BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS121E03

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010323025.1|  PREDICTED: uncharacterized protein LOC101246...    211   2e-59   Solanum lycopersicum
ref|XP_004242314.1|  PREDICTED: uncharacterized protein LOC101246...    211   2e-59   Solanum lycopersicum
ref|XP_010323026.1|  PREDICTED: uncharacterized protein LOC101246...    211   2e-59   Solanum lycopersicum
ref|XP_006352810.1|  PREDICTED: uncharacterized protein LOC102580...    210   6e-59   Solanum tuberosum [potatoes]
ref|XP_006352811.1|  PREDICTED: uncharacterized protein LOC102580...    210   7e-59   Solanum tuberosum [potatoes]
ref|XP_006359390.1|  PREDICTED: uncharacterized protein LOC102597...    186   2e-50   Solanum tuberosum [potatoes]
ref|XP_010326579.1|  PREDICTED: uncharacterized protein LOC101250...    184   1e-49   Solanum lycopersicum
emb|CDP03506.1|  unnamed protein product                                182   4e-49   Coffea canephora [robusta coffee]
ref|XP_009781904.1|  PREDICTED: uncharacterized protein LOC104230...    180   2e-48   Nicotiana sylvestris
ref|XP_009781903.1|  PREDICTED: uncharacterized protein LOC104230...    180   2e-48   Nicotiana sylvestris
ref|XP_009598054.1|  PREDICTED: uncharacterized protein LOC104093...    179   3e-48   Nicotiana tomentosiformis
ref|XP_009598050.1|  PREDICTED: uncharacterized protein LOC104093...    179   4e-48   Nicotiana tomentosiformis
ref|XP_009598052.1|  PREDICTED: uncharacterized protein LOC104093...    179   5e-48   Nicotiana tomentosiformis
ref|XP_009797825.1|  PREDICTED: uncharacterized protein LOC104244168    170   7e-45   Nicotiana sylvestris
ref|XP_009781905.1|  PREDICTED: uncharacterized protein LOC104230...    166   2e-43   Nicotiana sylvestris
ref|XP_009598053.1|  PREDICTED: uncharacterized protein LOC104093...    165   4e-43   Nicotiana tomentosiformis
ref|XP_004247431.1|  PREDICTED: uncharacterized protein LOC101250...    157   2e-40   Solanum lycopersicum
ref|XP_006359391.1|  PREDICTED: uncharacterized protein LOC102597...    157   2e-40   Solanum tuberosum [potatoes]
ref|XP_009596692.1|  PREDICTED: uncharacterized protein LOC104092731    124   3e-32   
ref|XP_011079691.1|  PREDICTED: uncharacterized protein LOC105163...    116   4e-26   Sesamum indicum [beniseed]
ref|XP_011079690.1|  PREDICTED: uncharacterized protein LOC105163...    116   5e-26   Sesamum indicum [beniseed]
ref|XP_011079689.1|  PREDICTED: uncharacterized protein LOC105163...    115   5e-26   Sesamum indicum [beniseed]
ref|XP_011082476.1|  PREDICTED: uncharacterized protein LOC105165229    112   8e-25   Sesamum indicum [beniseed]
ref|XP_010259603.1|  PREDICTED: uncharacterized protein LOC104598...    110   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010259604.1|  PREDICTED: uncharacterized protein LOC104598...    110   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010269523.1|  PREDICTED: uncharacterized protein LOC104606...    107   7e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010269522.1|  PREDICTED: uncharacterized protein LOC104606...    107   7e-23   Nelumbo nucifera [Indian lotus]
ref|XP_007143843.1|  hypothetical protein PHAVU_007G106400g             105   2e-22   Phaseolus vulgaris [French bean]
ref|XP_007050879.1|  AAA-type ATPase family protein isoform 1           105   3e-22   
gb|KHG14286.1|  ATPase family AAA domain-containing protein 1           104   5e-22   Gossypium arboreum [tree cotton]
gb|KHN46575.1|  ATPase family AAA domain-containing protein 1           102   2e-21   Glycine soja [wild soybean]
gb|KJB41938.1|  hypothetical protein B456_007G128700                    102   2e-21   Gossypium raimondii
ref|XP_006575111.1|  PREDICTED: uncharacterized protein LOC100801477    102   3e-21   Glycine max [soybeans]
gb|KDO87288.1|  hypothetical protein CISIN_1g000858mg                   101   4e-21   Citrus sinensis [apfelsine]
gb|KDO87289.1|  hypothetical protein CISIN_1g000858mg                   101   4e-21   Citrus sinensis [apfelsine]
gb|KDO87287.1|  hypothetical protein CISIN_1g000858mg                   101   6e-21   Citrus sinensis [apfelsine]
gb|KDO87285.1|  hypothetical protein CISIN_1g000858mg                   101   6e-21   Citrus sinensis [apfelsine]
gb|KDO87286.1|  hypothetical protein CISIN_1g000858mg                   101   6e-21   Citrus sinensis [apfelsine]
gb|KDO87276.1|  hypothetical protein CISIN_1g000858mg                   101   6e-21   Citrus sinensis [apfelsine]
ref|XP_006444295.1|  hypothetical protein CICLE_v10018538mg             101   7e-21   Citrus clementina [clementine]
gb|KDO87275.1|  hypothetical protein CISIN_1g000858mg                   101   7e-21   Citrus sinensis [apfelsine]
gb|KDO87277.1|  hypothetical protein CISIN_1g000858mg                   101   7e-21   Citrus sinensis [apfelsine]
ref|XP_006444294.1|  hypothetical protein CICLE_v10018538mg             100   7e-21   
gb|KDO87278.1|  hypothetical protein CISIN_1g000858mg                   100   7e-21   Citrus sinensis [apfelsine]
ref|XP_007050882.1|  ATPase family AAA domain-containing protein ...    100   1e-20   
ref|XP_006479928.1|  PREDICTED: uncharacterized protein LOC102620169  99.8    2e-20   Citrus sinensis [apfelsine]
ref|XP_008451597.1|  PREDICTED: uncharacterized protein LOC103492...  97.4    1e-19   Cucumis melo [Oriental melon]
ref|XP_008451596.1|  PREDICTED: uncharacterized protein LOC103492...  97.4    1e-19   Cucumis melo [Oriental melon]
ref|XP_008451595.1|  PREDICTED: uncharacterized protein LOC103492...  97.4    1e-19   Cucumis melo [Oriental melon]
ref|XP_004136037.1|  PREDICTED: uncharacterized protein LOC101211144  97.4    1e-19   Cucumis sativus [cucumbers]
ref|XP_008235052.1|  PREDICTED: uncharacterized protein LOC103333915  94.4    1e-18   Prunus mume [ume]
ref|XP_006588596.1|  PREDICTED: uncharacterized protein LOC100794...  93.2    3e-18   
ref|XP_010097306.1|  ATPase family AAA domain-containing protein 1    93.2    3e-18   
gb|KJB49948.1|  hypothetical protein B456_008G146500                  93.2    4e-18   Gossypium raimondii
gb|KJB49954.1|  hypothetical protein B456_008G146500                  93.2    4e-18   Gossypium raimondii
gb|KHG01617.1|  ATPase family AAA domain-containing protein 1         92.0    8e-18   Gossypium arboreum [tree cotton]
ref|XP_006588599.1|  PREDICTED: uncharacterized protein LOC100794...  92.0    8e-18   
gb|KJB23264.1|  hypothetical protein B456_004G089000                  92.0    8e-18   Gossypium raimondii
gb|KJB23261.1|  hypothetical protein B456_004G089000                  92.0    8e-18   Gossypium raimondii
gb|KDO87279.1|  hypothetical protein CISIN_1g000858mg                 92.0    9e-18   Citrus sinensis [apfelsine]
gb|KJB23262.1|  hypothetical protein B456_004G089000                  92.0    9e-18   Gossypium raimondii
ref|XP_003536887.1|  PREDICTED: uncharacterized protein LOC100794...  92.0    9e-18   Glycine max [soybeans]
ref|XP_010652173.1|  PREDICTED: uncharacterized protein LOC100260666  91.3    1e-17   Vitis vinifera
emb|CBI36835.3|  unnamed protein product                              91.3    1e-17   Vitis vinifera
ref|XP_009342112.1|  PREDICTED: uncharacterized protein LOC103934...  91.3    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009342111.1|  PREDICTED: uncharacterized protein LOC103934...  91.3    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009342114.1|  PREDICTED: uncharacterized protein LOC103934...  91.3    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_008386656.1|  PREDICTED: uncharacterized protein LOC103449148  90.5    3e-17   
ref|XP_008368992.1|  PREDICTED: uncharacterized protein LOC103432...  90.1    4e-17   Malus domestica [apple tree]
gb|KJB49953.1|  hypothetical protein B456_008G146500                  89.4    6e-17   Gossypium raimondii
gb|KHN03730.1|  ATPase family AAA domain-containing protein 1         85.9    9e-16   Glycine soja [wild soybean]
ref|XP_006588598.1|  PREDICTED: uncharacterized protein LOC100794...  84.0    4e-15   Glycine max [soybeans]
gb|KHN03731.1|  Protein MSP1                                          84.0    4e-15   Glycine soja [wild soybean]
ref|XP_004495974.1|  PREDICTED: uncharacterized protein LOC101498262  81.3    4e-14   Cicer arietinum [garbanzo]
ref|XP_004292654.1|  PREDICTED: uncharacterized protein LOC101311652  81.3    4e-14   Fragaria vesca subsp. vesca
gb|KDP28140.1|  hypothetical protein JCGZ_13911                       80.9    4e-14   Jatropha curcas
ref|XP_006575112.1|  PREDICTED: uncharacterized protein LOC100800...  79.0    2e-13   Glycine max [soybeans]
ref|XP_006588597.1|  PREDICTED: uncharacterized protein LOC100794...  78.2    3e-13   
ref|XP_003591554.1|  Katanin p60 ATPase-containing subunit            74.3    6e-12   
ref|XP_003591553.1|  Katanin p60 ATPase-containing subunit            74.3    7e-12   
ref|XP_003591552.1|  Katanin p60 ATPase-containing subunit            74.3    7e-12   Medicago truncatula
ref|XP_010684533.1|  PREDICTED: uncharacterized protein LOC104899...  73.9    9e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007050880.1|  ATP binding protein, putative isoform 2          72.0    3e-11   
ref|XP_007050881.1|  ATP binding protein, putative isoform 3          72.0    3e-11   
ref|XP_010248968.1|  PREDICTED: uncharacterized protein LOC104591...  71.6    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010248969.1|  PREDICTED: uncharacterized protein LOC104591...  71.6    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002301474.2|  AAA-type ATPase family protein                   71.6    5e-11   
ref|XP_011008046.1|  PREDICTED: uncharacterized protein LOC105113...  71.2    6e-11   Populus euphratica
ref|XP_011008045.1|  PREDICTED: uncharacterized protein LOC105113...  71.2    6e-11   Populus euphratica
ref|XP_006418289.1|  hypothetical protein EUTSA_v10006579mg           71.2    7e-11   
ref|XP_006418290.1|  hypothetical protein EUTSA_v10006579mg           71.2    7e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010684534.1|  PREDICTED: uncharacterized protein LOC104899...  70.1    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU46684.1|  hypothetical protein MIMGU_mgv1a000404mg              70.1    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_006396458.1|  hypothetical protein EUTSA_v10028366mg           69.7    2e-10   
ref|XP_006396457.1|  hypothetical protein EUTSA_v10028366mg           69.7    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_002892133.1|  AAA-type ATPase family protein                   69.7    2e-10   
ref|XP_004495973.1|  PREDICTED: uncharacterized protein LOC101497938  69.3    3e-10   Cicer arietinum [garbanzo]
ref|XP_011033559.1|  PREDICTED: uncharacterized protein LOC105132009  68.6    5e-10   Populus euphratica
gb|KHN46576.1|  Spastin                                               67.4    1e-09   Glycine soja [wild soybean]
ref|XP_009391006.1|  PREDICTED: uncharacterized protein LOC103977266  67.0    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321014.1|  AAA-type ATPase family protein                   66.2    2e-09   
ref|XP_006848423.1|  hypothetical protein AMTR_s00013p00232570        65.9    3e-09   Amborella trichopoda
ref|XP_009134429.1|  PREDICTED: uncharacterized protein LOC103858761  65.1    5e-09   Brassica rapa
ref|XP_004173001.1|  PREDICTED: uncharacterized protein LOC101225352  61.6    7e-09   
gb|KFK30845.1|  hypothetical protein AALP_AA6G033000                  64.7    8e-09   Arabis alpina [alpine rockcress]
emb|CDY18018.1|  BnaC03g30900D                                        64.3    1e-08   Brassica napus [oilseed rape]
emb|CDX90936.1|  BnaA03g26160D                                        64.3    1e-08   
ref|XP_009414467.1|  PREDICTED: uncharacterized protein LOC103995...  64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414468.1|  PREDICTED: uncharacterized protein LOC103995...  64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457286.1|  PREDICTED: uncharacterized protein LOC104738...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002523054.1|  ATP binding protein, putative                    63.2    2e-08   
ref|XP_010474879.1|  PREDICTED: uncharacterized protein LOC104754393  63.2    3e-08   Camelina sativa [gold-of-pleasure]
ref|NP_001117220.2|  AAA-type ATPase family protein                   62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171788.3|  AAA-type ATPase family protein                      62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAF02877.1|AC009525_11  Unknown protein                            62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801074.1|  PREDICTED: uncharacterized protein LOC103715...  62.0    5e-08   Phoenix dactylifera
gb|KGN44924.1|  hypothetical protein Csa_7G396390                     58.9    6e-08   Cucumis sativus [cucumbers]
emb|CDY22053.1|  BnaA09g00820D                                        62.0    7e-08   Brassica napus [oilseed rape]
ref|XP_009111283.1|  PREDICTED: uncharacterized protein LOC103836743  61.6    7e-08   Brassica rapa
ref|XP_010921817.1|  PREDICTED: uncharacterized protein LOC105045286  61.6    7e-08   Elaeis guineensis
emb|CDY50381.1|  BnaCnng19130D                                        60.8    1e-07   Brassica napus [oilseed rape]
ref|XP_010542858.1|  PREDICTED: uncharacterized protein LOC104815...  60.5    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010542859.1|  PREDICTED: uncharacterized protein LOC104815...  60.5    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010542857.1|  PREDICTED: uncharacterized protein LOC104815...  60.5    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_003591556.1|  Katanin p60 ATPase-containing subunit A-like...  60.5    2e-07   
gb|AES61807.2|  P-loop nucleoside triphosphate hydrolase superfam...  60.1    2e-07   Medicago truncatula
gb|KEH43221.1|  P-loop nucleoside triphosphate hydrolase superfam...  60.1    2e-07   Medicago truncatula
gb|KFK42647.1|  hypothetical protein AALP_AA1G022100                  60.1    3e-07   Arabis alpina [alpine rockcress]
ref|XP_009587828.1|  PREDICTED: uncharacterized protein LOC104085490  59.7    3e-07   
ref|XP_008800830.1|  PREDICTED: uncharacterized protein LOC103715088  58.9    6e-07   Phoenix dactylifera
ref|XP_007037955.1|  ATPase family AAA domain-containing protein ...  58.2    9e-07   
ref|XP_007037954.1|  ATPase family AAA domain-containing protein ...  58.2    1e-06   
ref|XP_010501293.1|  PREDICTED: uncharacterized protein LOC104778535  57.0    2e-06   
gb|KCW58479.1|  hypothetical protein EUGRSUZ_H01157                   57.4    2e-06   Eucalyptus grandis [rose gum]
ref|XP_008805743.1|  PREDICTED: uncharacterized protein LOC103718...  57.4    2e-06   Phoenix dactylifera
ref|XP_010069946.1|  PREDICTED: uncharacterized protein LOC104456...  57.4    2e-06   Eucalyptus grandis [rose gum]
gb|KCW58478.1|  hypothetical protein EUGRSUZ_H01157                   57.4    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010069947.1|  PREDICTED: uncharacterized protein LOC104456...  57.0    2e-06   Eucalyptus grandis [rose gum]
gb|KCW58480.1|  hypothetical protein EUGRSUZ_H01157                   57.0    2e-06   Eucalyptus grandis [rose gum]
ref|XP_006440095.1|  hypothetical protein CICLE_v100185461mg          56.6    3e-06   
ref|XP_006440096.1|  hypothetical protein CICLE_v100185461mg          56.6    3e-06   
ref|XP_010931645.1|  PREDICTED: uncharacterized protein LOC105052512  55.8    5e-06   Elaeis guineensis
ref|XP_010663739.1|  PREDICTED: uncharacterized protein LOC100266...  55.5    8e-06   Vitis vinifera
ref|XP_002279926.2|  PREDICTED: uncharacterized protein LOC100266...  55.1    9e-06   Vitis vinifera
ref|XP_010037429.1|  PREDICTED: uncharacterized protein LOC104426170  53.9    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010914430.1|  PREDICTED: uncharacterized protein LOC105039...  53.9    2e-05   Elaeis guineensis
gb|KCW49150.1|  hypothetical protein EUGRSUZ_K02736                   53.9    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010914431.1|  PREDICTED: uncharacterized protein LOC105039...  53.9    2e-05   Elaeis guineensis
gb|KDO52636.1|  hypothetical protein CISIN_1g000823mg                 53.1    4e-05   Citrus sinensis [apfelsine]
ref|XP_006477013.1|  PREDICTED: uncharacterized protein LOC102607540  53.1    4e-05   Citrus sinensis [apfelsine]
gb|KDO52637.1|  hypothetical protein CISIN_1g000823mg                 53.1    4e-05   Citrus sinensis [apfelsine]
gb|KDO52640.1|  hypothetical protein CISIN_1g000823mg                 53.1    4e-05   Citrus sinensis [apfelsine]
gb|KDO52638.1|  hypothetical protein CISIN_1g000823mg                 52.8    5e-05   Citrus sinensis [apfelsine]
ref|XP_009118737.1|  PREDICTED: uncharacterized protein LOC103843724  52.8    5e-05   Brassica rapa
ref|XP_007210914.1|  hypothetical protein PRUPE_ppa000404mg           52.4    7e-05   Prunus persica
gb|KDP30932.1|  hypothetical protein JCGZ_11308                       52.0    8e-05   Jatropha curcas
emb|CDY32485.1|  BnaA09g51110D                                        52.0    9e-05   Brassica napus [oilseed rape]
ref|XP_006303888.1|  hypothetical protein CARUB_v100081070mg          51.6    1e-04   
ref|XP_009411682.1|  PREDICTED: uncharacterized protein LOC103993374  52.0    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962808.1|  PREDICTED: protein argonaute 14-like isoform X1  51.2    1e-04   
emb|CDY18129.1|  BnaC05g01520D                                        51.2    1e-04   Brassica napus [oilseed rape]
ref|XP_009382545.1|  PREDICTED: uncharacterized protein LOC103970...  50.4    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382544.1|  PREDICTED: uncharacterized protein LOC103970...  50.4    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511201.1|  ATP binding protein, putative                    50.4    3e-04   Ricinus communis
emb|CDX91317.1|  BnaC02g27280D                                        50.1    4e-04   
ref|XP_008439688.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  49.3    7e-04   
gb|KJB08020.1|  hypothetical protein B456_001G059400                  49.3    7e-04   Gossypium raimondii
gb|KJB08017.1|  hypothetical protein B456_001G059400                  49.3    7e-04   Gossypium raimondii
gb|KJB08016.1|  hypothetical protein B456_001G059400                  49.3    8e-04   Gossypium raimondii
emb|CDX97266.1|  BnaA02g20570D                                        49.3    8e-04   
gb|KJB08013.1|  hypothetical protein B456_001G059400                  49.3    8e-04   Gossypium raimondii
gb|KJB08019.1|  hypothetical protein B456_001G059400                  49.3    8e-04   Gossypium raimondii
ref|XP_009342115.1|  PREDICTED: uncharacterized protein LOC103934...  49.3    8e-04   Pyrus x bretschneideri [bai li]
gb|KJB08018.1|  hypothetical protein B456_001G059400                  49.3    9e-04   Gossypium raimondii
ref|XP_002451231.1|  hypothetical protein SORBIDRAFT_05g026170        48.9    0.001   



