BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS120A11

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11417.1|  unnamed protein product                                262   2e-77   Coffea canephora [robusta coffee]
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...    258   4e-76   Sesamum indicum [beniseed]
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...    257   7e-76   Solanum tuberosum [potatoes]
ref|XP_009609627.1|  PREDICTED: cellulose synthase A catalytic su...    256   2e-75   Nicotiana tomentosiformis
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...    255   3e-75   Nicotiana sylvestris
gb|AFY06685.1|  cellulose synthase                                      255   3e-75   Nicotiana tabacum [American tobacco]
gb|AEI87569.1|  cellulose synthase catalytic subunit protein            255   4e-75   Nicotiana tabacum [American tobacco]
ref|XP_004252570.1|  PREDICTED: cellulose synthase A catalytic su...    254   1e-74   Solanum lycopersicum
ref|XP_009599913.1|  PREDICTED: cellulose synthase A catalytic su...    254   1e-74   Nicotiana tomentosiformis
gb|AAK49454.1|AF304374_1  cellulose synthase catalytic subunit          254   1e-74   Nicotiana alata [flowering tobacco]
gb|AIA61439.1|  cellulose synthase                                      253   3e-74   Boehmeria nivea [Chinese silk-plant]
gb|EPS58530.1|  hypothetical protein M569_16283                         239   5e-74   Genlisea aurea
ref|XP_009765335.1|  PREDICTED: cellulose synthase A catalytic su...    252   6e-74   Nicotiana sylvestris
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...    251   1e-73   Solanum lycopersicum
ref|XP_006364140.1|  PREDICTED: cellulose synthase A catalytic su...    251   1e-73   Solanum tuberosum [potatoes]
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...    250   3e-73   Sesamum indicum [beniseed]
ref|XP_010106861.1|  Isoxaben-resistant protein 2                       246   6e-72   
dbj|BAG06272.1|  cellulose synthase Z632                                246   1e-71   Zinnia elegans [garden zinnia]
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...    245   2e-71   
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...    245   2e-71   
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...    244   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg             244   3e-71   Prunus persica
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...    243   6e-71   
ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...    243   1e-70   Vitis vinifera
emb|CBI18221.3|  unnamed protein product                                242   2e-70   Vitis vinifera
gb|AFZ78561.1|  cellulose synthase                                      242   2e-70   Populus tomentosa [Chinese white poplar]
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...    241   6e-70   Populus euphratica
ref|XP_002302169.1|  CesA7A-like family protein                         241   6e-70   
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...    240   1e-69   Populus euphratica
ref|XP_002306707.1|  CesA7A-like family protein                         240   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009376550.1|  PREDICTED: cellulose synthase A catalytic su...    239   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...    239   3e-69   Fragaria vesca subsp. vesca
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...    238   6e-69   Cucumis sativus [cucumbers]
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...    238   7e-69   Cucumis melo [Oriental melon]
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...    238   7e-69   Cucumis melo [Oriental melon]
gb|AAT09895.1|  cellulose synthase                                      237   2e-68   Populus tremula x Populus tremuloides
gb|KDO83763.1|  hypothetical protein CISIN_1g001373mg                   234   2e-68   Citrus sinensis [apfelsine]
gb|AGV22110.1|  cellulose synthase 8                                    236   2e-68   Betula luminifera [liang ye hua]
ref|XP_011042923.1|  PREDICTED: cellulose synthase A catalytic su...    235   2e-68   Populus euphratica
ref|XP_007019545.1|  Cellulose synthase 6                               236   3e-68   
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg             235   5e-68   Citrus clementina [clementine]
ref|XP_006473074.1|  PREDICTED: cellulose synthase A catalytic su...    235   5e-68   Citrus sinensis [apfelsine]
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g             235   5e-68   Phaseolus vulgaris [French bean]
gb|KDO83760.1|  hypothetical protein CISIN_1g001373mg                   235   6e-68   Citrus sinensis [apfelsine]
gb|KDO83761.1|  hypothetical protein CISIN_1g001373mg                   235   6e-68   Citrus sinensis [apfelsine]
gb|AFZ78560.1|  cellulose synthase                                      235   7e-68   Populus tomentosa [Chinese white poplar]
gb|KDO83762.1|  hypothetical protein CISIN_1g001373mg                   234   8e-68   Citrus sinensis [apfelsine]
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                234   1e-67   Erythranthe guttata [common monkey flower]
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg                233   1e-67   Erythranthe guttata [common monkey flower]
gb|AEE60899.1|  cellulose synthase                                      234   2e-67   Populus tomentosa [Chinese white poplar]
gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg                232   6e-67   Erythranthe guttata [common monkey flower]
gb|KDP35302.1|  hypothetical protein JCGZ_09461                         232   7e-67   Jatropha curcas
gb|KJB66303.1|  hypothetical protein B456_010G134500                    231   2e-66   Gossypium raimondii
ref|XP_010680991.1|  PREDICTED: cellulose synthase A catalytic su...    231   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...    230   4e-66   Glycine max [soybeans]
gb|KJB59450.1|  hypothetical protein B456_009G255100                    229   5e-66   Gossypium raimondii
ref|XP_007048203.1|  Cellulose synthase 6                               230   6e-66   
gb|KJB59451.1|  hypothetical protein B456_009G255100                    229   6e-66   Gossypium raimondii
gb|KJB59449.1|  hypothetical protein B456_009G255100                    229   6e-66   Gossypium raimondii
gb|KJB18372.1|  hypothetical protein B456_003G049300                    229   7e-66   Gossypium raimondii
gb|KJB14950.1|  hypothetical protein B456_002G150300                    229   7e-66   Gossypium raimondii
gb|KHG29218.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    229   7e-66   Gossypium arboreum [tree cotton]
gb|KJB18371.1|  hypothetical protein B456_003G049300                    228   8e-66   Gossypium raimondii
gb|KJB59452.1|  hypothetical protein B456_009G255100                    229   8e-66   Gossypium raimondii
gb|KJB18370.1|  hypothetical protein B456_003G049300                    229   1e-65   Gossypium raimondii
gb|KJB18373.1|  hypothetical protein B456_003G049300                    229   1e-65   Gossypium raimondii
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    228   2e-65   Gossypium arboreum [tree cotton]
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...    227   6e-65   Nelumbo nucifera [Indian lotus]
gb|AFB18634.1|  CESA5                                                   227   6e-65   Gossypium hirsutum [American cotton]
gb|AFB18639.1|  CESA9                                                   226   9e-65   Gossypium hirsutum [American cotton]
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg             225   9e-65   
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    226   1e-64   Populus euphratica
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    226   1e-64   Gossypium arboreum [tree cotton]
ref|XP_002307145.1|  cellulose synthase family protein                  226   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    226   1e-64   Populus euphratica
gb|AAT09898.1|  cellulose synthase                                      226   2e-64   Populus tremula x Populus tremuloides
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             226   2e-64   Prunus persica
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    226   2e-64   Prunus mume [ume]
gb|KDP30751.1|  hypothetical protein JCGZ_15180                         225   2e-64   Jatropha curcas
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...    225   4e-64   Glycine max [soybeans]
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...    225   4e-64   Ricinus communis
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...    224   4e-64   Nelumbo nucifera [Indian lotus]
gb|KDO57138.1|  hypothetical protein CISIN_1g001369mg                   223   4e-64   Citrus sinensis [apfelsine]
ref|XP_002310628.1|  cellulose synthase family protein                  224   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             224   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...    224   6e-64   Glycine max [soybeans]
gb|AHL45027.1|  cellulose synthase 6A                                   224   6e-64   Linum usitatissimum
gb|AFZ78553.1|  cellulose synthase                                      224   6e-64   Populus tomentosa [Chinese white poplar]
gb|AHL45028.1|  cellulose synthase 6B                                   224   8e-64   Linum usitatissimum
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...    223   1e-63   Glycine max [soybeans]
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   223   1e-63   Citrus sinensis [apfelsine]
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    223   1e-63   Glycine soja [wild soybean]
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             223   1e-63   Citrus clementina [clementine]
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg             222   1e-63   
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    223   2e-63   Populus euphratica
gb|AAO25581.1|  cellulose synthase                                      223   2e-63   Populus tremuloides
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    223   2e-63   Populus euphratica
ref|XP_010678670.1|  PREDICTED: cellulose synthase A catalytic su...    223   2e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AHL45030.1|  cellulose synthase 6D                                   221   5e-63   Linum usitatissimum
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             220   1e-62   Phaseolus vulgaris [French bean]
gb|AHL45029.1|  cellulose synthase 6C                                   219   3e-62   Linum usitatissimum
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...    219   5e-62   
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    219   5e-62   Cucumis melo [Oriental melon]
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    219   6e-62   Eucalyptus grandis [rose gum]
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    218   7e-62   Cucumis sativus [cucumbers]
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...    217   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...    217   3e-61   
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    216   6e-61   Tarenaya hassleriana [spider flower]
gb|AES62337.2|  cellulose synthase-like protein                         215   1e-60   Medicago truncatula
