  104



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 9/100 (9%)
 Frame = +3

Query  267  GGPMYPSSKD--SGSFLSLHPRVDGYFPPCKR--ARVGTPVVACEGLEPKK--KPTIEVL  428
            G P+YP+ K+  S   L++       F   +R  A V   + A  GL   +  + +IE L
Sbjct  57   GAPIYPNPKEHVSSCLLAVKLMFTFLF---RRGLASVFHLISAENGLSRSRSQRTSIESL  113

Query  429  PDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            PDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ + EI
Sbjct  114  PDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEI  153



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R  E+
Sbjct  61   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  111



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  396  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R  E+
Sbjct  53   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  103



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  PPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLML  521
            PPC  A V     A +  + ++ P+++ LPDECLFE+ RRV   + R A AC S+RWL L
Sbjct  38   PPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASACVSRRWLAL  97

Query  522  LSSLRRDEI  548
            L  +R  EI
Sbjct  98   LGGIRASEI  106



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  408  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+
Sbjct  69   QPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASEL  115



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/114 (36%), Positives = 56/114 (49%), Gaps = 27/114 (24%)
 Frame = +3

Query  273  PMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----------------ACEGLEPK  404
            P + +  D G  +S    + G F      R G PVV                A E +   
Sbjct  2    PAFHAYGDGGCLVSAPAELSGMF-----CRGGGPVVQQRKRSLVAASAVAAAAAECMRAS  56

Query  405  KK------PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            KK      P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+
Sbjct  57   KKQRQPPQPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSEL  110



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  408  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            +P+++VLPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+
Sbjct  354  QPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISEL  400



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            +++P+++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  42   REEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASE  89



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            + +P+++ +PDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  41   RDEPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  405  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R  EI
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEI  120



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  405  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R  EI
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEI  120



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  417  IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            ++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  402  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  545
            ++ P+++ LPDECLFE+ RRV     R A AC S+RWL LL S+R  E
Sbjct  57   RQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSE  102



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +3

Query  342  PPCKRARVGTPVVACEGLEPKKK--PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWL  515
            PPC  A      V       K++  P+++ LPDECLFE+ RRV   + R A    S+RWL
Sbjct  37   PPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARCASGAVSRRWL  96

Query  516  MLLSSL  533
             LL + 
Sbjct  97   ALLGAF  102



>ref|XP_004240647.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Solanum lycopersicum]
Length=630

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  471  GKERSACACTSKRWLMLLSSLRRDEIF  551
            G+ER ACAC SKRWLMLLSS+ RDE+F
Sbjct  526  GQERRACACVSKRWLMLLSSIHRDEVF  552



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 6/57 (11%)
 Frame = +3

Query  396  EPKKKPT------IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            EP +K T      I  LPDEC+ E+FR +   ++R +C   SKRWL L +++R  E+
Sbjct  62   EPVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMRISEL  118



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            P   P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  62   PLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  111



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  411  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  63   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  108



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  411  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  548
            P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  166  PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760