>ref|XP_010323025.1| PREDICTED: uncharacterized protein LOC101246936 isoform X2 [Solanum 
lycopersicum]
Length=1249

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRR SSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1    MVETRRGSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RSADL GAS LKS +A +P K PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGK
Sbjct  61   VRSADLSGASVLKSSDASLPLKSPENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQLKSN+G AWGKL+SQ  QN HV +   T++VGQGRQCDL + DPSVSKSLC
Sbjct  121  KRQLKSNVGAAWGKLISQCSQNPHVVMHHPTYSVGQGRQCDLWIGDPSVSKSLC  174



>ref|XP_004242314.1| PREDICTED: uncharacterized protein LOC101246936 isoform X1 [Solanum 
lycopersicum]
Length=1251

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRR SSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1    MVETRRGSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RSADL GAS LKS +A +P K PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGK
Sbjct  61   VRSADLSGASVLKSSDASLPLKSPENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQLKSN+G AWGKL+SQ  QN HV +   T++VGQGRQCDL + DPSVSKSLC
Sbjct  121  KRQLKSNVGAAWGKLISQCSQNPHVVMHHPTYSVGQGRQCDLWIGDPSVSKSLC  174



>ref|XP_010323026.1| PREDICTED: uncharacterized protein LOC101246936 isoform X3 [Solanum 
lycopersicum]
Length=1219

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRR SSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1    MVETRRGSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RSADL GAS LKS +A +P K PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGK
Sbjct  61   VRSADLSGASVLKSSDASLPLKSPENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQLKSN+G AWGKL+SQ  QN HV +   T++VGQGRQCDL + DPSVSKSLC
Sbjct  121  KRQLKSNVGAAWGKLISQCSQNPHVVMHHPTYSVGQGRQCDLWIGDPSVSKSLC  174



>ref|XP_006352810.1| PREDICTED: uncharacterized protein LOC102580303 isoform X1 [Solanum 
tuberosum]
Length=1251

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRRSSSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1    MVETRRSSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RS DL GAS LKS +A +P K PE  + GEPLVSP+ LG + ID +KVK NGS LNRGK
Sbjct  61   VRSVDLAGASVLKSSDASLPLKSPENQVQGEPLVSPITLGHTVIDAEKVKLNGSTLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQLKSN+G AWGKL+SQ  QN HV + + T++VGQGRQCD  + DPSVSKSLC
Sbjct  121  KRQLKSNVGVAWGKLISQCSQNPHVVMHRPTYSVGQGRQCDFWIGDPSVSKSLC  174



>ref|XP_006352811.1| PREDICTED: uncharacterized protein LOC102580303 isoform X2 [Solanum 
tuberosum]
Length=1249

 Score =   210 bits (534),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRRSSSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1    MVETRRSSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RS DL GAS LKS +A +P K PE  + GEPLVSP+ LG + ID +KVK NGS LNRGK
Sbjct  61   VRSVDLAGASVLKSSDASLPLKSPENQVQGEPLVSPITLGHTVIDAEKVKLNGSTLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQLKSN+G AWGKL+SQ  QN HV + + T++VGQGRQCD  + DPSVSKSLC
Sbjct  121  KRQLKSNVGVAWGKLISQCSQNPHVVMHRPTYSVGQGRQCDFWIGDPSVSKSLC  174



>ref|XP_006359390.1| PREDICTED: uncharacterized protein LOC102597355 isoform X1 [Solanum 
tuberosum]
Length=1252

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 132/181 (73%), Gaps = 8/181 (4%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRRSSSS +   P  SS   NGKRSKA E+LSST+D LGEK+ G VN+SGPESAEQE
Sbjct  1    MVETRRSSSSKRSLSPPSSSLQNNGKRSKAVEALSSTNDTLGEKSQGGVNDSGPESAEQE  60

Query  225  IRSADLDGASALKSPE-------APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANG  383
            +RSADL GAS LKS +       A  P+K  E     EPLVSPM LGDSAIDV+K K+NG
Sbjct  61   VRSADLAGASVLKSSDDAAATAAAAAPQKSMETEGANEPLVSPMTLGDSAIDVEKSKSNG  120

Query  384  SALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSL  563
            SALNRGKKRQLKSN G AWGKLLSQ  QN H+ + +  +TVGQ R  DL + D +VSK+L
Sbjct  121  SALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPMYTVGQSRSSDLWIGDSTVSKAL  179

Query  564  C  566
            C
Sbjct  180  C  180



>ref|XP_010326579.1| PREDICTED: uncharacterized protein LOC101250339 isoform X1 [Solanum 
lycopersicum]
Length=1254

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 118/159 (74%), Gaps = 9/159 (6%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE-------  272
            NGKRSKA E+LSST+D LG K+ G VN+SGPESAEQE+RSADL GAS LKS +       
Sbjct  25   NGKRSKAVEALSSTNDTLGMKSQGGVNDSGPESAEQEVRSADLVGASVLKSSDDAAATPA  84

Query  273  -APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKL  449
             A  P+K  E     EPLVSPM LGDSAIDVDK K+NGSALNRGKKRQLKSN G AWGKL
Sbjct  85   AAAAPQKSMETEGANEPLVSPMTLGDSAIDVDKSKSNGSALNRGKKRQLKSN-GAAWGKL  143

Query  450  LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            LSQ  QN H+ + + T+TVGQ R+ DL + D +VSK LC
Sbjct  144  LSQCSQNPHLVMHRPTYTVGQSRESDLWIGDSTVSKDLC  182



>emb|CDP03506.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  224
            MVETRRSSS+SKRPLPSPSSPLP GKRSKA E+ SST+D  GE    A  ESG ES EQE
Sbjct  1    MVETRRSSSTSKRPLPSPSSPLPKGKRSKAGEASSSTNDSSGEVGIDAAKESGRESREQE  60

Query  225  IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  404
            +RSADL  A  LK  +  VPEKLPE  L  EPLVSPM LGDS ID++K K+ G  LNRGK
Sbjct  61   VRSADLTDADNLKLSDGEVPEKLPEGQLESEPLVSPMTLGDSVIDLEKTKSIGKVLNRGK  120

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KRQ+KS    AWGKLLSQ+ QN HV +  STFTVGQ RQ DL V DPSVSKSLC
Sbjct  121  KRQMKSKAAAAWGKLLSQFSQNRHVVISNSTFTVGQDRQSDLWVGDPSVSKSLC  174



>ref|XP_009781904.1| PREDICTED: uncharacterized protein LOC104230725 isoform X2 [Nicotiana 
sylvestris]
Length=1235

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADL  A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61   EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  402  KKRQLKSNLG-TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+G  AWGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  114  KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  169



>ref|XP_009781903.1| PREDICTED: uncharacterized protein LOC104230725 isoform X1 [Nicotiana 
sylvestris]
Length=1238

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADL  A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61   EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  402  KKRQLKSNLG-TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+G  AWGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  114  KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  169



>ref|XP_009598054.1| PREDICTED: uncharacterized protein LOC104093922 isoform X4 [Nicotiana 
tomentosiformis]
Length=1048

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61   EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  402  KKRQLKSNL-GTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+   AWGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  114  KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  169



>ref|XP_009598050.1| PREDICTED: uncharacterized protein LOC104093922 isoform X1 [Nicotiana 
tomentosiformis]
Length=1237

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61   EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  402  KKRQLKSNL-GTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+   AWGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  114  KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  169



>ref|XP_009598052.1| PREDICTED: uncharacterized protein LOC104093922 isoform X2 [Nicotiana 
tomentosiformis]
Length=1234

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61   EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  402  KKRQLKSNL-GTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+   AWGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  114  KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  169



>ref|XP_009797825.1| PREDICTED: uncharacterized protein LOC104244168 [Nicotiana sylvestris]
Length=1248

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 113/154 (73%), Gaps = 10/154 (6%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGA-SALKSPEAPVPEK  290
            NGKRSKA E+LSST+D LG KT GAVNES    AEQE+RSADL  A + LKS +A +P K
Sbjct  25   NGKRSKAAEALSSTNDTLGGKTQGAVNES----AEQEVRSADLAAAATVLKSSDASLPLK  80

Query  291  LPEAPLGGEPLVSPMILGDSAIDV-DKVKANGSALNRGKKRQLKSNL-GTAWGKLLSQYP  464
             PE  + GEPLVSPM LG S ID  +K K NGS   + KKRQLKSN+ G AW +L+SQ  
Sbjct  81   SPENQVDGEPLVSPMTLGHSVIDAAEKAKLNGS---KAKKRQLKSNVVGAAWAQLISQCS  137

Query  465  QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            QN H  + + T++VGQGRQCDLC+ DPSVSKSLC
Sbjct  138  QNPHFVMHRPTYSVGQGRQCDLCIGDPSVSKSLC  171



>ref|XP_009781905.1| PREDICTED: uncharacterized protein LOC104230725 isoform X3 [Nicotiana 
sylvestris]
Length=1233

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 130/176 (74%), Gaps = 14/176 (8%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADL  A       A VP+K  E     EPLVSPM L     DV+K KA  SALNRG
Sbjct  61   EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTL-----DVEKSKAKESALNRG  108

Query  402  KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+G A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  109  KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  164



>ref|XP_009598053.1| PREDICTED: uncharacterized protein LOC104093922 isoform X3 [Nicotiana 
tomentosiformis]
Length=1232

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 129/176 (73%), Gaps = 14/176 (8%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  221
            MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1    MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+RSADLD A       A VP+K  E     EPLVSPM L     DV+K KA  SALNRG
Sbjct  61   EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTL-----DVEKSKAKESALNRG  108

Query  402  KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKRQLKSN+  A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LC
Sbjct  109  KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLC  164