gb|KEH43649.1|  cellulose synthase-like protein                         215   1e-60   Medicago truncatula
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    214   2e-60   Gossypium arboreum [tree cotton]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    213   6e-60   Cicer arietinum [garbanzo]
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g             213   7e-60   Phaseolus vulgaris [French bean]
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    213   8e-60   Nicotiana tomentosiformis
gb|AGV22108.1|  cellulose synthase 6                                    213   8e-60   Betula luminifera [liang ye hua]
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    212   1e-59   Glycine soja [wild soybean]
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...    212   1e-59   Glycine max [soybeans]
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    211   4e-59   Nicotiana sylvestris
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             211   4e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    209   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_002878571.1|  hypothetical protein ARALYDRAFT_900606             209   2e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit             207   5e-58   Medicago truncatula
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             206   2e-57   
ref|XP_006394118.1|  hypothetical protein EUTSA_v100035740mg            204   3e-57   
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    205   3e-57   Tarenaya hassleriana [spider flower]
emb|CDY42621.1|  BnaC01g00330D                                          205   3e-57   Brassica napus [oilseed rape]
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             205   5e-57   Capsella rubella
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    204   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    204   1e-56   Brassica rapa
emb|CDY41973.1|  BnaA01g05450D                                          204   1e-56   Brassica napus [oilseed rape]
dbj|BAF01335.1|  cellulose synthase                                     202   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                204   1e-56   Brassica napus [oilseed rape]
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    201   2e-56   Glycine soja [wild soybean]
emb|CDY14504.1|  BnaC03g49550D                                          203   2e-56   Brassica napus [oilseed rape]
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    203   2e-56   Brassica rapa
emb|CDY08854.1|  BnaA06g23700D                                          203   2e-56   Brassica napus [oilseed rape]
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    203   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...    202   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             202   4e-56   Capsella rubella
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    202   6e-56   Sesamum indicum [beniseed]
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    202   6e-56   Tarenaya hassleriana [spider flower]
emb|CDX81249.1|  BnaC09g06600D                                          202   7e-56   
emb|CDY18696.1|  BnaA09g06990D                                          202   7e-56   Brassica napus [oilseed rape]
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    201   7e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...    202   7e-56   Brassica rapa
ref|XP_010444419.1|  PREDICTED: cellulose synthase A catalytic su...    202   7e-56   Camelina sativa [gold-of-pleasure]
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit                201   8e-56   Brassica napus [oilseed rape]
gb|AEK86669.1|  cellulose synthase 5                                    201   8e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDP12843.1|  unnamed protein product                                201   1e-55   Coffea canephora [robusta coffee]
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...    201   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462809.1|  PREDICTED: cellulose synthase A catalytic su...    201   2e-55   Camelina sativa [gold-of-pleasure]
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    201   2e-55   Arabis alpina [alpine rockcress]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       200   2e-55   Morus notabilis
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936             199   4e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010063847.1|  PREDICTED: cellulose synthase A catalytic su...    199   7e-55   Eucalyptus grandis [rose gum]
ref|XP_010484268.1|  PREDICTED: cellulose synthase A catalytic su...    199   7e-55   Camelina sativa [gold-of-pleasure]
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    198   1e-54   Gossypium arboreum [tree cotton]
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             197   3e-54   
gb|AAC29067.1|  cellulose synthase                                      197   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             196   5e-54   Eutrema salsugineum [saltwater cress]
gb|AFD33697.1|  cellulose synthase A                                    195   1e-53   Eucalyptus camaldulensis
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    195   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    194   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...    194   3e-53   Camelina sativa [gold-of-pleasure]
ref|NP_179768.1|  cellulose synthase A9                                 194   4e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31305.1|  BnaA02g34360D                                          193   8e-53   Brassica napus [oilseed rape]
ref|XP_010063851.1|  PREDICTED: cellulose synthase A catalytic su...    192   1e-52   Eucalyptus grandis [rose gum]
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    192   2e-52   Brassica rapa
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg             192   2e-52   Capsella rubella
emb|CDY46820.1|  BnaC02g43280D                                          191   3e-52   Brassica napus [oilseed rape]
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550          190   1e-51   Amborella trichopoda
emb|CDX81145.1|  BnaC03g03990D                                          189   1e-51   
ref|XP_003592086.1|  Cellulose synthase                                 189   2e-51   
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                189   2e-51   Brassica napus [oilseed rape]
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    189   3e-51   Brassica rapa
emb|CDY56540.1|  BnaA03g55860D                                          189   3e-51   Brassica napus [oilseed rape]
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...    187   9e-51   Vitis vinifera
gb|EPS71230.1|  hypothetical protein M569_03522                         186   2e-50   Genlisea aurea
emb|CBI21555.3|  unnamed protein product                                186   3e-50   Vitis vinifera
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    186   4e-50   Cicer arietinum [garbanzo]
gb|EPS66740.1|  hypothetical protein M569_08032                         184   6e-50   Genlisea aurea
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                185   7e-50   Erythranthe guttata [common monkey flower]
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    182   5e-49   Solanum tuberosum [potatoes]
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...    181   1e-48   Solanum lycopersicum
gb|KJB49074.1|  hypothetical protein B456_008G100100                    167   2e-47   Gossypium raimondii
ref|XP_011466718.1|  PREDICTED: cellulose synthase A catalytic su...    171   4e-45   Fragaria vesca subsp. vesca
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...    170   1e-44   Elaeis guineensis
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...    163   3e-42   Elaeis guineensis
ref|XP_011466721.1|  PREDICTED: cellulose synthase A catalytic su...    162   3e-42   Fragaria vesca subsp. vesca
gb|EYU17477.1|  hypothetical protein MIMGU_mgv1a016004mg                146   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    156   6e-40   Nelumbo nucifera [Indian lotus]
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     156   6e-40   Eucalyptus grandis [rose gum]
ref|XP_008785840.1|  PREDICTED: cellulose synthase A catalytic su...    156   9e-40   Phoenix dactylifera
ref|XP_009414591.1|  PREDICTED: cellulose synthase A catalytic su...    156   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFR38707.1|  cellulose synthase                                      142   1e-39   Populus trichocarpa [western balsam poplar]
gb|AFR38732.1|  cellulose synthase                                      142   1e-39   Populus fremontii
gb|AFR38724.1|  cellulose synthase                                      142   1e-39   Populus alba [abele]
gb|AFR38723.1|  cellulose synthase                                      142   1e-39   Populus alba [abele]
gb|AFR38726.1|  cellulose synthase                                      142   1e-39   Populus alba [abele]
gb|AFR38730.1|  cellulose synthase                                      142   1e-39   Populus fremontii
ref|XP_002963550.1|  family 2 glycosyltransferase                       155   3e-39   
gb|AFR38984.1|  cellulose synthase                                      141   4e-39   Populus trichocarpa [western balsam poplar]
dbj|BAM05571.1|  cellulose synthase 3                                   146   5e-39   Eucalyptus globulus subsp. globulus
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    154   5e-39   Elaeis guineensis
gb|KHG22630.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    145   6e-39   Gossypium arboreum [tree cotton]
gb|KHG19971.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    145   8e-39   Gossypium arboreum [tree cotton]
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    152   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    152   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          152   2e-38   Amborella trichopoda
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    152   2e-38   Phoenix dactylifera
ref|XP_009411928.1|  PREDICTED: cellulose synthase A catalytic su...    152   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    151   3e-38   Sesamum indicum [beniseed]
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    151   3e-38   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    151   4e-38   
gb|AFR38735.1|  cellulose synthase                                      138   4e-38   Populus fremontii
dbj|BAM05574.1|  cellulose synthase 3                                   147   7e-38   Eucalyptus pyrocarpa
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         150   8e-38   Jatropha curcas
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    150   8e-38   Sesamum indicum [beniseed]
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                150   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    150   1e-37   Nicotiana tomentosiformis
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    150   1e-37   Nicotiana tomentosiformis
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    150   1e-37   Nicotiana sylvestris