>ref|XP_004247431.1| PREDICTED: uncharacterized protein LOC101250339 isoform X2 [Solanum 
lycopersicum]
Length=1237

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 103/141 (73%), Gaps = 9/141 (6%)
 Frame = +3

Query  168  GEKTPGAVNESGPESAEQEIRSADLDGASALKSPE--------APVPEKLPEAPLGGEPL  323
            G+++ G VN+SGPESAEQE+RSADL GAS LKS +        A  P+K  E     EPL
Sbjct  26   GKRSKGGVNDSGPESAEQEVRSADLVGASVLKSSDDAAATPAAAAAPQKSMETEGANEPL  85

Query  324  VSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFT  503
            VSPM LGDSAIDVDK K+NGSALNRGKKRQLKSN G AWGKLLSQ  QN H+ + + T+T
Sbjct  86   VSPMTLGDSAIDVDKSKSNGSALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPTYT  144

Query  504  VGQGRQCDLCVDDPSVSKSLC  566
            VGQ R+ DL + D +VSK LC
Sbjct  145  VGQSRESDLWIGDSTVSKDLC  165



>ref|XP_006359391.1| PREDICTED: uncharacterized protein LOC102597355 isoform X2 [Solanum 
tuberosum]
Length=1235

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = +3

Query  168  GEKTPGAVNESGPESAEQEIRSADLDGASALKSPE-------APVPEKLPEAPLGGEPLV  326
            G+++ G VN+SGPESAEQE+RSADL GAS LKS +       A  P+K  E     EPLV
Sbjct  25   GKRSKGGVNDSGPESAEQEVRSADLAGASVLKSSDDAAATAAAAAPQKSMETEGANEPLV  84

Query  327  SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  506
            SPM LGDSAIDV+K K+NGSALNRGKKRQLKSN G AWGKLLSQ  QN H+ + +  +TV
Sbjct  85   SPMTLGDSAIDVEKSKSNGSALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPMYTV  143

Query  507  GQGRQCDLCVDDPSVSKSLC  566
            GQ R  DL + D +VSK+LC
Sbjct  144  GQSRSSDLWIGDSTVSKALC  163



>ref|XP_009596692.1| PREDICTED: uncharacterized protein LOC104092731 [Nicotiana tomentosiformis]
Length=153

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 87/121 (72%), Gaps = 10/121 (8%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDG-ASALKSPEAPVPEK  290
            NGKRSKA E+LSST+D LGEKT GAVN    ESAEQE+RSADL   A+ LKS +A +P K
Sbjct  25   NGKRSKAAEALSSTNDTLGEKTQGAVN----ESAEQEVRSADLAATATVLKSSDASLPLK  80

Query  291  LPEAPLGGEPLVSPMILGDSAID-VDKVKANGSALNRGKKRQLKSN-LGTAWGKLLSQYP  464
             PE  + GEPLVSPM LG S ID  +K K NGS   + KKRQLKSN +G AW +L+SQ  
Sbjct  81   SPENQVEGEPLVSPMTLGHSVIDAAEKAKLNGS---KAKKRQLKSNVVGAAWAQLISQCS  137

Query  465  Q  467
            Q
Sbjct  138  Q  138



>ref|XP_011079691.1| PREDICTED: uncharacterized protein LOC105163145 isoform X3 [Sesamum 
indicum]
Length=1197

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 82/132 (62%), Gaps = 15/132 (11%)
 Frame = +3

Query  171  EKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDS  350
            E+  GAV      + E E  SADL      K  +    E  PE        V+P   GDS
Sbjct  45   EEVVGAV-----AAKELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDS  89

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
            AIDV+K K  G ++NRGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL
Sbjct  90   AIDVEKGKPGGPSVNRGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDL  149

Query  531  CVDDPSVSKSLC  566
             V DP+VSKSLC
Sbjct  150  WVRDPTVSKSLC  161



>ref|XP_011079690.1| PREDICTED: uncharacterized protein LOC105163145 isoform X2 [Sesamum 
indicum]
Length=1223

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 82/132 (62%), Gaps = 15/132 (11%)
 Frame = +3

Query  171  EKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDS  350
            E+  GAV      + E E  SADL      K  +    E  PE        V+P   GDS
Sbjct  45   EEVVGAV-----AAKELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDS  89

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
            AIDV+K K  G ++NRGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL
Sbjct  90   AIDVEKGKPGGPSVNRGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDL  149

Query  531  CVDDPSVSKSLC  566
             V DP+VSKSLC
Sbjct  150  WVRDPTVSKSLC  161



>ref|XP_011079689.1| PREDICTED: uncharacterized protein LOC105163145 isoform X1 [Sesamum 
indicum]
Length=1230

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 82/132 (62%), Gaps = 15/132 (11%)
 Frame = +3

Query  171  EKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDS  350
            E+  GAV      + E E  SADL      K  +    E  PE        V+P   GDS
Sbjct  45   EEVVGAV-----AAKELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDS  89

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
            AIDV+K K  G ++NRGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL
Sbjct  90   AIDVEKGKPGGPSVNRGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDL  149

Query  531  CVDDPSVSKSLC  566
             V DP+VSKSLC
Sbjct  150  WVRDPTVSKSLC  161



>ref|XP_011082476.1| PREDICTED: uncharacterized protein LOC105165229 [Sesamum indicum]
 ref|XP_011082477.1| PREDICTED: uncharacterized protein LOC105165229 [Sesamum indicum]
Length=1230

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 10/117 (9%)
 Frame = +3

Query  216  EQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  395
            E E  SADL  +  +K  +    EK PE          P +  D+ ID +K K++G ++N
Sbjct  55   ELEAGSADLAISGVVKQSDDLTAEKSPE----------PAVEDDTVIDAEKGKSSGPSVN  104

Query  396  RGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            RGKKRQLKS+ G AWGKLLSQ  QN HV + + TFTVGQGRQCDL V DP+VSKSLC
Sbjct  105  RGKKRQLKSDTGIAWGKLLSQCSQNPHVVMHRPTFTVGQGRQCDLWVGDPTVSKSLC  161



>ref|XP_010259603.1| PREDICTED: uncharacterized protein LOC104598971 isoform X1 [Nelumbo 
nucifera]
Length=1244

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 94/158 (59%), Gaps = 7/158 (4%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE---A  275
            NGKR K  E+ SST+++      +T G+  ESG ES +QE+R +DL      K  +   A
Sbjct  25   NGKRLKVAEASSSTNEIPCVTPVETLGSSKESGCESHDQEVRLSDLSAFGPSKESDDCDA  84

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDK-VKANGSALNRGKKRQLKSNLGTAWGKLL  452
             + EK P+    GE L  P   G  AI+ D  V+  G+A+NR +KR  KS    AWG+LL
Sbjct  85   TMLEKSPDRNGEGEVLAPPSATGGPAIEADNAVELVGAAMNRARKRSTKSRTKVAWGRLL  144

Query  453  SQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            SQ  QN H+ +  S FTVGQG+QC+LC+ DPSVS  LC
Sbjct  145  SQCSQNPHLLMCGSPFTVGQGQQCNLCLRDPSVSTILC  182



>ref|XP_010259604.1| PREDICTED: uncharacterized protein LOC104598971 isoform X2 [Nelumbo 
nucifera]
Length=1227

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 94/158 (59%), Gaps = 7/158 (4%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE---A  275
            NGKR K  E+ SST+++      +T G+  ESG ES +QE+R +DL      K  +   A
Sbjct  25   NGKRLKVAEASSSTNEIPCVTPVETLGSSKESGCESHDQEVRLSDLSAFGPSKESDDCDA  84

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDK-VKANGSALNRGKKRQLKSNLGTAWGKLL  452
             + EK P+    GE L  P   G  AI+ D  V+  G+A+NR +KR  KS    AWG+LL
Sbjct  85   TMLEKSPDRNGEGEVLAPPSATGGPAIEADNAVELVGAAMNRARKRSTKSRTKVAWGRLL  144

Query  453  SQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            SQ  QN H+ +  S FTVGQG+QC+LC+ DPSVS  LC
Sbjct  145  SQCSQNPHLLMCGSPFTVGQGQQCNLCLRDPSVSTILC  182



>ref|XP_010269523.1| PREDICTED: uncharacterized protein LOC104606152 isoform X2 [Nelumbo 
nucifera]
Length=1248

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = +3

Query  114  NGKRSKATESLSSTDD---MLGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  275
            NGKRSK  E+ SS +    +L  +T G+  E G ES +QE R +D    D +    S +A
Sbjct  25   NGKRSKVAEASSSINGXPCVLPVETLGSSKEPGSESHDQEGRFSDPSVCDPSKEFDSCDA  84

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  455
             + EK  +    GE LVSP  +G  A++ D V  N + +NR +KR +KS    AWGKLLS
Sbjct  85   VMLEKPQDVNGEGETLVSPSSIGAPAMEDDNV--NNAVMNRARKRSIKSRAKVAWGKLLS  142

Query  456  QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q  QN H+ +  S FTVGQ +QC+LC+ DPSVS  LC
Sbjct  143  QCSQNPHLLMCGSPFTVGQSQQCNLCLRDPSVSTVLC  179



>ref|XP_010269522.1| PREDICTED: uncharacterized protein LOC104606152 isoform X1 [Nelumbo 
nucifera]
Length=1265

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = +3

Query  114  NGKRSKATESLSSTDD---MLGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  275
            NGKRSK  E+ SS +    +L  +T G+  E G ES +QE R +D    D +    S +A
Sbjct  25   NGKRSKVAEASSSINGXPCVLPVETLGSSKEPGSESHDQEGRFSDPSVCDPSKEFDSCDA  84

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  455
             + EK  +    GE LVSP  +G  A++ D V  N + +NR +KR +KS    AWGKLLS
Sbjct  85   VMLEKPQDVNGEGETLVSPSSIGAPAMEDDNV--NNAVMNRARKRSIKSRAKVAWGKLLS  142

Query  456  QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q  QN H+ +  S FTVGQ +QC+LC+ DPSVS  LC
Sbjct  143  QCSQNPHLLMCGSPFTVGQSQQCNLCLRDPSVSTVLC  179



>ref|XP_007143843.1| hypothetical protein PHAVU_007G106400g [Phaseolus vulgaris]
 gb|ESW15837.1| hypothetical protein PHAVU_007G106400g [Phaseolus vulgaris]
Length=1255

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 91/159 (57%), Gaps = 12/159 (8%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPE---AP  278
            N KRSK +E  SST       +   VNESGP  ESAE E+R +DL   ++LK+ +   A 
Sbjct  24   NTKRSKVSEDSSSTT----VPSVAPVNESGPANESAEPELRPSDLPDTTSLKAVDGCDAI  79

Query  279  VPEKLPEAPLGGEPLVSPMILGDSAID---VDKVKANGSALNRGKKRQLKSNLGTAWGKL  449
             P+K P  P+ GE LVSP  LG++A        V A  S   R KKR +K +   AW KL
Sbjct  80   SPDKSPSTPVEGEALVSPQCLGETAEKSKGAGAVAATVSTGGRSKKRPMKLSPKVAWAKL  139

Query  450  LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            LSQ  QN HV +   +FTVGQGR C+L + DP+V   LC
Sbjct  140  LSQCSQNPHVSISDLSFTVGQGRNCNLWLKDPTVGNMLC  178



>ref|XP_007050879.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
 gb|EOX95036.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
Length=1251

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 13/160 (8%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  278
            KRSKA+E  SS+ +  G    G +NE       SG +S   E+RS+DL  + + K+ +A 
Sbjct  27   KRSKASEPASSSTN--GAVVSGPLNEALGPPKESGSDSRVTELRSSDLRVSDSAKAVDAS  84

Query  279  VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK---SNLGTAWGK  446
            V +K  +A +    LVSP  LG++A+DV+K KA G+    R KKR  K   S     WGK
Sbjct  85   VTDKSADADVENGTLVSPGSLGEAAMDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGK  144

Query  447  LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            LLSQ+ QN H+ +  + FTVGQ RQC+LC+ DP+VS  LC
Sbjct  145  LLSQHSQNPHLVMCGTLFTVGQSRQCNLCLKDPNVSTVLC  184



>gb|KHG14286.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
Length=1247

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 91/160 (57%), Gaps = 13/160 (8%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  278
            KRSKA+E  SS+ +  G    G VNE       SG +S   E+RS+DL  + A K+ +A 
Sbjct  27   KRSKASEPASSSTN--GAAVSGPVNEALGPPKESGSDSRVTELRSSDLPVSDAAKAVDAS  84

Query  279  VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK---SNLGTAWGK  446
            VP+K  +  +    LVS   LG++A+D +  K   +    R KKR  K   S     WGK
Sbjct  85   VPDKSADVDVENGALVSHRSLGEAAVDAENAKVISAGFTARVKKRPTKPAKSGSKVPWGK  144

Query  447  LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            LLSQY QN HV +  + FTVGQ RQC+LC+ DPS+S  LC
Sbjct  145  LLSQYSQNPHVVMCGTIFTVGQSRQCNLCLKDPSISTVLC  184



>gb|KHN46575.1| ATPase family AAA domain-containing protein 1 [Glycine soja]
Length=1237

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 104/178 (58%), Gaps = 14/178 (8%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGA--VNESGP--ES  212
            MVETRRSSSSS +   S  SP  N KRSK +E  SST        P    VNESG   ES
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRSKVSEDSSST------TVPSVAPVNESGTANES  54

Query  213  AEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSAL  392
            AE E+R +DL   ++LK  +A  P++ P AP+ GE LVSP   GD+A  +  V    +A 
Sbjct  55   AEPELRPSDLPDTASLK--DAMSPDRSPSAPVEGEALVSPQCQGDTAEKLKGVPM--AAG  110

Query  393  NRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             R KKR  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC
Sbjct  111  GRSKKRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLC  168



>gb|KJB41938.1| hypothetical protein B456_007G128700 [Gossypium raimondii]
Length=1247

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 90/160 (56%), Gaps = 13/160 (8%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  278
            KRSKA+E  SS+ +  G    G VNE       SG  S   E+RS+DL  + A K+ +A 
Sbjct  27   KRSKASEPASSSTN--GAAASGPVNEALGPPKESGSGSRVTELRSSDLPVSDAAKAVDAS  84

Query  279  VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK---SNLGTAWGK  446
             P+K  +  +    LVSP  LG++A+D +  K   +    R KKR  K   S     WGK
Sbjct  85   FPDKSADVDVENGALVSPRSLGEAAVDAENAKVVSAGFTARVKKRPTKPAKSGSKVPWGK  144

Query  447  LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            LLSQY QN HV +  + FT+GQ RQC+LC+ DP++S  LC
Sbjct  145  LLSQYSQNPHVVMCGTIFTIGQSRQCNLCLKDPNISTVLC  184



>ref|XP_006575111.1| PREDICTED: uncharacterized protein LOC100801477 [Glycine max]
Length=1243

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 105/179 (59%), Gaps = 10/179 (6%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAE  218
            MVETRRSSSSS +   S  SP  N KRSK +E  SST       +   VNESG   ESAE
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRSKVSEDSSSTT----VPSVAPVNESGTANESAE  56

Query  219  QEIRSADLDGASALKSPE---APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  389
             E+R +DL   ++LK+ +   A  P++ P AP+ GE LVSP   GD+A  +  V    +A
Sbjct  57   PELRPSDLPDTASLKAVDGCDAMSPDRSPSAPVEGEALVSPQCQGDTAEKLKGVPM-AAA  115

Query  390  LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              R KKR  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC
Sbjct  116  GGRSKKRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLC  174



>gb|KDO87288.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=845

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87289.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=779

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87287.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1163

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87285.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1183

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87286.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1116

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87276.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1226

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>ref|XP_006444295.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
 gb|ESR57535.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
Length=1251

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87275.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1222

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87277.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1223

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>ref|XP_006444294.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
 gb|ESR57534.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
Length=1256

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>gb|KDO87278.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1251

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             QNSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SQNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>ref|XP_007050882.1| ATPase family AAA domain-containing protein 1-A isoform 4, partial 
[Theobroma cacao]
 gb|EOX95039.1| ATPase family AAA domain-containing protein 1-A isoform 4, partial 
[Theobroma cacao]
Length=865

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = +3

Query  195  ESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVK  374
            ESG +S   E+RS+DL  + + K+ +A V +K  +A +    LVSP  LG++A+DV+K K
Sbjct  27   ESGSDSRVTELRSSDLRVSDSAKAVDASVTDKSADADVENGTLVSPGSLGEAAMDVEKAK  86

Query  375  ANGSALN-RGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDD  542
            A G+    R KKR  K   S     WGKLLSQ+ QN H+ +  + FTVGQ RQC+LC+ D
Sbjct  87   AVGAGFTGRVKKRPTKPAKSGSKVPWGKLLSQHSQNPHLVMCGTLFTVGQSRQCNLCLKD  146

Query  543  PSVSKSLC  566
            P+VS  LC
Sbjct  147  PNVSTVLC  154



>ref|XP_006479928.1| PREDICTED: uncharacterized protein LOC102620169 [Citrus sinensis]
Length=1251

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  299
            KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27   KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  300  APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQY  461
            A +  + LVSP   G++A+D +K KA G   N R KKR  K  LG       W +L+SQ 
Sbjct  84   ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQC  141

Query  462  PQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             +NSH+ +  + FTVG  RQCDL + DPS+SK+LC
Sbjct  142  SENSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLC  176



>ref|XP_008451597.1| PREDICTED: uncharacterized protein LOC103492829 isoform X3 [Cucumis 
melo]
Length=1073

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 90/161 (56%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSPEA---  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK       
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVEPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC
Sbjct  148  KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLC  188



>ref|XP_008451596.1| PREDICTED: uncharacterized protein LOC103492829 isoform X2 [Cucumis 
melo]
Length=1254

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 90/161 (56%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSPEA---  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK       
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVEPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC
Sbjct  148  KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLC  188



>ref|XP_008451595.1| PREDICTED: uncharacterized protein LOC103492829 isoform X1 [Cucumis 
melo]
Length=1271

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 90/161 (56%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSPEA---  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK       
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVEPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC
Sbjct  148  KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLC  188



>ref|XP_004136037.1| PREDICTED: uncharacterized protein LOC101211144 [Cucumis sativus]
Length=1270

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 90/161 (56%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSPEA---  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK       
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVDPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC
Sbjct  148  KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLC  188



>ref|XP_008235052.1| PREDICTED: uncharacterized protein LOC103333915 [Prunus mume]
Length=1248

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 91/160 (57%), Gaps = 17/160 (11%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLG---EKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  275
            N KRSKA+++ SS + +      +  G + ESG +  E E+RS+D    D   A+   +A
Sbjct  21   NPKRSKASDASSSNNGVRSGPPAEPLGPIKESGSQPPEIELRSSDPPSTDSLKAVNGSDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWGK  446
             V E+ P+    GE LVSP  LG++A+         + L R KK   +  KSN  +AWG 
Sbjct  81   TVFERSPDVVAEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTTKSNSKSAWGM  132

Query  447  LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L+SQ  +N H+ +  + FTVGQ R C+LC+ DPS+S +LC
Sbjct  133  LISQCSKNPHLFICDTVFTVGQSRDCNLCLKDPSISTTLC  172



>ref|XP_006588596.1| PREDICTED: uncharacterized protein LOC100794406 isoform X2 [Glycine 
max]
Length=1246

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 87/161 (54%), Gaps = 16/161 (10%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGA--VNESGP--ESAEQEIRSADLDGASALKSPEAPV  281
            N KRSK +E  SST        P    VNESG   ESAE E+  +DL   ++LK+ +  V
Sbjct  23   NTKRSKVSEDSSST------TVPSVAPVNESGTANESAEPELMLSDLPETASLKAVDGCV  76

Query  282  ---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK-KRQLKSNLG--TAWG  443
               P+K P  P+ GE LVSP   G++A     V    +    G+ K+Q  S L    AWG
Sbjct  77   AMSPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAAATTTGGRSKKQRPSKLSPKVAWG  136

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC
Sbjct  137  KLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLC  177



>ref|XP_010097306.1| ATPase family AAA domain-containing protein 1 [Morus notabilis]
 gb|EXB67538.1| ATPase family AAA domain-containing protein 1 [Morus notabilis]
Length=1412

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSAD------LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILG  344
            G V E+  ES   E+RS D      L  A+ +   +A +PEK  E  +    LVSP + G
Sbjct  153  GPVKEAVSESGGVELRSPDPANPDPLKEAATVAEFDATLPEKSAEEGVEDLALVSPQLSG  212

Query  345  DSAIDVDKVKANGSALNRGKKR--QL-KSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQG  515
            ++A+D DK KA   A  RGKKR  +L KSN   AWGKLLSQ   N H+ +  S FTVGQ 
Sbjct  213  EAAVDADKSKAVVPASGRGKKRPSKLPKSNPKAAWGKLLSQCSLNPHLFIRDSLFTVGQS  272

Query  516  RQCDLCVDDPSVSKSLC  566
             QC+L + DPS+S +LC
Sbjct  273  VQCNLSIKDPSISNTLC  289



>gb|KJB49948.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
 gb|KJB49949.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
 gb|KJB49950.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
 gb|KJB49952.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
Length=1229

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVP-EKLP  296
            KRSKA+E  SS  +  G    G+V ESG +S   E+RS+DL  +   K+ +  VP +K  
Sbjct  28   KRSKASELASSPSN--GATGSGSVKESGSDSPVTELRSSDLRVSDVAKADDGSVPTDKSA  85

Query  297  EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  476
            +A +    LVS   LG++A+D +K  A G +  R KK+  KS     WGKLLSQ+ QN H
Sbjct  86   DADVENVSLVSAGTLGEAAVDAEK--AEGLS-GRVKKKPAKSGSKVPWGKLLSQHSQNPH  142

Query  477  VPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            + +  + FT GQ RQC+LC+ D ++S  LC
Sbjct  143  LVMCGTPFTAGQSRQCNLCLKDSNISNVLC  172



>gb|KJB49954.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
Length=1228

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVP-EKLP  296
            KRSKA+E  SS  +  G    G+V ESG +S   E+RS+DL  +   K+ +  VP +K  
Sbjct  28   KRSKASELASSPSN--GATGSGSVKESGSDSPVTELRSSDLRVSDVAKADDGSVPTDKSA  85

Query  297  EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  476
            +A +    LVS   LG++A+D +K  A G +  R KK+  KS     WGKLLSQ+ QN H
Sbjct  86   DADVENVSLVSAGTLGEAAVDAEK--AEGLS-GRVKKKPAKSGSKVPWGKLLSQHSQNPH  142

Query  477  VPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            + +  + FT GQ RQC+LC+ D ++S  LC
Sbjct  143  LVMCGTPFTAGQSRQCNLCLKDSNISNVLC  172



>gb|KHG01617.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
 gb|KHG08860.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
Length=1244

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 94/161 (58%), Gaps = 15/161 (9%)
 Frame = +3

Query  120  KRSKATE-SLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEA  275
            KRSKA+E +LSS +   G    G VNE       SG +S   E+RS+DL  + A K+ +A
Sbjct  24   KRSKASEPALSSNN---GAAVSGPVNETLGPPKESGSDSRVMELRSSDLRVSDAAKAVDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WG  443
               +K   A L    LV+P   G++A++ DKV+   + L  R K R +K + LG+   WG
Sbjct  81   SPIDKPAVADLENGTLVAPRSSGEAAVNADKVETVAAGLTGRAKNRPIKPAKLGSKFPWG  140

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ+ QN H+ +  + FTVGQ  QC+LC+ D ++S  LC
Sbjct  141  KLLSQHSQNPHLVMCGTLFTVGQSHQCNLCLKDHNISAILC  181



>ref|XP_006588599.1| PREDICTED: uncharacterized protein LOC100794406 isoform X5 [Glycine 
max]
Length=1223

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 101/184 (55%), Gaps = 16/184 (9%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGA--VNESGP--ES  212
            MVETRRSSSSS +   S  SP  N KR K +E  SST        P    VNESG   ES
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSST------TVPSVAPVNESGTANES  54

Query  213  AEQEIRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANG  383
            AE E+  +DL   ++LK+ +  V   P+K P  P+ GE LVSP   G++A     V    
Sbjct  55   AEPELMLSDLPETASLKAVDGCVAMSPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAA  114

Query  384  SALNRGK-KRQLKSNLG--TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVS  554
            +    G+ K+Q  S L    AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V 
Sbjct  115  ATTTGGRSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVG  174

Query  555  KSLC  566
              LC
Sbjct  175  NVLC  178



>gb|KJB23264.1| hypothetical protein B456_004G089000 [Gossypium raimondii]
Length=1258

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 94/161 (58%), Gaps = 15/161 (9%)
 Frame = +3

Query  120  KRSKATE-SLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEA  275
            KRSKA+E +LSS +   G    G VNE       SG +S   E+RS+DL  + + K+ +A
Sbjct  24   KRSKASEPALSSNN---GAAVSGPVNETLGPPKESGSDSRVMELRSSDLRVSDSAKAVDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WG  443
               +K   A L    LV+P   G++A+D DKV+   + L  R K R +K + LG+   WG
Sbjct  81   SPIDKPAVADLENGTLVAPRSSGEAAVDADKVETVAAGLTGRAKNRPIKPAKLGSKFPWG  140

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ+ QN H+ +  + FTVGQ  QC+LC+ D ++S  LC
Sbjct  141  KLLSQHSQNPHLVMCGTPFTVGQSHQCNLCLKDHNISAVLC  181



>gb|KJB23261.1| hypothetical protein B456_004G089000 [Gossypium raimondii]
 gb|KJB23263.1| hypothetical protein B456_004G089000 [Gossypium raimondii]
Length=1244

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 94/161 (58%), Gaps = 15/161 (9%)
 Frame = +3

Query  120  KRSKATE-SLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEA  275
            KRSKA+E +LSS +   G    G VNE       SG +S   E+RS+DL  + + K+ +A
Sbjct  24   KRSKASEPALSSNN---GAAVSGPVNETLGPPKESGSDSRVMELRSSDLRVSDSAKAVDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WG  443
               +K   A L    LV+P   G++A+D DKV+   + L  R K R +K + LG+   WG
Sbjct  81   SPIDKPAVADLENGTLVAPRSSGEAAVDADKVETVAAGLTGRAKNRPIKPAKLGSKFPWG  140

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ+ QN H+ +  + FTVGQ  QC+LC+ D ++S  LC
Sbjct  141  KLLSQHSQNPHLVMCGTPFTVGQSHQCNLCLKDHNISAVLC  181



>gb|KDO87279.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1211

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 79/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  186  AVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVD  365
            A ++SG ES E E+RS+DLD     K  +    +K  +A +  + LVSP   G++A+D +
Sbjct  9    AASKSGSESREPELRSSDLDLTDDAKPADV---DKSVDADVEADALVSPPTPGETAVDAE  65

Query  366  KVKANGSALN-RGKKRQLKSNLGTA-----WGKLLSQYPQNSHVPLDQSTFTVGQGRQCD  527
            K KA G   N R KKR  K  LG       W +L+SQ  QNSH+ +  + FTVG  RQCD
Sbjct  66   KSKAVGVVFNGRVKKRATK--LGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCD  123

Query  528  LCVDDPSVSKSLC  566
            L + DPS+SK+LC
Sbjct  124  LYLKDPSISKNLC  136



>gb|KJB23262.1| hypothetical protein B456_004G089000 [Gossypium raimondii]
Length=1175

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 94/161 (58%), Gaps = 15/161 (9%)
 Frame = +3

Query  120  KRSKATE-SLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEA  275
            KRSKA+E +LSS +   G    G VNE       SG +S   E+RS+DL  + + K+ +A
Sbjct  24   KRSKASEPALSSNN---GAAVSGPVNETLGPPKESGSDSRVMELRSSDLRVSDSAKAVDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WG  443
               +K   A L    LV+P   G++A+D DKV+   + L  R K R +K + LG+   WG
Sbjct  81   SPIDKPAVADLENGTLVAPRSSGEAAVDADKVETVAAGLTGRAKNRPIKPAKLGSKFPWG  140

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KLLSQ+ QN H+ +  + FTVGQ  QC+LC+ D ++S  LC
Sbjct  141  KLLSQHSQNPHLVMCGTPFTVGQSHQCNLCLKDHNISAVLC  181



>ref|XP_003536887.1| PREDICTED: uncharacterized protein LOC100794406 isoform X1 [Glycine 
max]
Length=1247

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 101/184 (55%), Gaps = 16/184 (9%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGA--VNESGP--ES  212
            MVETRRSSSSS +   S  SP  N KR K +E  SST        P    VNESG   ES
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSST------TVPSVAPVNESGTANES  54

Query  213  AEQEIRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANG  383
            AE E+  +DL   ++LK+ +  V   P+K P  P+ GE LVSP   G++A     V    
Sbjct  55   AEPELMLSDLPETASLKAVDGCVAMSPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAA  114

Query  384  SALNRGK-KRQLKSNLG--TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVS  554
            +    G+ K+Q  S L    AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V 
Sbjct  115  ATTTGGRSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVG  174

Query  555  KSLC  566
              LC
Sbjct  175  NVLC  178



>ref|XP_010652173.1| PREDICTED: uncharacterized protein LOC100260666 [Vitis vinifera]
Length=1259

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 8/157 (5%)
 Frame = +3

Query  120  KRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEAPV  281
            KRSK+ E+ SS+ ++   L E+      ESG E  +Q  + +D    D + A  + +   
Sbjct  27   KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA  86

Query  282  PEKLPEAPLGGEPLV--SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  455
             EK  EA   GE LV  SP+ L DSA+  +K K+     NRG+KR +KSN   AWGKLLS
Sbjct  87   KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSNRGRKRSVKSNATVAWGKLLS  146