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    150   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW69155.1|  putative cellulose synthase family protein              149   2e-37   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-37   Solanum lycopersicum
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              149   2e-37   Selaginella moellendorffii
ref|XP_003598145.1|  Cellulose synthase                                 149   3e-37   Medicago truncatula
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    149   3e-37   Setaria italica
gb|ACL36368.1|  cellulose synthase CesA10                               141   3e-37   Bambusa oldhamii
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          149   3e-37   Sorghum bicolor [broomcorn]
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    149   3e-37   
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            149   3e-37   Zea mays [maize]
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    149   3e-37   Oryza brachyantha
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    149   3e-37   Solanum tuberosum [potatoes]
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    148   5e-37   Phoenix dactylifera
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    148   5e-37   Elaeis guineensis
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                     148   6e-37   Eucalyptus grandis [rose gum]
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           148   6e-37   Eucalyptus grandis [rose gum]
gb|EPS60781.1|  hypothetical protein M569_14019                         148   6e-37   Genlisea aurea
gb|AFR58756.2|  cellulose synthase 3                                    148   6e-37   Eucalyptus tereticornis [red ironbark]
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     148   6e-37   Eucalyptus grandis [rose gum]
gb|AGE09566.1|  cellulose synthase-like protein                         148   6e-37   Eucalyptus cladocalyx
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     148   6e-37   Eucalyptus grandis [rose gum]
gb|AGJ71354.1|  cellulose synthase 3                                    148   6e-37   Eucalyptus urophylla
gb|AEK31217.1|  cellulose synthase A                                    147   7e-37   Eucalyptus camaldulensis
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        147   7e-37   
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    147   7e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    147   8e-37   Gossypium arboreum [tree cotton]
gb|ACL36367.1|  cellulose synthase CesA9                                140   8e-37   Bambusa oldhamii
gb|KJB07760.1|  hypothetical protein B456_001G044700                    146   8e-37   Gossypium raimondii
ref|XP_002325122.1|  cellulose synthase family protein                  147   9e-37   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    147   9e-37   Gossypium arboreum [tree cotton]
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          147   9e-37   
gb|AFB18637.1|  CESA8                                                   147   9e-37   Gossypium hirsutum [American cotton]
gb|KJB53884.1|  hypothetical protein B456_009G009700                    147   1e-36   Gossypium raimondii
gb|AFZ78551.1|  cellulose synthase                                      147   1e-36   Populus tomentosa [Chinese white poplar]
ref|XP_006435515.1|  hypothetical protein CICLE_v10000117mg             147   1e-36   
gb|KDO85323.1|  hypothetical protein CISIN_1g045222mg                   147   1e-36   Citrus sinensis [apfelsine]
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-36   Cucumis melo [Oriental melon]
gb|AAM26299.1|  cellulose synthase                                      147   1e-36   Populus tremuloides
gb|AFB18636.1|  CESA7                                                   147   1e-36   Gossypium hirsutum [American cotton]
gb|KJB07761.1|  hypothetical protein B456_001G044700                    147   1e-36   Gossypium raimondii
gb|KJB07762.1|  hypothetical protein B456_001G044700                    147   1e-36   Gossypium raimondii
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    147   1e-36   Phoenix dactylifera
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-36   Populus euphratica
gb|KEH32616.1|  cellulose synthase-like protein                         145   1e-36   Medicago truncatula
ref|XP_007013860.1|  Cellulose synthase family protein isoform 2        146   1e-36   
gb|AAP97496.1|  cellulose synthase                                      147   1e-36   Solanum tuberosum [potatoes]
gb|AEE60897.1|  cellulose synthase                                      147   1e-36   Populus tomentosa [Chinese white poplar]
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-36   Populus euphratica
dbj|BAJ85783.1|  predicted protein                                      147   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        147   1e-36   
dbj|BAG06269.1|  cellulose synthase Z811                                146   1e-36   Zinnia elegans [garden zinnia]
gb|AFR39009.1|  cellulose synthase                                      134   1e-36   Populus nigra [black poplar]
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    147   2e-36   Nicotiana tomentosiformis
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    147   2e-36   Nicotiana tomentosiformis
tpg|DAA60392.1|  TPA: cellulose synthase7                               139   2e-36   
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    146   2e-36   Fragaria vesca subsp. vesca
gb|KEH32618.1|  cellulose synthase-like protein                         147   2e-36   
gb|ACJ38667.1|  cellulose synthase                                      147   2e-36   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               146   2e-36   
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   146   2e-36   
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    146   2e-36   
ref|NP_001063207.1|  Os09g0422500                                       146   2e-36   
gb|AII73574.1|  cellulose synthase 7-A                                  146   2e-36   
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    146   2e-36   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    146   2e-36   
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          146   2e-36   
gb|KEH32617.1|  cellulose synthase-like protein                         145   2e-36   
emb|CDP02834.1|  unnamed protein product                                146   2e-36   
ref|XP_004509860.1|  PREDICTED: cellulose synthase A catalytic su...    146   2e-36   
gb|ACC59196.1|  cellulose synthase                                      146   3e-36   
gb|ACJ38665.1|  cellulose synthase                                      146   3e-36   
ref|XP_006494425.1|  PREDICTED: probable cellulose synthase A cat...    146   3e-36   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    145   3e-36   
gb|AGX27203.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27220.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27222.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27215.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27223.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27216.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27206.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27202.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27235.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27219.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27205.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27214.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27238.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27211.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27231.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27199.1|  cellulose synthase 7                                    145   4e-36   
gb|AFZ78559.1|  cellulose synthase                                      145   4e-36   
gb|AGX27233.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27229.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27236.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27212.1|  cellulose synthase 7                                    145   4e-36   
gb|AGX27201.1|  cellulose synthase 7                                    145   4e-36   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    145   4e-36   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             145   4e-36   
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    145   4e-36   
ref|XP_002308412.1|  cellulose synthase family protein                  145   5e-36   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             145   5e-36   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    145   5e-36   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    145   6e-36   
gb|AFP93559.1|  cellulose synthase A1                                   145   6e-36   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    145   6e-36   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    145   6e-36   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    145   6e-36   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    145   6e-36   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    145   7e-36   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    145   7e-36   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             145   7e-36   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   145   7e-36   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    145   7e-36   
ref|XP_010091161.1|  OsCesA7 protein                                    145   7e-36   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             144   8e-36   
emb|CDP13491.1|  unnamed protein product                                144   8e-36   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    144   9e-36   
ref|XP_004238519.1|  PREDICTED: probable cellulose synthase A cat...    144   9e-36   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    144   9e-36   
ref|NP_001051830.1|  Os03g0837100                                       144   1e-35   
gb|ACT67415.1|  cellulose synthase                                      144   1e-35   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    144   1e-35   
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    144   1e-35   
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    144   1e-35   
ref|XP_008387657.1|  PREDICTED: cellulose synthase A catalytic su...    143   1e-35   
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    144   1e-35   
gb|AHH81946.1|  cellulose synthase                                      144   1e-35   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    144   1e-35   
ref|XP_006354075.1|  PREDICTED: probable cellulose synthase A cat...    144   1e-35   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    144   1e-35   
gb|AEE60896.1|  cellulose synthase                                      144   1e-35   
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    144   2e-35   
gb|AGX27207.1|  cellulose synthase 7                                    144   2e-35   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    143   2e-35   