Query  456  QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q  Q  H PL    FT+GQ R  +L + DPS+S +LC
Sbjct  147  QCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLC  183



>emb|CBI36835.3| unnamed protein product [Vitis vinifera]
Length=1287

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 8/157 (5%)
 Frame = +3

Query  120  KRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEAPV  281
            KRSK+ E+ SS+ ++   L E+      ESG E  +Q  + +D    D + A  + +   
Sbjct  27   KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA  86

Query  282  PEKLPEAPLGGEPLV--SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  455
             EK  EA   GE LV  SP+ L DSA+  +K K+     NRG+KR +KSN   AWGKLLS
Sbjct  87   KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSNRGRKRSVKSNATVAWGKLLS  146

Query  456  QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q  Q  H PL    FT+GQ R  +L + DPS+S +LC
Sbjct  147  QCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLC  183



>ref|XP_009342112.1| PREDICTED: uncharacterized protein LOC103934131 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009342140.1| PREDICTED: uncharacterized protein LOC103934149 isoform X2 [Pyrus 
x bretschneideri]
Length=1245

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  272
            N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D    D   A    +
Sbjct  21   NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  273  APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  443
            A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80   ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC
Sbjct  132  MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLC  172



>ref|XP_009342111.1| PREDICTED: uncharacterized protein LOC103934131 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342139.1| PREDICTED: uncharacterized protein LOC103934149 isoform X1 [Pyrus 
x bretschneideri]
Length=1253

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  272
            N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D    D   A    +
Sbjct  21   NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  273  APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  443
            A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80   ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC
Sbjct  132  MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLC  172



>ref|XP_009342114.1| PREDICTED: uncharacterized protein LOC103934131 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009342141.1| PREDICTED: uncharacterized protein LOC103934149 isoform X3 [Pyrus 
x bretschneideri]
Length=1229

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  272
            N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D    D   A    +
Sbjct  21   NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  273  APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  443
            A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80   ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC
Sbjct  132  MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLC  172



>ref|XP_008386656.1| PREDICTED: uncharacterized protein LOC103449148 [Malus domestica]
Length=1255

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 11/157 (7%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLG---EKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  275
            N KRSKA+++ SS + +      +  G + ESG +  E E+RS+D   +D   A+  P+A
Sbjct  21   NPKRSKASDASSSNNGVRSGPPAEPLGPIKESGSQPPELELRSSDPPTIDSLKAINGPDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  455
               E+ P+    GE LVSP  LG++A     V+A      +  K++ K N  +AWG L+S
Sbjct  81   TALERSPDDVAEGEALVSPQPLGETA-----VRAGLKRGKKLPKKKAKLNSKSAWGMLIS  135

Query  456  QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q+ +N H  + ++ FTVGQ  +C LC+ DPS+S +LC
Sbjct  136  QFSKNPHQFICETVFTVGQSHECHLCLKDPSISTTLC  172



>ref|XP_008368992.1| PREDICTED: uncharacterized protein LOC103432576 isoform X1 [Malus 
domestica]
Length=1253

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 89/160 (56%), Gaps = 17/160 (11%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLG---EKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  275
            N KRSKA+++ SS + +      +  G + ESG +S E E+R +D    D   A    +A
Sbjct  21   NPKRSKASDASSSNNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSDA  80

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWGK  446
               E+ P+A   GE LVSP  LG++A+         + L R KK   +  K N  +AWG 
Sbjct  81   TALERSPDAIPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKLNSKSAWGM  132

Query  447  LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC
Sbjct  133  LISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLC  172



>gb|KJB49953.1| hypothetical protein B456_008G146500 [Gossypium raimondii]
Length=1230

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 90/151 (60%), Gaps = 7/151 (5%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVP-EKLP  296
            KRSKA+E  SS  +  G    G+V ESG +S   E+RS+DL  +   K+ +  VP +K  
Sbjct  28   KRSKASELASSPSN--GATGSGSVKESGSDSPVTELRSSDLRVSDVAKADDGSVPTDKSA  85

Query  297  EAPLGGEPLVSP-MILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  473
            +A +    LVS   ++G++A+D +K  A G +  R KK+  KS     WGKLLSQ+ QN 
Sbjct  86   DADVENVSLVSAGTLVGEAAVDAEK--AEGLS-GRVKKKPAKSGSKVPWGKLLSQHSQNP  142

Query  474  HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            H+ +  + FT GQ RQC+LC+ D ++S  LC
Sbjct  143  HLVMCGTPFTAGQSRQCNLCLKDSNISNVLC  173



>gb|KHN03730.1| ATPase family AAA domain-containing protein 1 [Glycine soja]
Length=1233

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 97/180 (54%), Gaps = 22/180 (12%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGA--VNESGPESAE  218
            MVETRRSSSSS +   S  SP  N KR K +E  SST        P    VNESG  + E
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSST------TVPSVAPVNESG-TATE  53

Query  219  QEIRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  389
             E+  +DL   ++LK+ +  V   P K P AP+ GE LVSP   G          A+G+ 
Sbjct  54   PELMLSDLPETASLKAVDGCVAMSPNKSPSAPVEGEALVSPQCQGG---------ADGAT  104

Query  390  LNRGKK-RQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              R KK R  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC
Sbjct  105  GGRSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLC  164



>ref|XP_006588598.1| PREDICTED: uncharacterized protein LOC100794406 isoform X4 [Glycine 
max]
Length=1226

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPVPE  287
            N KRSK +E  S             VNESG   ES E E+R +DL   ++LK   A V +
Sbjct  23   NTKRSKVSEDSS---------VAAPVNESGTGNESGEPELRPSDLPDTASLKV--AGVCD  71

Query  288  KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQ  467
            K   +P  GE LV P+  G++A   +K K  G      KKR  KS   TAWGKLLSQ  +
Sbjct  72   K---SPSEGEALVPPLCAGETA---EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCSK  125

Query  468  NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              HV + +  FTVGQGR C+L + DP++   LC
Sbjct  126  TPHVCMTEPFFTVGQGRHCNLWLKDPTIGSVLC  158



>gb|KHN03731.1| Protein MSP1 [Glycine soja]
Length=1226

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPVPE  287
            N KRSK +E  S             VNESG   ES E E+R +DL   ++LK   A V +
Sbjct  23   NTKRSKVSEDSS---------VAAPVNESGTGNESGEPELRPSDLPDTASLKV--AGVCD  71

Query  288  KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQ  467
            K   +P  GE LV P+  G++A   +K K  G      KKR  KS   TAWGKLLSQ  +
Sbjct  72   K---SPSEGEALVPPLCAGETA---EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCSK  125

Query  468  NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              HV + +  FTVGQGR C+L + DP++   LC
Sbjct  126  TPHVCMTEPFFTVGQGRHCNLWLKDPTIGSVLC  158



>ref|XP_004495974.1| PREDICTED: uncharacterized protein LOC101498262 [Cicer arietinum]
Length=1236

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 13/151 (9%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-VNESGPESAEQEIRSADLDGASALKSPEAPVPEKLP  296
            KRSK +E  SST        P   VNES P + E EI+ +DL   ++LK  +    +K P
Sbjct  25   KRSKVSEDASST------TLPSLPVNESAPRN-ESEIQPSDLPQTASLKVVDGE-NDKSP  76

Query  297  EAPLGGEPLVSPMILGDSAIDVDKVKANGSAL-NRGKKRQLKSNLGTAWGKLLSQYPQNS  473
              P+  +PLVSP   G++A   +K K     +  R K+  +K +    WGKL+SQ+ QN 
Sbjct  77   SLPIEDDPLVSPQSPGETA---EKSKVAAPVVPCRKKRSAVKLSPKAEWGKLISQFSQNP  133

Query  474  HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            HV +    FTVGQGRQ +L + DP+V   LC
Sbjct  134  HVSISDPIFTVGQGRQSNLMLKDPTVGSVLC  164



>ref|XP_004292654.1| PREDICTED: uncharacterized protein LOC101311652 [Fragaria vesca 
subsp. vesca]
Length=1237

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 21/162 (13%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSPE-AP  278
            N KRSKA+++ SS+++ +   TP    G + ES  +S + E+RS D   A +LK+   + 
Sbjct  21   NPKRSKASDA-SSSNNGVRSGTPAEPLGPIKESESQSPDLELRSPDPQTADSLKAVNGSD  79

Query  279  VPEKLPE---APLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAW  440
              E+ P+          L SP  L D+A+         S L R KK   R  KSN   AW
Sbjct  80   AAERAPDDVAEAEAAAALESPKPLSDTAVR--------SGLKRNKKVPKRSAKSNQKLAW  131

Query  441  GKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            G+LLSQ  +N H  L   TFTVGQGR+C+LC+ DPSVS +LC
Sbjct  132  GQLLSQCSKNPHQFL-CDTFTVGQGRECNLCLKDPSVSTTLC  172



>gb|KDP28140.1| hypothetical protein JCGZ_13911 [Jatropha curcas]
Length=1205

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 12/140 (9%)
 Frame = +3

Query  174  KTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  353
            +T  +V ESG    + E++S+D    + +  P +   E+ P+    GE L+SP  LG++ 
Sbjct  54   ETLTSVKESGSIPRDPELQSSD-PLVTVVSEPVSADAERSPDPE--GEGLLSPQPLGETN  110

Query  354  IDVDKV-KANGSALNRGKKRQLKSNLG--------TAWGKLLSQYPQNSHVPLDQSTFTV  506
            ++  ++ KA G+ L+RG+KR  KS +          AW KLLSQ  Q  H  +  + FTV
Sbjct  111  LNAAEISKAVGATLSRGRKRPAKSAVAKPVKPLDKLAWAKLLSQCSQYPHKEMRSTLFTV  170

Query  507  GQGRQCDLCVDDPSVSKSLC  566
            GQGR CDL ++DPSVS  LC
Sbjct  171  GQGRHCDLVINDPSVSTILC  190



>ref|XP_006575112.1| PREDICTED: uncharacterized protein LOC100800938 isoform X1 [Glycine 
max]
Length=1225

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 22/154 (14%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE---APVP  284
            N KRSK      S D  +       VN+SG    E E+R +DL   ++LK+ +   A +P
Sbjct  22   NTKRSKV-----SKDSFVA----APVNKSG----EPELRPSDLPDTASLKAVDVCDAVLP  68

Query  285  EKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYP  464
            +K   +P  GE LV P   G++A   +K K  G      KKR  KS   TAWGKLLSQ  
Sbjct  69   DK---SPSEGEALVPPRCAGETA---EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCS  122

Query  465  QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            +N HV + +  FTVGQG+ C+L + DP++   LC
Sbjct  123  KNPHVCMTEPIFTVGQGQHCNLWLKDPTIGSVLC  156



>ref|XP_006588597.1| PREDICTED: uncharacterized protein LOC100794406 isoform X3 [Glycine 
max]
Length=1237

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 94/181 (52%), Gaps = 20/181 (11%)
 Frame = +3

Query  45   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGA--VNESGP--ES  212
            MVETRRSSSSS +   S  SP  N KR K +E  SST        P    VNESG   ES
Sbjct  1    MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSST------TVPSVAPVNESGTANES  54

Query  213  AEQEIRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANG  383
            AE E+  +DL   ++LK+ +  V   P+K P  P+ GE         + +  V    A  
Sbjct  55   AEPELMLSDLPETASLKAVDGCVAMSPDKSPSVPVEGET-------AEKSKGVLMAAATT  107

Query  384  SALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSL  563
            +     K+R  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   L
Sbjct  108  TGGRSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVL  167

Query  564  C  566
            C
Sbjct  168  C  168



>ref|XP_003591554.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
Length=1211

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  390  LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L+R KKR  KSN  +AWGKL+SQ+ +N H+P+    +TVGQ RQC+L + DPSVS  LC
Sbjct  100  LSRSKKRCTKSNSKSAWGKLISQFSENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLC  158



>ref|XP_003591553.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
Length=1229

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  390  LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L+R KKR  KSN  +AWGKL+SQ+ +N H+P+    +TVGQ RQC+L + DPSVS  LC
Sbjct  100  LSRSKKRCTKSNSKSAWGKLISQFSENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLC  158



>ref|XP_003591552.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
 gb|AES61803.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1237

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  390  LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L+R KKR  KSN  +AWGKL+SQ+ +N H+P+    +TVGQ RQC+L + DPSVS  LC
Sbjct  100  LSRSKKRCTKSNSKSAWGKLISQFSENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLC  158



>ref|XP_010684533.1| PREDICTED: uncharacterized protein LOC104899096 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1236

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 16/118 (14%)
 Frame = +3

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+ SADL    ++K  +   P+K P          + + L D+ +D    K   SAL   
Sbjct  61   EVGSADLPPTDSIKPSDLNFPDKFPSVE-------AKVALEDAVVDEKDTK---SAL---  107

Query  402  KKRQLKSNLGT---AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            K+++LK N+ +   AW +L+SQ+ +N H  +  S FTVG GRQCDL ++DPS+SK LC
Sbjct  108  KRQRLKKNIKSEQPAWAQLISQFSENPHEFVRGSQFTVGHGRQCDLWLNDPSISKMLC  165



>ref|XP_007050880.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX95037.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
Length=1142

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +3

Query  354  IDVDKVKANGSALN-RGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  521
            +DV+K KA G+    R KKR  K   S     WGKLLSQ+ QN H+ +  + FTVGQ RQ
Sbjct  1    MDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGKLLSQHSQNPHLVMCGTLFTVGQSRQ  60

Query  522  CDLCVDDPSVSKSLC  566
            C+LC+ DP+VS  LC
Sbjct  61   CNLCLKDPNVSTVLC  75



>ref|XP_007050881.1| ATP binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOX95038.1| ATP binding protein, putative isoform 3 [Theobroma cacao]
Length=1007

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +3

Query  354  IDVDKVKANGSALN-RGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  521
            +DV+K KA G+    R KKR  K   S     WGKLLSQ+ QN H+ +  + FTVGQ RQ
Sbjct  1    MDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGKLLSQHSQNPHLVMCGTLFTVGQSRQ  60

Query  522  CDLCVDDPSVSKSLC  566
            C+LC+ DP+VS  LC
Sbjct  61   CNLCLKDPNVSTVLC  75



>ref|XP_010248968.1| PREDICTED: uncharacterized protein LOC104591697 isoform X1 [Nelumbo 
nucifera]
Length=1253

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  318  PLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQST  497
            P+ +P+  G S I  DK + + S+ +  +K+    +  T W KLLS+YPQN HVP+    
Sbjct  98   PVSTPIAEGSSTIVGDKTRTSFSSWSLYQKQNSSFDTSTPWCKLLSEYPQNPHVPIYSPL  157

Query  498  FTVGQGRQCDLCVDDPSVSKSLC  566
            FT+G  R C+L + DP++S  LC
Sbjct  158  FTIGSSRNCNLSLKDPNISAVLC  180



>ref|XP_010248969.1| PREDICTED: uncharacterized protein LOC104591697 isoform X2 [Nelumbo 
nucifera]
Length=1224

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  318  PLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQST  497
            P+ +P+  G S I  DK + + S+ +  +K+    +  T W KLLS+YPQN HVP+    
Sbjct  98   PVSTPIAEGSSTIVGDKTRTSFSSWSLYQKQNSSFDTSTPWCKLLSEYPQNPHVPIYSPL  157

Query  498  FTVGQGRQCDLCVDDPSVSKSLC  566
            FT+G  R C+L + DP++S  LC
Sbjct  158  FTIGSSRNCNLSLKDPNISAVLC  180



>ref|XP_002301474.2| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE80747.2| AAA-type ATPase family protein [Populus trichocarpa]
Length=1229

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = +3

Query  354  IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  506
            + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83   VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  507  GQGRQCDLCVDDPSVSKSLC  566
            GQ RQC+L ++D S+S  LC
Sbjct  143  GQSRQCNLWLNDSSISTILC  162



>ref|XP_011008046.1| PREDICTED: uncharacterized protein LOC105113541 isoform X2 [Populus 
euphratica]
Length=1229

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = +3

Query  354  IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  506
            + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83   VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  507  GQGRQCDLCVDDPSVSKSLC  566
            GQ RQC+L ++D S+S  LC
Sbjct  143  GQSRQCNLWLNDSSISTILC  162



>ref|XP_011008045.1| PREDICTED: uncharacterized protein LOC105113541 isoform X1 [Populus 
euphratica]
Length=1233

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = +3

Query  354  IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  506
            + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83   VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  507  GQGRQCDLCVDDPSVSKSLC  566
            GQ RQC+L ++D S+S  LC
Sbjct  143  GQSRQCNLWLNDSSISTILC  162



>ref|XP_006418289.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 ref|XP_006418291.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36642.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36644.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
Length=1266

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 17/131 (13%)
 Frame = +3

Query  189  VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGDSA  353
            V++ G ES E E+R++DL   D      + + P  E  P+  +  E   LV+P   G+  
Sbjct  70   VSDPGSESGEPELRTSDLQTNDAERPATATDVPAMENCPDTDMNPEVEGLVTPTPAGEVV  129

Query  354  IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  533
             + +K+K+       GKKR  K+     W KLLSQ+PQN H  +  S FTVG+ R CDLC
Sbjct  130  AEAEKLKS-------GKKRIAKA----PWAKLLSQHPQNPHRVMRGSVFTVGR-RGCDLC  177

Query  534  VDDPSVSKSLC  566
            + D S+   LC
Sbjct  178  IKDQSMPSVLC  188



>ref|XP_006418290.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36643.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
Length=1253

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 17/131 (13%)
 Frame = +3

Query  189  VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGDSA  353
            V++ G ES E E+R++DL   D      + + P  E  P+  +  E   LV+P   G+  
Sbjct  57   VSDPGSESGEPELRTSDLQTNDAERPATATDVPAMENCPDTDMNPEVEGLVTPTPAGEVV  116

Query  354  IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  533
             + +K+K+       GKKR  K+     W KLLSQ+PQN H  +  S FTVG+ R CDLC
Sbjct  117  AEAEKLKS-------GKKRIAKA----PWAKLLSQHPQNPHRVMRGSVFTVGR-RGCDLC  164

Query  534  VDDPSVSKSLC  566
            + D S+   LC
Sbjct  165  IKDQSMPSVLC  175



>ref|XP_010684534.1| PREDICTED: uncharacterized protein LOC104899096 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1233

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 19/118 (16%)
 Frame = +3

Query  222  EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  401
            E+ SADL    ++K  +   P+K P      + +V               K   SAL   
Sbjct  61   EVGSADLPPTDSIKPSDLNFPDKFPSVEAKEDAVVDE-------------KDTKSAL---  104

Query  402  KKRQLKSNLGT---AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            K+++LK N+ +   AW +L+SQ+ +N H  +  S FTVG GRQCDL ++DPS+SK LC
Sbjct  105  KRQRLKKNIKSEQPAWAQLISQFSENPHEFVRGSQFTVGHGRQCDLWLNDPSISKMLC  162



>gb|EYU46684.1| hypothetical protein MIMGU_mgv1a000404mg [Erythranthe guttata]
Length=1182

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  345  DSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQC  524
            DS ++ +    +G   + G K QLKSN   AWGKL+SQ P+  HV + +  FTVGQGRQC
Sbjct  59   DSVVNEEDEGKSGGPSDNGGKGQLKSNGDAAWGKLISQCPKIPHVVIHRPIFTVGQGRQC  118

Query  525  DLCVDDPSVSKSLC  566
            DL +  P+VS SLC
Sbjct  119  DLSL-SPTVSNSLC  131



>ref|XP_006396458.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
 gb|ESQ37911.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
Length=937

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALK--SPEAPVPEKLPEAPLG--GEPLVSPMILGDS  350
            G  ++ G ES E E+RS+D     A K  + + PV E  PE       E L +P I G+ 
Sbjct  65   GPASDPGSESGEPELRSSDPQAMDAEKPVTADVPVMENSPETDANPEVEVLATPTIAGEV  124

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
              D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL
Sbjct  125  VADAEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDL  171

Query  531  CVDDPSVSKSLC  566
             + D S+  +LC
Sbjct  172  SIKDQSMPSTLC  183



>ref|XP_006396457.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
 gb|ESQ37910.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
Length=1256

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALK--SPEAPVPEKLPEAPLG--GEPLVSPMILGDS  350
            G  ++ G ES E E+RS+D     A K  + + PV E  PE       E L +P I G+ 
Sbjct  65   GPASDPGSESGEPELRSSDPQAMDAEKPVTADVPVMENSPETDANPEVEVLATPTIAGEV  124

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
              D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL
Sbjct  125  VADAEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDL  171

Query  531  CVDDPSVSKSLC  566
             + D S+  +LC
Sbjct  172  SIKDQSMPSTLC  183



>ref|XP_002892133.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68392.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1238

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 17/131 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  353
            G V++ G ES EQE+R++D    D    + +   P  E      + G  LV+P   G+  
Sbjct  49   GPVSDPGSESGEQELRTSDPQSNDAERPVNNTAVPAMETDTNPEVEG--LVTPTPAGEVV  106

Query  354  IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  533
            ++ +K K++       KKR  K+     W KLLSQYPQN H  +  S FTVG+ R CDLC
Sbjct  107  VEAEKSKSS-------KKRIAKA----PWAKLLSQYPQNPHCVMRGSVFTVGR-RGCDLC  154

Query  534  VDDPSVSKSLC  566
            + D S+   LC
Sbjct  155  IRDHSMPNVLC  165



>ref|XP_004495973.1| PREDICTED: uncharacterized protein LOC101497938 [Cicer arietinum]
Length=1248

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 70/122 (57%), Gaps = 4/122 (3%)
 Frame = +3

Query  207  ESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGS  386
            ESA+ +IRS+DL   S+L + +    +K     +  E L+SP+   DS  D+ +      
Sbjct  46   ESAKGDIRSSDLQETSSLNAVDCD-NDKSSSVAVKTEALMSPLRCLDSG-DIAEKSKGLP  103

Query  387  ALNRGKKRQLK--SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  560
             + R KKR +K       AWGKL+SQ  +N H+ + +  +TVGQGRQC+L + DP++S  
Sbjct  104  PIARPKKRGIKLCPKAEDAWGKLISQSSENPHLSMCEPIYTVGQGRQCNLWLKDPALSHV  163

Query  561  LC  566
            LC
Sbjct  164  LC  165



>ref|XP_011033559.1| PREDICTED: uncharacterized protein LOC105132009 [Populus euphratica]
Length=1227

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +3

Query  390  LNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  560
            LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + F+VGQ RQC+L ++DPS+S  
Sbjct  99   LNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLMNSTLFSVGQSRQCNLWLNDPSISTV  158

Query  561  LC  566
            LC
Sbjct  159  LC  160



>gb|KHN46576.1| Spastin [Glycine soja]
Length=1245

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 72/144 (50%), Gaps = 30/144 (21%)
 Frame = +3

Query  207  ESAEQEIRSADLDGASALKSPE---APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKA  377
            +S E E+R +DL   ++LK+ +   A +P+K   +P  GE LV P   G++A   +K K 
Sbjct  39   KSGEPELRPSDLPDTASLKAVDVCDAVLPDK---SPSEGEALVPPRCAGETA---EKSKV  92

Query  378  NGSALNRGKKRQLKSNLGTAWGKLLSQ---------------------YPQNSHVPLDQS  494
             G      KKR  KS   TAWGKLLSQ                       QN HV + + 
Sbjct  93   AGLPPRSVKKRAAKSCPKTAWGKLLSQSGNGEEVYKKVSYLRRIYIKQVMQNPHVCMTEP  152

Query  495  TFTVGQGRQCDLCVDDPSVSKSLC  566
             FTVGQG+ C+L + DP++   LC
Sbjct  153  IFTVGQGQHCNLWLKDPTIGSVLC  176



>ref|XP_009391006.1| PREDICTED: uncharacterized protein LOC103977266 [Musa acuminata 
subsp. malaccensis]
Length=1243

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = +3

Query  285  EKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYP  464
            EK  +AP  G P+  P      A+ V++ K    A     KR +K+   TAW KL+SQ+ 
Sbjct  72   EKPVDAPGQGSPVQLPA--QKRAVKVERRKLEVPA-----KRVVKAKQKTAWAKLISQHS  124

Query  465  QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Q  H+ L  S F+VGQ   C+LC+ DPSVSK+LC
Sbjct  125  QYPHIFLSGSRFSVGQSPSCNLCMKDPSVSKTLC  158



>ref|XP_002321014.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE99329.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=1231

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +3

Query  390  LNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  560
            LN+ KKR    +KS+   AWG+LLSQ  QN H  ++ + F+VGQ RQC+L ++DPS+S  
Sbjct  108  LNKSKKRVPKSVKSSAKAAWGQLLSQCSQNPHKLMNSTLFSVGQSRQCNLWLNDPSISTV  167

Query  561  LC  566
            LC
Sbjct  168  LC  169



>ref|XP_006848423.1| hypothetical protein AMTR_s00013p00232570 [Amborella trichopoda]
 gb|ERN10004.1| hypothetical protein AMTR_s00013p00232570 [Amborella trichopoda]
Length=1280

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 8/82 (10%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + SPM+L       DK K++ S   R  K+    +    WGKLLSQY QN HVPL  + F
Sbjct  119  VASPMVL-------DKPKSSLS-WGRYGKQSATWHASNVWGKLLSQYSQNPHVPLCNAIF  170

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            T+G  + C+LC+ D SVS  LC
Sbjct  171  TIGSNKTCNLCLKDSSVSGMLC  192



>ref|XP_009134429.1| PREDICTED: uncharacterized protein LOC103858761 [Brassica rapa]
Length=1254

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALKS--PEAPVPEKLPEAPLGGEP--LVSPMILGDS  350
            G V++ G ES E E+ S+D  G  A K    + PV E  PEA    E   L +P I G+ 
Sbjct  65   GPVSDPGSESGEPELGSSDPQGVDAEKPVLTDVPVMEISPEADANPEADVLATPAIAGEV  124

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
              D +K KA       GKKR         W KLLSQY QN H  +    FTVG+ R CDL
Sbjct  125  VADGEKSKA-------GKKRA-----KAPWAKLLSQYSQNPHRIMRGPVFTVGR-RGCDL  171

Query  531  CVDDPSVSKSLC  566
             + D S+  +LC
Sbjct  172  SIKDQSMPSTLC  183



>ref|XP_004173001.1| PREDICTED: uncharacterized protein LOC101225352, partial [Cucumis 
sativus]
Length=185

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 14/146 (10%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSP---EA  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK     + 
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVDPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQNSHVPLDQSTFTVGQGRQ  521
            KLLSQ  Q+  +  + S   V  GR+
Sbjct  148  KLLSQCSQDYPIEKNVSRELVWYGRK  173



>gb|KFK30845.1| hypothetical protein AALP_AA6G033000, partial [Arabis alpina]
Length=1123

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 15/126 (12%)
 Frame = +3

Query  189  VNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDK  368
            V+E G ES E E+ S+D        + + PV E   EA    E L +P I G++  D +K
Sbjct  63   VSEPGSESGEPELGSSDPQVEEKAVTTDVPVMET--EANPEVEVLATPTIAGEAVTDTEK  120

Query  369  VKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPS  548
             K        GKKR  K+     W KLLSQYPQN H  +    FTVG+ R CDL + + +
Sbjct  121  SK--------GKKRASKA----PWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDLSIKEQN  167

Query  549  VSKSLC  566
            +  +LC
Sbjct  168  MPSALC  173



>emb|CDY18018.1| BnaC03g30900D [Brassica napus]
Length=1220

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALKS--PEAPVPEKLPEAPLGGEP--LVSPMILGDS  350
            G V++ G ES E E+ S+D  G  A K    + PV E  PEA    E   L +P + G+ 
Sbjct  65   GPVSDPGSESGEPELGSSDPQGVDAEKPVLTDVPVMEISPEADANPEADVLATPTVAGEV  124

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
              D +K KA       GKKR         W KLLSQY QN H  +    FTVG+ R CDL
Sbjct  125  VADGEKSKA-------GKKRA-----KAPWAKLLSQYSQNPHRIMRGPVFTVGR-RGCDL  171

Query  531  CVDDPSVSKSLC  566
             + D S+  +LC
Sbjct  172  SIKDQSMPSTLC  183



>emb|CDX90936.1| BnaA03g26160D [Brassica napus]
Length=1094

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALKS--PEAPVPEKLPEAPLGGEP--LVSPMILGDS  350
            G V++ G ES E E+ S+D  G  A K    + PV E  PEA    E   L +P + G+ 
Sbjct  65   GPVSDPGSESGEPELGSSDPQGVDAEKPVLTDVPVMEISPEADANPEADVLATPAVAGEV  124

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
              D +K KA       GKKR         W KLLSQY QN H  +    FTVG+ R CDL
Sbjct  125  VADGEKSKA-------GKKRA-----KAPWAKLLSQYSQNPHRIMRGPVFTVGR-RGCDL  171

Query  531  CVDDPSVSKSLC  566
             + D S+  +LC
Sbjct  172  SIKDQSMPSTLC  183



>ref|XP_009414467.1| PREDICTED: uncharacterized protein LOC103995579 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1252

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KR +K+    AW KL+SQ+ QN H+ L  S F+VGQ R C+L + DPS+SK LC
Sbjct  115  KRVVKATQKAAWAKLISQHSQNPHLFLSGSQFSVGQSRSCNLWLKDPSISKILC  168



>ref|XP_009414468.1| PREDICTED: uncharacterized protein LOC103995579 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1247

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  405  KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KR +K+    AW KL+SQ+ QN H+ L  S F+VGQ R C+L + DPS+SK LC
Sbjct  115  KRVVKATQKAAWAKLISQHSQNPHLFLSGSQFSVGQSRSCNLWLKDPSISKILC  168