gb|AGC97433.2|  cellulose synthase                                      144   2e-35   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   143   2e-35   
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    143   2e-35   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    143   2e-35   
ref|XP_008337190.1|  PREDICTED: cellulose synthase A catalytic su...    134   3e-35   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    143   3e-35   
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    143   4e-35   
gb|AGV22109.1|  cellulose synthase 7                                    143   4e-35   
gb|AAX18649.1|  cellulose synthase catalytic subunit                    143   4e-35   
gb|AFI71895.1|  cellulose synthase 6                                    142   4e-35   
gb|ACR38558.1|  unknown                                                 140   4e-35   
gb|AAT57672.1|  cellulose synthase catalytic subunit                    142   5e-35   
ref|XP_007018605.1|  Cellulose synthase 6                               142   5e-35   
ref|XP_002319002.2|  cellulose synthase 6 family protein                142   5e-35   
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    142   6e-35   
ref|XP_002983952.1|  family 2 glycosyltransferase                       142   6e-35   
gb|AFW81388.1|  cellulose synthase1                                     142   7e-35   
gb|AFW81389.1|  cellulose synthase1                                     142   7e-35   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             142   7e-35   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    142   7e-35   
ref|XP_004499618.1|  PREDICTED: probable cellulose synthase A cat...    142   7e-35   
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    142   8e-35   
emb|CBI40805.3|  unnamed protein product                                142   8e-35   
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    142   8e-35   
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    142   8e-35   
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     142   8e-35   
emb|CBI21020.3|  unnamed protein product                                141   8e-35   
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           142   8e-35   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    142   8e-35   
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    142   1e-34   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    141   1e-34   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             141   1e-34   
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    141   1e-34   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             141   1e-34   
ref|NP_001104954.1|  cellulose synthase-1                               141   1e-34   
emb|CAN73700.1|  hypothetical protein VITISV_013112                     141   1e-34   
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                     141   1e-34   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    141   1e-34   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    141   1e-34   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    141   1e-34   
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             141   1e-34   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    141   1e-34   
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    141   1e-34   
gb|AEK31219.1|  cellulose synthase A                                    141   1e-34   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             141   2e-34   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    141   2e-34   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     141   2e-34   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                141   2e-34   
gb|AAY43217.1|  cellulose synthase BoCesA1                              141   2e-34   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    141   2e-34   
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     141   2e-34   
ref|NP_001059487.1|  Os07g0424400                                       141   2e-34   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-34   
gb|ADV58936.1|  cellulose synthase                                      140   2e-34   
gb|ADR74043.1|  cellulose synthase                                      140   2e-34   
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    140   2e-34   
gb|AAP40636.1|  cellulose synthase 6                                    140   2e-34   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          140   2e-34   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    140   3e-34   
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                140   4e-34   
gb|ADD71499.1|  cellulose synthase catalytic subunit                    140   4e-34   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    140   4e-34   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    140   4e-34   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    140   4e-34   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    140   4e-34   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    140   4e-34   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    140   4e-34   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          140   4e-34   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    140   4e-34   
ref|NP_001105574.1|  cellulose synthase2                                140   4e-34   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    140   4e-34   
gb|AFZ78555.1|  cellulose synthase                                      140   4e-34   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    139   5e-34   
emb|CDX85455.1|  BnaA02g03580D                                          139   5e-34   
tpg|DAA60393.1|  TPA: cellulose synthase7                               139   5e-34   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    139   5e-34   
ref|XP_007148742.1|  hypothetical protein PHAVU_005G010400g             139   5e-34   
ref|XP_007148743.1|  hypothetical protein PHAVU_005G010400g             139   6e-34   
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    139   6e-34   
emb|CAN60659.1|  hypothetical protein VITISV_018069                     139   6e-34   
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          139   6e-34   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    139   8e-34   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    139   8e-34   
gb|AFZ78563.1|  cellulose synthase                                      139   8e-34   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    139   8e-34   
gb|KHN26453.1|  Putative cellulose synthase A catalytic subunit 3...    139   9e-34   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    139   9e-34   
ref|XP_006382504.1|  cellulose synthase 6 family protein                139   9e-34   
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    139   9e-34   
gb|AHL45024.1|  cellulose synthase 1B                                   139   1e-33   
ref|XP_006582808.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    138   2e-33   
ref|XP_010110357.1|  Protein radially swollen 1                         138   2e-33   
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-33   
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-33   
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-33   
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-33   
ref|NP_001104957.1|  cellulose synthase7                                138   2e-33   
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    138   2e-33   
ref|XP_003628669.1|  Cellulose synthase                                 137   2e-33   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    137   2e-33   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              137   2e-33   
ref|XP_002960291.1|  family 2 glycosyltransferase                       137   2e-33   
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    137   2e-33   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    137   2e-33   
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             137   2e-33   
gb|ABI78958.1|  cellulose synthase 5                                    137   3e-33   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    137   3e-33   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    137   3e-33   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    137   3e-33   
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    137   3e-33   
gb|AAC39333.1|  RSW1-like cellulose synthase catalytic subunit          135   3e-33   
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    137   3e-33   
gb|AFS95066.1|  cellulose synthase                                      137   3e-33   
ref|XP_010266322.1|  PREDICTED: probable cellulose synthase A cat...    137   3e-33   
gb|AHL45023.1|  cellulose synthase 1A                                   137   3e-33   
ref|XP_002466137.1|  hypothetical protein SORBIDRAFT_01g002050          137   4e-33   
ref|XP_001757832.1|  predicted protein                                  137   4e-33   
emb|CCW28829.1|  putative cellulose synthase family protein             137   4e-33   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             137   5e-33   
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    137   5e-33   
gb|ACQ99194.1|  cellulose synthase                                      137   5e-33   
gb|AAT66940.1|  CesA1                                                   136   6e-33   
tpg|DAA39741.1|  TPA: putative cellulose synthase family protein        136   7e-33   
ref|XP_010238067.1|  PREDICTED: probable cellulose synthase A cat...    136   7e-33   
ref|XP_010238134.1|  PREDICTED: probable cellulose synthase A cat...    136   7e-33   
ref|XP_008667855.1|  PREDICTED: uncharacterized protein LOC100280...    136   9e-33   
ref|XP_007138396.1|  hypothetical protein PHAVU_009G205200g             135   1e-32   
ref|XP_006474030.1|  PREDICTED: cellulose synthase A catalytic su...    135   1e-32   
gb|KDO62271.1|  hypothetical protein CISIN_1g039678mg                   135   1e-32   
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    135   1e-32   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    135   1e-32   
ref|XP_006453580.1|  hypothetical protein CICLE_v10010165mg             135   1e-32   
ref|XP_006474029.1|  PREDICTED: cellulose synthase A catalytic su...    135   1e-32   
dbj|BAJ93596.1|  predicted protein                                      132   2e-32   
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         135   2e-32   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    135   2e-32   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             135   2e-32   
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       135   2e-32   
gb|AAY43224.2|  cellulose synthase BoCesA7                              135   2e-32   
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    135   2e-32   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    135   2e-32   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    135   2e-32   
ref|XP_003562886.1|  PREDICTED: probable cellulose synthase A cat...    135   2e-32   



>emb|CDP11417.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 159/179 (89%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E+EFDDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDEFDDLEHEFDYNSNER  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+ + EAALAAR N G G  VN SG TTPSE+D S +DS VPLLTYG+EDDGISADK
Sbjct  121  RDPQQIAEAALAARLNIGRGGNVNASGITTPSEMD-SALDSEVPLLTYGQEDDGISADK  178



>ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1084

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-PEHM  478
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E+EFDDL++EFDY  +H+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDEFDDLENEFDYNAQHI  120

Query  479  TEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             EA+L++R N G   +G  +TPSE+DPSGV S +PLLTYG+EDD ISADK
Sbjct  121  AEASLSSRLNIGRSASGI-STPSELDPSGVISEIPLLTYGQEDDTISADK  169



>ref|XP_006367803.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1091

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGS RV+GD+EE+EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRVDGDDEEDEFDDLDHEFDYDGTPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            H++EAALAAR   G   N SG  TP+EVDP+ ++S +PLLTYG+EDD ISADK
Sbjct  121  HLSEAALAARLGRGTNYNASGLNTPAEVDPAALNSEIPLLTYGQEDDTISADK  173



>ref|XP_009609627.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1087

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 157/173 (91%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +M+EAAL++R   G   N SG TTPSEVDP+ ++S +PLLTYG+EDD ISADK
Sbjct  121  YMSEAALSSRLGRGTNHNASGLTTPSEVDPAALNSEIPLLTYGQEDDTISADK  173