>ref|XP_010457286.1| PREDICTED: uncharacterized protein LOC104738781 isoform X1 [Camelina 
sativa]
 ref|XP_010457287.1| PREDICTED: uncharacterized protein LOC104738781 isoform X2 [Camelina 
sativa]
Length=1253

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 70/134 (52%), Gaps = 22/134 (16%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEK--LPEAPLGGEPLVSPMI-LG  344
            G V++ G ES E E+R+ D    D    L + + P  E   +PE     E LV+P    G
Sbjct  56   GPVSDPGSESGEAELRTPDPQTHDAERPLTTTDVPAMETDTIPEV----EALVAPSTPAG  111

Query  345  DSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQC  524
            +  ++ +K K++       KKR  K+     W KL+SQY QN H+ +  S FTVG+ R C
Sbjct  112  EVVVEPEKSKSS-------KKRIAKA----PWAKLISQYSQNPHIFIRGSVFTVGR-RGC  159

Query  525  DLCVDDPSVSKSLC  566
            DLC+ D S+   LC
Sbjct  160  DLCIRDHSMPTVLC  173



>ref|XP_002523054.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39239.1| ATP binding protein, putative [Ricinus communis]
Length=1181

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 63/126 (50%), Gaps = 13/126 (10%)
 Frame = +3

Query  189  VNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDK  368
            V ES     E E+ S+D +   A K       EK  +A   GE LVSP+ L  SA    K
Sbjct  58   VKESEEVHREHELESSDPEVTVASKPGLVADSEKSVDAE--GEGLVSPLPLVKSA--PSK  113

Query  369  VKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPS  548
              A  SA         K N   AWGKLLSQ  Q  H  +  + FTVGQ R CDL ++DPS
Sbjct  114  SAAMKSA---------KPNDKAAWGKLLSQCSQYPHKEMRGTLFTVGQSRNCDLVLNDPS  164

Query  549  VSKSLC  566
            +S +LC
Sbjct  165  ISGTLC  170



>ref|XP_010474879.1| PREDICTED: uncharacterized protein LOC104754393 [Camelina sativa]
Length=1245

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 67/132 (51%), Gaps = 20/132 (15%)
 Frame = +3

Query  189  VNESGPESAEQEIRSAD---LDGASALKSPEAPV--PEKLPEAPLGGEPLVSPMI-LGDS  350
            +   G ES E E+R+ D    D    L + + P    E +PE     E LV P+   G+ 
Sbjct  48   IENRGSESGEPELRTPDPQTHDAERPLTTTDVPAMETETVPEV----EALVPPITPAGEV  103

Query  351  AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  530
             ++ +K K++       KKR  K+     W KL+SQY QN H+ +  S FTVG+ R CDL
Sbjct  104  VVEPEKSKSS-------KKRTAKAQ--APWAKLISQYSQNPHIIIRGSVFTVGR-RGCDL  153

Query  531  CVDDPSVSKSLC  566
            C+ D S+   LC
Sbjct  154  CIKDHSMPTVLC  165



>ref|NP_001117220.2| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE27493.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=1218

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 68/129 (53%), Gaps = 17/129 (13%)
 Frame = +3

Query  189  VNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAID  359
            V++ G  S + E+R++D    D    + + + P  E      L G  LV+P   G+  ++
Sbjct  51   VSDPGSISGDPELRTSDPQSNDAERPVTTTDVPAMETDTNPELEG--LVTPTPAGEVVVE  108

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K K++       KKR  K+     W KLLSQ+PQN H+ +  S FTVG+ R CDLC+ 
Sbjct  109  AEKSKSS-------KKRIAKA----PWAKLLSQFPQNPHLVMRGSVFTVGR-RACDLCIR  156

Query  540  DPSVSKSLC  566
            D S+   LC
Sbjct  157  DHSMPNVLC  165



>ref|NP_171788.3| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE27492.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=1246

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 68/129 (53%), Gaps = 17/129 (13%)
 Frame = +3

Query  189  VNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAID  359
            V++ G  S + E+R++D    D    + + + P  E      L G  LV+P   G+  ++
Sbjct  51   VSDPGSISGDPELRTSDPQSNDAERPVTTTDVPAMETDTNPELEG--LVTPTPAGEVVVE  108

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K K++       KKR  K+     W KLLSQ+PQN H+ +  S FTVG+ R CDLC+ 
Sbjct  109  AEKSKSS-------KKRIAKA----PWAKLLSQFPQNPHLVMRGSVFTVGR-RACDLCIR  156

Query  540  DPSVSKSLC  566
            D S+   LC
Sbjct  157  DHSMPNVLC  165



>gb|AAF02877.1|AC009525_11 Unknown protein [Arabidopsis thaliana]
Length=1217

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 68/129 (53%), Gaps = 17/129 (13%)
 Frame = +3

Query  189  VNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAID  359
            V++ G  S + E+R++D    D    + + + P  E      L G  LV+P   G+  ++
Sbjct  57   VSDPGSISGDPELRTSDPQSNDAERPVTTTDVPAMETDTNPELEG--LVTPTPAGEVVVE  114

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K K++       KKR  K+     W KLLSQ+PQN H+ +  S FTVG+ R CDLC+ 
Sbjct  115  AEKSKSS-------KKRIAKA----PWAKLLSQFPQNPHLVMRGSVFTVGR-RACDLCIR  162

Query  540  DPSVSKSLC  566
            D S+   LC
Sbjct  163  DHSMPNVLC  171



>ref|XP_008801074.1| PREDICTED: uncharacterized protein LOC103715277 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008801075.1| PREDICTED: uncharacterized protein LOC103715277 isoform X2 [Phoenix 
dactylifera]
Length=1148

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWGKLLSQ  QN H+P+  S FTVG  ++CDL + DPSVS +LC
Sbjct  120  AWGKLLSQSSQNPHLPIRGSPFTVGYSKKCDLQLKDPSVSTTLC  163



>gb|KGN44924.1| hypothetical protein Csa_7G396390 [Cucumis sativus]
Length=162

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 67/128 (52%), Gaps = 14/128 (11%)
 Frame = +3

Query  120  KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSP---EA  275
            KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK     + 
Sbjct  30   KRSKVVEASSSTEDV--QSAPPVDPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  276  PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKA-NGSALNRGKKRQL---KSNLGTAWG  443
             VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88   AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  444  KLLSQYPQ  467
            KLLSQ  Q
Sbjct  148  KLLSQCSQ  155



>emb|CDY22053.1| BnaA09g00820D [Brassica napus]
Length=1229

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = +3

Query  201  GPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMILGDSAID  359
            G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P +  +   D
Sbjct  74   GSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPETDANPEVDVLATPTVAEEVVAD  133

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL + 
Sbjct  134  GEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDLSIK  180

Query  540  DPSVSKSLC  566
            D S+  SLC
Sbjct  181  DQSMPSSLC  189



>ref|XP_009111283.1| PREDICTED: uncharacterized protein LOC103836743 [Brassica rapa]
Length=1261

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = +3

Query  201  GPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMILGDSAID  359
            G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P +  +   D
Sbjct  74   GSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPETDANPEVDVLATPAVAEEVVAD  133

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL + 
Sbjct  134  GEKTKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDLSIK  180

Query  540  DPSVSKSLC  566
            D S+  +LC
Sbjct  181  DQSMPSTLC  189



>ref|XP_010921817.1| PREDICTED: uncharacterized protein LOC105045286 [Elaeis guineensis]
Length=1152

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWGKLLSQ  QN H+P+  S FT+G  ++CDL + DPSVS +LC
Sbjct  124  AWGKLLSQCSQNPHLPIRGSPFTIGYSKKCDLQLKDPSVSTTLC  167



>emb|CDY50381.1| BnaCnng19130D [Brassica napus]
Length=1201

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = +3

Query  201  GPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMILGDSAID  359
            G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P +  +   D
Sbjct  76   GSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPEIDANPEVDVLATPTVAEEVVAD  135

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL + 
Sbjct  136  GEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDLSIK  182

Query  540  DPSVSKSLC  566
            D S+  +LC
Sbjct  183  DQSMPSTLC  191



>ref|XP_010542858.1| PREDICTED: uncharacterized protein LOC104815931 isoform X2 [Tarenaya 
hassleriana]
Length=1251

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 13/92 (14%)
 Frame = +3

Query  294  PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  473
            P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLSQ  QN 
Sbjct  91   PDADTEAEVLVTPTAAGEVLVDAEKPKA-------VKKRAGKA----PWGKLLSQCSQNP  139

Query  474  HVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLC  566
            H  +    FTVG+ R CDLC+ DPS+ S +LC
Sbjct  140  HRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLC  170



>ref|XP_010542859.1| PREDICTED: uncharacterized protein LOC104815931 isoform X3 [Tarenaya 
hassleriana]
Length=1263

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 13/92 (14%)
 Frame = +3

Query  294  PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  473
            P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLSQ  QN 
Sbjct  103  PDADTEAEVLVTPTAAGEVLVDAEKPKA-------VKKRAGKA----PWGKLLSQCSQNP  151

Query  474  HVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLC  566
            H  +    FTVG+ R CDLC+ DPS+ S +LC
Sbjct  152  HRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLC  182



>ref|XP_010542857.1| PREDICTED: uncharacterized protein LOC104815931 isoform X1 [Tarenaya 
hassleriana]
Length=1255

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 13/92 (14%)
 Frame = +3

Query  294  PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  473
            P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLSQ  QN 
Sbjct  95   PDADTEAEVLVTPTAAGEVLVDAEKPKA-------VKKRAGKA----PWGKLLSQCSQNP  143

Query  474  HVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLC  566
            H  +    FTVG+ R CDLC+ DPS+ S +LC
Sbjct  144  HRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLC  174



>ref|XP_003591556.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago 
truncatula]
Length=1242

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 79/156 (51%), Gaps = 12/156 (8%)
 Frame = +3

Query  114  NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  287
            N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22   NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  288  KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  458
            K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79   KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  459  YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              QN H+ +    FTVGQGRQ +L + DP++   LC
Sbjct  135  SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLC  170



>gb|AES61807.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1243

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 79/156 (51%), Gaps = 12/156 (8%)
 Frame = +3

Query  114  NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  287
            N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22   NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  288  KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  458
            K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79   KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  459  YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              QN H+ +    FTVGQGRQ +L + DP++   LC
Sbjct  135  SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLC  170



>gb|KEH43221.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1194

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 79/156 (51%), Gaps = 12/156 (8%)
 Frame = +3

Query  114  NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  287
            N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22   NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  288  KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  458
            K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79   KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  459  YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
              QN H+ +    FTVGQGRQ +L + DP++   LC
Sbjct  135  SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLC  170



>gb|KFK42647.1| hypothetical protein AALP_AA1G022100 [Arabis alpina]
Length=1240

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 23/156 (15%)
 Frame = +3

Query  120  KRSKATE----SLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKS---PEAP  278
            KRSKA      S S+++  +  + PG+  + G ES E E+R++D       +S    +  
Sbjct  28   KRSKAAAEPAGSSSASEVPIENQIPGS--DPGSESGEPELRTSDPQSNGVERSVVKTDVV  85

Query  279  VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQ  458
              E  P+  + G  LV+P   G+   D +K K+        KKR  K+     W KLLSQ
Sbjct  86   AMENCPDTEVEG--LVTPNPAGEVVADAEKSKS-------AKKRIAKA----PWAKLLSQ  132

Query  459  YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            Y QN H  +  S +TVG+ + CDLC+ D S+   LC
Sbjct  133  YSQNPHRVIRSSVYTVGR-KGCDLCIKDQSMPSVLC  167



>ref|XP_009587828.1| PREDICTED: uncharacterized protein LOC104085490, partial [Nicotiana 
tomentosiformis]
Length=928

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  459  YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            + QN H  + + T++VGQGRQCDLC+ DPSVSKSLC
Sbjct  276  FSQNPHFVMHRPTYSVGQGRQCDLCIGDPSVSKSLC  311



>ref|XP_008800830.1| PREDICTED: uncharacterized protein LOC103715088 [Phoenix dactylifera]
Length=1257

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  390  LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            L   KKR LK     AW KLLSQ  QN H+ +  S FTVGQG  C+L + DPSV ++LC
Sbjct  118  LELSKKRDLKVQ-PKAWAKLLSQCSQNPHLVICGSQFTVGQGPSCNLSLKDPSVGRTLC  175



>ref|XP_007037955.1| ATPase family AAA domain-containing protein 1-A isoform 2, partial 
[Theobroma cacao]
 gb|EOY22456.1| ATPase family AAA domain-containing protein 1-A isoform 2, partial 
[Theobroma cacao]
Length=887

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +3

Query  318  PLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQST  497
            P+ +P+  G + I +DK +++ S  +  +K+       T W +LLSQ+ QN +VP+  S 
Sbjct  90   PVTAPIADGSAPIVLDKGRSSFSTWSICQKQNPNFETSTPWCRLLSQFAQNPNVPICTSN  149

Query  498  FTVGQGRQCDLCVDDPSVSKSLC  566
            FT+G  + C+  + D ++S  LC
Sbjct  150  FTIGSSKHCNFQLKDQAISAMLC  172



>ref|XP_007037954.1| ATPase family AAA domain-containing protein 1-A isoform 1 [Theobroma 
cacao]
 gb|EOY22455.1| ATPase family AAA domain-containing protein 1-A isoform 1 [Theobroma 
cacao]
Length=1201

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +3

Query  318  PLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQST  497
            P+ +P+  G + I +DK +++ S  +  +K+       T W +LLSQ+ QN +VP+  S 
Sbjct  85   PVTAPIADGSAPIVLDKGRSSFSTWSICQKQNPNFETSTPWCRLLSQFAQNPNVPICTSN  144

Query  498  FTVGQGRQCDLCVDDPSVSKSLC  566
            FT+G  + C+  + D ++S  LC
Sbjct  145  FTIGSSKHCNFQLKDQAISAMLC  167



>ref|XP_010501293.1| PREDICTED: uncharacterized protein LOC104778535 [Camelina sativa]
Length=523

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (50%), Gaps = 15/129 (12%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMI-LGDSAID  359
            G V++ G ES E E+R+ D     A    E P+        +  + + +P    GD  ++
Sbjct  80   GPVSDPGSESGEPELRTPDPQTHDA----ERPLTTTTDVPAMETDTIPAPSTPAGDVVVE  135

Query  360  VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  539
             +K K++       KKR   +     W KL+SQY QN H+ +  S FTVG+ R CDLC+ 
Sbjct  136  PEKSKSS-------KKRTAIAK--APWAKLISQYSQNPHIIIRSSVFTVGR-RGCDLCIR  185

Query  540  DPSVSKSLC  566
            D S+   LC
Sbjct  186  DHSMPTVLC  194



>gb|KCW58479.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1094

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC
Sbjct  109  AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLC  152



>ref|XP_008805743.1| PREDICTED: uncharacterized protein LOC103718614 isoform X1 [Phoenix 
dactylifera]
Length=1253