>ref|XP_009782822.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1091

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 156/173 (90%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +M+EAAL++R   G   N SG TTPSE+DP+ + S +PLLTYG+EDD ISADK
Sbjct  121  YMSEAALSSRLGRGTNHNASGLTTPSEIDPAALHSEIPLLTYGQEDDTISADK  173



>gb|AFY06685.1| cellulose synthase [Nicotiana tabacum]
Length=1091

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 156/173 (90%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +M+EAAL++R   G   N SG TTPSE+DP+ + S +PLLTYG+EDD ISADK
Sbjct  121  YMSEAALSSRLGRGTNHNASGLTTPSEIDPAALHSEIPLLTYGQEDDTISADK  173



>gb|AEI87569.1| cellulose synthase catalytic subunit protein [Nicotiana tabacum]
Length=1091

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 156/173 (90%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +M+EAAL++R   G   N SG TTPSE+DP+ + S +PLLTYG+EDD ISADK
Sbjct  121  YMSEAALSSRLGRGTNHNASGLTTPSEIDPAALHSEIPLLTYGQEDDTISADK  173



>ref|XP_004252570.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1083

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P    
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PHQTA  119

Query  482  EAALAARFNGGLG-VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EAAL+AR N G G  N SG  TPSE+DP+ + + +PLLTYG+E+DGISADK
Sbjct  120  EAALSARLNVGRGNPNASGYATPSEMDPAALGTEIPLLTYGQEEDGISADK  170



>ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1084

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P+   
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PQQTA  119

Query  482  EAALAARFNGGLG-VNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EAAL+AR N G G  N SGT TPSE+DP+ + + +PLLTYG+EDD ISADK
Sbjct  120  EAALSARLNFGRGHPNASGTATPSEMDPAALGTEIPLLTYGQEDDTISADK  170



>gb|AAK49454.1|AF304374_1 cellulose synthase catalytic subunit [Nicotiana alata]
Length=1091

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 156/173 (90%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INAD++GRVTSVKELSGQICQICGDE+E+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADDVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCR CYEYERREGNQACPQCKTR+KRIKGSPRV+GD+E++EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRVDGDDEDDEFDDLDHEFDYHGNPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +M+EAA ++R   G   N SG TTPSEVDP+ ++S +PLLTYG+EDD ISADK
Sbjct  121  YMSEAAFSSRLGRGTNHNASGLTTPSEVDPAALNSEIPLLTYGQEDDTISADK  173



>gb|AIA61439.1| cellulose synthase [Boehmeria nivea]
Length=1090

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 155/177 (88%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEEE+ DDL++EF       
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEEDTDDLENEFHIQHGGD  120

Query  467  PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P ++T+A LAAR N G G  VNGSG TTPSE+D + V + +PLLTYG+ED GIS+DK
Sbjct  121  PHNLTDAMLAARLNVGRGSQVNGSGITTPSELDSASVATDIPLLTYGQEDTGISSDK  177



>gb|EPS58530.1| hypothetical protein M569_16283, partial [Genlisea aurea]
Length=343

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MD  GRL+AGSHNRNEFVLINADEIG+VTSVKELSGQICQICGDE+E  +DGEPFVACNE
Sbjct  1    MDATGRLVAGSHNRNEFVLINADEIGKVTSVKELSGQICQICGDEIEFKIDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP--EH  475
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV+GDE+EEEFDDL+HEFDY   E 
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVDGDEDEEEFDDLEHEFDYDGNEQ  120

Query  476  MTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            + E AL++RFN     +G   +P ++DP+ V+S +PLLTYG+EDD ISADK
Sbjct  121  IAEPALSSRFNISRTASGITISP-DLDPAAVNSEIPLLTYGQEDDTISADK  170



>ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1084

 Score =   252 bits (643),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P+   
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PQQTA  119

Query  482  EAALAARFNGGLG-VNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EAAL+AR + G G  N SGT TPSE+DP+ + + +PLLTYG+EDD ISADK
Sbjct  120  EAALSARLSIGRGHPNASGTATPSEMDPAALGTEIPLLTYGQEDDTISADK  170



>ref|XP_004237809.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1090

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 5/173 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+E+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGS RV+GD+EE+EFDDLDHEFDY   P 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRVDGDDEEDEFDDLDHEFDYDGTPR  120

Query  473  HMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            H++EAAL AR   G   N SG  TP+EVDP+ ++S +PLLTYG+EDD ISADK
Sbjct  121  HLSEAAL-ARLGRGTNYNASGLNTPAEVDPAALNSEIPLLTYGQEDDTISADK  172



>ref|XP_006364140.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1084

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE+EFDDLD+EFD P    
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDEFDDLDNEFD-PHQTA  119

Query  482  EAALAARFNGGLG-VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EAAL+AR N G G  N SG  T SE+DP+ + + +PLLTYG+E+DGISADK
Sbjct  120  EAALSARLNVGRGNPNASGYATQSEMDPAALGTEIPLLTYGQEEDGISADK  170



>ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1092

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 8/176 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKEL+GQICQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELTGQICQICGDEIEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E+EFDDL++EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDEFDDLENEFDYNGNER  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               +H+ E AL+ R N G   +G  TTPSE+D + ++S +PLLTYG+EDD ISADK
Sbjct  121  RDHQHIAEGALSGRLNIGRTASGI-TTPSELDATAINSEIPLLTYGQEDDTISADK  175



>ref|XP_010106861.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXC12321.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1121

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 152/177 (86%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFV+INADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDE+E++ DDL++EF       
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEDEDDIDDLENEFHIANGGD  120

Query  467  PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P ++ EA LAAR N G    +NG G TTPSE+D + V + +PLLTYG+ED GIS+DK
Sbjct  121  PNNIAEAMLAARLNVGRSSQINGFGITTPSELDAASVATEIPLLTYGQEDTGISSDK  177



>dbj|BAG06272.1| cellulose synthase Z632 [Zinnia elegans]
Length=1090

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 153/171 (89%), Gaps = 3/171 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+GRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFP+CRPCYEYERREGNQACPQCKTR+KRIKGSPRV+GDE+E+ FDDLDHEFD    ++
Sbjct  61   CAFPICRPCYEYERREGNQACPQCKTRFKRIKGSPRVDGDEDEDGFDDLDHEFDLANGVS  120

Query  482  EAALAARFNGGLGV-NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EA L++R N G G  N SG  TPSE+D + ++  +PLLTYG+EDDGISADK
Sbjct  121  EAGLSSRLNIGRGTSNASGFGTPSELD-AALNPEIPLLTYGQEDDGISADK  170



>ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 152/179 (85%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASNER  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G  VNGSG +TP+E D + V S +PLLTYG+ED GI++DK
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGISTPAEFDSASVASEIPLLTYGQEDVGIASDK  179



>ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 152/179 (85%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASSER  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G  VNGSG +TP+E D + + S +PLLTYG+ED GI++DK
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGISTPAEFDSASIASEIPLLTYGQEDVGIASDK  179



>ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 152/179 (85%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASNEK  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G  +NGSG +TP+E D + V S +PLLTYG+ED GI++DK
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHINGSGISTPAEFDSASVASEIPLLTYGQEDVGIASDK  179



>ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
 ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Prunus mume]
 gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
Length=1096

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 153/179 (85%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLENEFDISSNDR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA LAAR N G G  V+GSG +TP+E D + + S +PLLTYG+ED GI++DK
Sbjct  121  RDPHHIAEAVLAARLNIGRGSHVHGSGISTPAEFDSASIASEIPLLTYGQEDVGIASDK  179



>ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 151/179 (84%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDIASXER  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G  VNGSG +TP+E D +   S +PLLTYG+ED GI++DK
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHVNGSGISTPAEFDSASXASEIPLLTYGQEDVGIASDK  179



>ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
Length=1096

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 150/177 (85%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDFRSNYS  120

Query  467  --PEHMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA L+A  N G   + SG +TP ++D S V S +PLLTYG+ D GIS+DK
Sbjct  121  RDPHQVAEAMLSAHLNIGSHAHTSGISTPLDLDSSSVPSGIPLLTYGQYDVGISSDK  177



>emb|CBI18221.3| unnamed protein product [Vitis vinifera]
Length=1067

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 150/177 (85%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLENEFDFRSNYS  120

Query  467  --PEHMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA L+A  N G   + SG +TP ++D S V S +PLLTYG+ D GIS+DK
Sbjct  121  RDPHQVAEAMLSAHLNIGSHAHTSGISTPLDLDSSSVPSGIPLLTYGQYDVGISSDK  177



>gb|AFZ78561.1| cellulose synthase [Populus tomentosa]
Length=1097

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 150/179 (84%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGINDR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  +TEA LAAR N G G   N SG  TPSE D + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPHQVTEALLAARLNTGRGSHSNVSGLATPSEFDSASVVPEIPLLTYGEEDVGISSDK  179



>ref|XP_011042869.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1093

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  467  --PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N G G     SG  TPSE D + V   +PLLTYGEED GIS+DK
Sbjct  121  KDPRHVAEALLSARLNTGRGSQAHVSGFATPSEFDSASVAPEIPLLTYGEEDVGISSDK  179



>ref|XP_002302169.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE81442.1| CesA7A-like family protein [Populus trichocarpa]
Length=1093

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  467  --PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N G G     SG  TPSE D + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPRHVAEALLSARLNTGRGSQAHVSGFATPSEFDSASVAPEIPLLTYGEEDVGISSDK  179



>ref|XP_011044242.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1095

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 149/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDMGINDR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G   N SG  TPSE D + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPHQVAEALLAARLNTGRGSQSNVSGFATPSEFDSASVVPEIPLLTYGEEDAGISSDK  179



>ref|XP_002306707.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE93703.1| CesA7A-like family protein [Populus trichocarpa]
Length=1095

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 149/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGINDR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G   N SG  TPSE D + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPHQVAEALLAARLNTGRGSQSNVSGFATPSEFDSASVVPEIPLLTYGEEDVGISSDK  179



>ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGS RVEGDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSQRVEGDEEEDDIDDLENEFDIASNER  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA LAAR N G G  +NGSG +TP++ D + + S +PLLTYG+ED GI++DK
Sbjct  121  RDPHSIAEAVLAARLNIGRGSHLNGSGISTPADFDSASIASEIPLLTYGQEDVGIASDK  179



>ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSPRVEGDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRSCYEYERREGNQSCPQCKTRYKRVKGSPRVEGDEEEEDIDDLENEFDIASNDR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  +  A LAAR N G G  V+GSG +TP+E D + V S +PLLTYG+ED GI++DK
Sbjct  121  RDPHQIAAAVLAARLNIGRGSQVHGSGISTPAEFDTASVASEIPLLTYGKEDVGIASDK  179



>ref|XP_004138382.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004160741.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
Length=1090

 Score =   238 bits (607),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL++EFD     P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLENEFDIANKDP  120

Query  470  EHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               +EA L      G G   NGSG   S++D S V + +PLLTYG+ED GIS+DK
Sbjct  121  NSASEAMLYPHLAVGRGSHANGSGNMASDLDSSSVPTDIPLLTYGQEDAGISSDK  175



>ref|XP_008463087.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Cucumis melo]
Length=1091

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL++EFD     P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLENEFDIANKDP  120

Query  470  EHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               +EA L      G G   NGSG   S++D S V + +PLLTYG+ED GIS+DK
Sbjct  121  NSASEAMLYPHLAVGRGSHANGSGNMASDLDSSSVPTDIPLLTYGQEDAGISSDK  175



>ref|XP_008463088.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Cucumis melo]
Length=1090

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL++EFD     P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLENEFDIANKDP  120

Query  470  EHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               +EA L      G G   NGSG   S++D S V + +PLLTYG+ED GIS+DK
Sbjct  121  NSASEAMLYPHLAVGRGSHANGSGNMASDLDSSSVPTDIPLLTYGQEDAGISSDK  175



>gb|AAT09895.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1095

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 148/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSP+V+GDEEEE+ DDL++EF+      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPKVDGDEEEEDTDDLENEFEIGVNDR  120

Query  467  --PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N G G     SG  TPS  D + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPRHVAEALLSARLNTGRGSQAHVSGFATPSGFDSASVAPEIPLLTYGEEDVGISSDK  179



>gb|KDO83763.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
 gb|KDO83764.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=786

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>gb|AGV22110.1| cellulose synthase 8 [Betula luminifera]
Length=1091

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 147/173 (85%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRLIAGSHNRNEF+LINADE+ RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFILINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---PE  472
            CAFPVCRPCYEYERREGNQACPQCKTR+KRIKG PRVEGDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRIKGCPRVEGDEEEEDTDDLENEFDIGSNSH  120

Query  473  HMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTY-GEEDDGISADK  628
            ++ EA L+AR N G G + +  TPSE+D + V   +PLLTY G ED GIS+DK
Sbjct  121  NIAEAMLSARLNVGRGSHATIATPSELDSASVAPEIPLLTYGGHEDAGISSDK  173



>ref|XP_011042923.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=943

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 148/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRVKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  467  --PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N G G     SG  TPSE D + V   +PLLTYGEED  IS+DK
Sbjct  121  KDPRHVAEALLSARLNTGRGSQAHVSGFATPSEFDSASVAPEIPLLTYGEEDVEISSDK  179