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  387  ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + DPS+S++LC
Sbjct  114  ALELPKKRVKKVQPKAAWAKLLSQCSQNPHLVICGYQFTVGQSPACNLTLKDPSISRTLC  173



>ref|XP_010069946.1| PREDICTED: uncharacterized protein LOC104456788 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58475.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1232

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC
Sbjct  109  AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLC  152



>gb|KCW58478.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1206

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC
Sbjct  109  AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLC  152



>ref|XP_010069947.1| PREDICTED: uncharacterized protein LOC104456788 isoform X2 [Eucalyptus 
grandis]
Length=1205

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC
Sbjct  109  AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLC  152



>gb|KCW58480.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=829

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  435  AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC
Sbjct  109  AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLC  152



>ref|XP_006440095.1| hypothetical protein CICLE_v100185461mg, partial [Citrus clementina]
 gb|ESR53335.1| hypothetical protein CICLE_v100185461mg, partial [Citrus clementina]
Length=730

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G + + ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPVVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>ref|XP_006440096.1| hypothetical protein CICLE_v100185461mg, partial [Citrus clementina]
 gb|ESR53336.1| hypothetical protein CICLE_v100185461mg, partial [Citrus clementina]
Length=764

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 15/123 (12%)
 Frame = +3

Query  243  DGASALKSPEAPVPEKLP--EAPLGGE----------PLVS---PMILGDSAIDVDKVKA  377
            D +  + +P AP P +    + P+ GE          P VS   P+  G + + ++K ++
Sbjct  47   DNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPVVMEKPRS  106

Query  378  NGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSK  557
            + S+ +  +K+       T W +LLSQ  QNS+VP+  S FTVG  RQC+  + D ++S 
Sbjct  107  SFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISA  166

Query  558  SLC  566
             LC
Sbjct  167  VLC  169



>ref|XP_010931645.1| PREDICTED: uncharacterized protein LOC105052512 [Elaeis guineensis]
Length=1249

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  402  KKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            KKR LK     AW KLLSQ  QN H+ +  S FTVGQG  C+L + D SVS++LC
Sbjct  114  KKRVLKVQ-PKAWAKLLSQCSQNPHLVICGSQFTVGQGPSCNLSLKDLSVSRNLC  167



>ref|XP_010663739.1| PREDICTED: uncharacterized protein LOC100266414 isoform X2 [Vitis 
vinifera]
 emb|CBI15650.3| unnamed protein product [Vitis vinifera]
Length=1216

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  297  EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  476
            EA L   P+ +P+  G S I VDK +++ S+ +  +K+  ++++   W KLLSQ+ QN +
Sbjct  87   EAALAA-PVSAPIAEGTSPIVVDKPRSSFSSWSVYQKQNYETSM--PWCKLLSQFSQNPN  143

Query  477  VPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            V +    FT+G  R C+  + D ++S  LC
Sbjct  144  VSIGVINFTIGSSRHCNFPLKDQTISPILC  173



>ref|XP_002279926.2| PREDICTED: uncharacterized protein LOC100266414 isoform X1 [Vitis 
vinifera]
Length=1247

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  297  EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  476
            EA L   P+ +P+  G S I VDK +++ S+ +  +K+  ++++   W KLLSQ+ QN +
Sbjct  87   EAALAA-PVSAPIAEGTSPIVVDKPRSSFSSWSVYQKQNYETSM--PWCKLLSQFSQNPN  143

Query  477  VPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            V +    FT+G  R C+  + D ++S  LC
Sbjct  144  VSIGVINFTIGSSRHCNFPLKDQTISPILC  173



>ref|XP_010037429.1| PREDICTED: uncharacterized protein LOC104426170 [Eucalyptus grandis]
 gb|KCW49149.1| hypothetical protein EUGRSUZ_K02736 [Eucalyptus grandis]
Length=1204

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G S + VDK +++  + N  +K+       T W +LLSQ  QN +VP+   +F
Sbjct  90   VAAPIPEGTSPLVVDKHRSSFPSWNSFQKQSPSFESSTPWCRLLSQLGQNPNVPISCPSF  149

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            T+G  RQC+  + D ++S  LC
Sbjct  150  TIGASRQCNFPLKDQTISGILC  171



>ref|XP_010914430.1| PREDICTED: uncharacterized protein LOC105039839 isoform X1 [Elaeis 
guineensis]
Length=1250

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  387  ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + D S+S++LC
Sbjct  112  ALELPKKRVKKVQPKAAWAKLLSQSSQNPHLVICGYQFTVGQSPTCNLSLKDSSISRTLC  171



>gb|KCW49150.1| hypothetical protein EUGRSUZ_K02736 [Eucalyptus grandis]
Length=1115

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G S + VDK +++  + N  +K+       T W +LLSQ  QN +VP+   +F
Sbjct  90   VAAPIPEGTSPLVVDKHRSSFPSWNSFQKQSPSFESSTPWCRLLSQLGQNPNVPISCPSF  149

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            T+G  RQC+  + D ++S  LC
Sbjct  150  TIGASRQCNFPLKDQTISGILC  171



>ref|XP_010914431.1| PREDICTED: uncharacterized protein LOC105039839 isoform X2 [Elaeis 
guineensis]
Length=1176

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  387  ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + D S+S++LC
Sbjct  112  ALELPKKRVKKVQPKAAWAKLLSQSSQNPHLVICGYQFTVGQSPTCNLSLKDSSISRTLC  171



>gb|KDO52636.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1203

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G +   ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>ref|XP_006477013.1| PREDICTED: uncharacterized protein LOC102607540 [Citrus sinensis]
Length=1237

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G +   ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>gb|KDO52637.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1237

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G +   ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>gb|KDO52640.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1138

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G +   ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>gb|KDO52638.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1267

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            + +P+  G +   ++K +++ S+ +  +K+       T W +LLSQ  QNS+VP+  S F
Sbjct  88   VTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIF  147

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG  RQC+  + D ++S  LC
Sbjct  148  TVGSSRQCNFPLKDQAISAVLC  169



>ref|XP_009118737.1| PREDICTED: uncharacterized protein LOC103843724 [Brassica rapa]
Length=1152

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +3

Query  438  WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            W KLLSQYPQN H  +  + FTVG+ R CDL + D S+   LC
Sbjct  90   WAKLLSQYPQNPHCVMRGAVFTVGR-RGCDLSIKDQSIPSVLC  131



>ref|XP_007210914.1| hypothetical protein PRUPE_ppa000404mg [Prunus persica]
 gb|EMJ12113.1| hypothetical protein PRUPE_ppa000404mg [Prunus persica]
Length=1204

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  324  VSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFT  503
            V+P I   S   V+K ++  S+ +  +K+       T W KLLSQ  QN ++P+    FT
Sbjct  91   VTPPIAEGSTPVVEKPRSAFSSWSFYQKQSPSFETSTPWCKLLSQSGQNLNIPISTMNFT  150

Query  504  VGQGRQCDLCVDDPSVSKSLC  566
            +G  RQC+  + D ++S  LC
Sbjct  151  IGANRQCNFTLKDQTISGFLC  171



>gb|KDP30932.1| hypothetical protein JCGZ_11308 [Jatropha curcas]
Length=1235

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            +V+P+  G + I VDK + + S+ +   ++Q  +   + W  LLSQ  QN  VP+   +F
Sbjct  92   VVTPIAEGSTPIVVDKPRTSFSSWSSFYQKQ-NTIQESPWCNLLSQSAQNPSVPICVPSF  150

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            T+G  R C+L + D ++S +LC
Sbjct  151  TIGSNRNCNLSLKDQTISATLC  172



>emb|CDY32485.1| BnaA09g51110D [Brassica napus]
Length=1102

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +3

Query  438  WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            W KLLSQYPQN H  +  + FTVG+ R CDL + D S+   LC
Sbjct  92   WAKLLSQYPQNPHRVMRGAVFTVGR-RGCDLSIKDQSIPSVLC  133



>ref|XP_006303888.1| hypothetical protein CARUB_v100081070mg, partial [Capsella rubella]
 gb|EOA36786.1| hypothetical protein CARUB_v100081070mg, partial [Capsella rubella]
Length=772

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 24/133 (18%)
 Frame = +3

Query  183  GAVNESGPESAEQEIRSAD--LDGASA-LKSPEAPVPEK--LPEAPLGGEPLVSPMILGD  347
            G V++ G ES E E R+ D   +GA   + + + P  E   +PE     E LV+P     
Sbjct  53   GPVSDPGSESGEPERRTPDPQTNGAERPVTTADVPAMETDTIPEV----EGLVTPT---P  105

Query  348  SAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCD  527
            + ++ +K K++       KKR  K+     W KL+SQ  QN H  +  S FTVG+ R CD
Sbjct  106  AVVEAEKSKSS-------KKRTAKA----PWAKLISQCSQNPHRVMRGSVFTVGR-RGCD  153

Query  528  LCVDDPSVSKSLC  566
            LC+ D ++   LC
Sbjct  154  LCIKDHTMPTVLC  166



>ref|XP_009411682.1| PREDICTED: uncharacterized protein LOC103993374 [Musa acuminata 
subsp. malaccensis]
Length=1141

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  423  NLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            ++ TAWGKL+S + QN    +  + FTVG  + CDL + DPSV  +LC
Sbjct  110  SMATAWGKLVSLFSQNPSRSICSNLFTVGHSKTCDLQLRDPSVGTTLC  157



>ref|XP_004962808.1| PREDICTED: protein argonaute 14-like isoform X1 [Setaria italica]
Length=250

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  438  WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            W +LL+QYP+  H P+     +VG+G  C +C+DD ++S +LC
Sbjct  96   WARLLAQYPKTPHFPIYGDEISVGRGDDCHICLDDQAISGNLC  138



>emb|CDY18129.1| BnaC05g01520D [Brassica napus]
Length=1214

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 9/82 (11%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            LV+P   G+   + DK K       + +K  LK      W KL+SQYPQN H  +    F
Sbjct  92   LVTPTPTGEVVAEADKSK-------KAEKLWLKRT-KAPWAKLISQYPQNPHRVMRGPVF  143

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            TVG+ R CDL + D S+   LC
Sbjct  144  TVGR-RGCDLSIKDQSMPSVLC  164



>ref|XP_009382545.1| PREDICTED: uncharacterized protein LOC103970483 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1108

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  432  TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             AWGKL+SQ+ +N    +  + FTVG  + CDL + DPSV  +LC
Sbjct  114  VAWGKLVSQFSENPSRSICSNLFTVGHSKNCDLQLRDPSVGTTLC  158



>ref|XP_009382544.1| PREDICTED: uncharacterized protein LOC103970483 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1140

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  432  TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
             AWGKL+SQ+ +N    +  + FTVG  + CDL + DPSV  +LC
Sbjct  114  VAWGKLVSQFSENPSRSICSNLFTVGHSKNCDLQLRDPSVGTTLC  158



>ref|XP_002511201.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51803.1| ATP binding protein, putative [Ricinus communis]
Length=1240

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +3

Query  321  LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  500
            +V+P+  G + + V+K +   S+L    K+ +       W KLL++  QN  V +   TF
Sbjct  93   VVTPIAEGSTPVAVEKPR---SSLASWYKQSITFETSVPWCKLLTESAQNRDVVICTPTF  149

Query  501  TVGQGRQCDLCVDDPSVSKSLC  566
            T+G  RQC+  + D S+S +LC
Sbjct  150  TIGSSRQCNFPLKDQSISGTLC  171



>emb|CDX91317.1| BnaC02g27280D [Brassica napus]
Length=1058

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 38/75 (51%), Gaps = 6/75 (8%)
 Frame = +3

Query  342  GDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  521
            GD  +   +V A G     GKKR         W KLLSQYPQN H  +    FTVG+   
Sbjct  91   GDDEVLAGEVVAEGERSKAGKKRP-----NAPWAKLLSQYPQNPHRIMRGPVFTVGR-LG  144

Query  522  CDLCVDDPSVSKSLC  566
            C+L + D S+  +LC
Sbjct  145  CNLSIKDHSMPTTLC  159



>ref|XP_008439688.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103484405 
[Cucumis melo]
Length=1243

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  432  TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            T W +LLSQ+ QNS+V +  S FT+G  R C+  + D ++S +LC
Sbjct  164  TPWCRLLSQFGQNSNVDIFSSNFTIGSSRGCNFPLKDHTISGTLC  208



>gb|KJB08020.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1231

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>gb|KJB08017.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1145

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>gb|KJB08016.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1194

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>emb|CDX97266.1| BnaA02g20570D [Brassica napus]
Length=1131

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 41/84 (49%), Gaps = 13/84 (15%)
 Frame = +3

Query  315  EPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQS  494
            E L +P + G+       V A G     GKKR         W KLLSQYPQN H  +   
Sbjct  86   EVLATPTLAGE-------VVAEGERSKAGKKRA-----NAPWAKLLSQYPQNPHRIMRGP  133

Query  495  TFTVGQGRQCDLCVDDPSVSKSLC  566
             FTVG+   C+L + D S+  +LC
Sbjct  134  VFTVGR-LGCNLSIKDHSMPSTLC  156



>gb|KJB08013.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
 gb|KJB08014.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
 gb|KJB08015.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1197

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>gb|KJB08019.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1202

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>ref|XP_009342115.1| PREDICTED: uncharacterized protein LOC103934131 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009342142.1| PREDICTED: uncharacterized protein LOC103934149 isoform X4 [Pyrus 
x bretschneideri]
Length=1214

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 65/125 (52%), Gaps = 19/125 (15%)
 Frame = +3

Query  114  NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  272
            N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D    D   A    +
Sbjct  21   NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  273  APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK---KRQLKSNLGTAWG  443
            A   E+ P+A   GE LVSP  LG++A+         + L R K   K+  KSN   AWG
Sbjct  80   ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  444  KLLSQ  458
             L+SQ
Sbjct  132  MLISQ  136



>gb|KJB08018.1| hypothetical protein B456_001G059400 [Gossypium raimondii]
Length=1137

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  PMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVG  509
            P+  G + + +DK +++ +  +  +K+    +  T W +LLSQ  QN +V +  S FT+G
Sbjct  91   PIADGSAPVLLDKGRSSFTTWSISQKQNPNFDTSTPWCRLLSQSAQNPNVSICISNFTIG  150

Query  510  QGRQCDLCVDDPSVSKSLC  566
              + CD  + D ++S  LC
Sbjct  151  SSKHCDFQLKDQTISAVLC  169



>ref|XP_002451231.1| hypothetical protein SORBIDRAFT_05g026170 [Sorghum bicolor]
 gb|EES10219.1| hypothetical protein SORBIDRAFT_05g026170 [Sorghum bicolor]
Length=1205

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  438  WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  566
            W KLLSQ  Q  H P+  + F+VGQ + C+L + D  VSK LC
Sbjct  104  WAKLLSQCSQTPHHPISVAQFSVGQSKSCNLWLKDQPVSKVLC  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960