>ref|XP_007019545.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOY16770.1| Cellulose synthase 6 [Theobroma cacao]
Length=1091

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 144/180 (80%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD  +H+ 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIANHDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+AR N   G    V+G  +TP+E+D + V S +PLLTYG+ED GIS+DK
Sbjct  121  RDPHHIAAAMLSARLNISRGSQPHVSGI-STPAELDAASVASEIPLLTYGQEDVGISSDK  179



>ref|XP_006434481.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47721.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=1091

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>ref|XP_006473074.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
Length=1091

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>ref|XP_007151999.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
 gb|ESW23993.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
Length=1089

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 141/176 (80%), Gaps = 8/176 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  RVT+V ELSGQICQICGDE+E+TV GEPFVACNE
Sbjct  1    MDTNGRLIAGSHNRNEFVLINADETARVTAVTELSGQICQICGDELEVTVIGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGS RVEGDEEE+  DDL+ EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSARVEGDEEEDNTDDLESEFDFGGNLR  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                HM EA  + R N G  VNGS  TPSE D + V S +PLLTYG+ED GISADK
Sbjct  121  RDHHHMAEAMFSTRLNYG-SVNGSVHTPSEFDAASVASEIPLLTYGQEDVGISADK  175



>gb|KDO83760.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1091

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>gb|KDO83761.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1089

 Score =   235 bits (599),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>gb|AFZ78560.1| cellulose synthase [Populus tomentosa]
Length=1093

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 147/179 (82%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVT  KELSGQIC+ICGDE+E+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTPFKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDIGVNDR  120

Query  467  --PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N G G     SG  TPSE + + V   +PLLTYGEED GIS+DK
Sbjct  121  RDPRHVAEALLSARLNTGRGSQAHVSGFATPSEFESASVAPEIPLLTYGEEDVGISSDK  179



>gb|KDO83762.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=917

 Score =   234 bits (596),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDTDDLENEFDINDRKD  120

Query  467  PEHMTEAALAARFNGGLGVNG--SG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P H+ EA L++R N G G     SG TTPSEVD   V   +PLLTYG ED GIS+DK
Sbjct  121  PHHIAEAMLSSRLNIGRGSQAYVSGITTPSEVDSVSVAQEIPLLTYGNEDVGISSDK  177



>gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=1093

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 150/179 (84%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV+GDE+EEEFDDLD+EFDY     
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRVDGDEDEEEFDDLDNEFDYDNNNS  120

Query  467  ---PEHMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYG-EEDDGISADK  628
                  ++E A  +R N  +G   SG T  S+VDP+ V+S +PLLTYG EEDD ISADK
Sbjct  121  KGHTRQISEGAYYSRHN-NIGRTSSGITNSSDVDPAAVNSEIPLLTYGQEEDDAISADK  178



>gb|EYU17480.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=938

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 150/179 (84%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVE TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV+GDE+EEEFDDLD+EFDY     
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRVDGDEDEEEFDDLDNEFDYDNNNS  120

Query  467  ---PEHMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYG-EEDDGISADK  628
                  ++E A  +R N  +G   SG T  S+VDP+ V+S +PLLTYG EEDD ISADK
Sbjct  121  KGHTRQISEGAYYSRHN-NIGRTSSGITNSSDVDPAAVNSEIPLLTYGQEEDDAISADK  178



>gb|AEE60899.1| cellulose synthase [Populus tomentosa]
Length=1100

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 149/184 (81%), Gaps = 15/184 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGR-----VTSVKELSGQICQICGDEVEITVDGEPF  286
            M+TKGRLIAGSHNRNEFVLINADEI R     VTSVKELSGQIC+ICGDE+EITVDGEPF
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARLLSIPVTSVKELSGQICKICGDEIEITVDGEPF  60

Query  287  VACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY  466
            VACNECAFPVCRPCYEYERREGNQACPQC+TRYKRIKGSPRV+GDEEEE+ DDL++EFD 
Sbjct  61   VACNECAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRVDGDEEEEDTDDLENEFDI  120

Query  467  -------PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGI  616
                   P  + EA LAAR N G G   N SG  TPSE D + V   +PLLTYGEED GI
Sbjct  121  GINDRRDPHQVAEALLAARLNTGRGSQSNVSGFATPSEFDSASVVPEIPLLTYGEEDVGI  180

Query  617  SADK  628
            S+DK
Sbjct  181  SSDK  184



>gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata]
Length=1087

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 148/178 (83%), Gaps = 11/178 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDE+E + DGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFSADGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KRIKGSPRV+GDE+E+EFDDLD+EFDY     
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRVDGDEDEDEFDDLDNEFDYNNGNE  120

Query  467  ---PEHMTEAALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               P  + E+  + R  G +G   SG T  S++D + V+S +PLLTYG+EDD ISADK
Sbjct  121  RRDPHQIAESTHSTR--GNIGRTSSGITNSSDLDAAAVNSEIPLLTYGQEDDTISADK  176



>gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas]
Length=1097

 Score =   232 bits (592),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDDIDDLEHEFDYGNFDG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L+AR N G     N +G  T SE+D S + S +PLLTYGEED  IS+D+
Sbjct  121  MGPEQVAEAMLSARLNTGRASYSNAAGIPTSSELDSSPLSSKIPLLTYGEEDAEISSDR  179



>gb|KJB66303.1| hypothetical protein B456_010G134500 [Gossypium raimondii]
Length=1090

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 140/180 (78%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EI++DGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISLDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD    + 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASQDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                H+  A L+AR N   G    V+G  +TP+E D + V + +PLLTYGEED GIS+DK
Sbjct  121  RDSHHIAAAMLSARLNINRGSQPHVSGI-STPAEFDAASVATEIPLLTYGEEDAGISSDK  179



>ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   231 bits (588),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 121/178 (68%), Positives = 144/178 (81%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E T + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENTKNDEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCY+YER EGNQACPQCKTRYKRIKG  RVEGDE+E++ DD+++E  Y     
Sbjct  61   CAFPVCRPCYDYERGEGNQACPQCKTRYKRIKGCARVEGDEDEDDLDDIENELKYVSEDR  120

Query  467  -PEHMTEAALAARFNGGLG-VNGSG-TTPSEVDPSGVDSXVP-LLTYGEEDDGISADK  628
             P+H+ E+  ++R N G    N SG +TP+E+DP+ V S    LLTYG+ED GIS D+
Sbjct  121  DPQHIAESVFSSRLNVGRAPSNASGLSTPAELDPAAVSSEQQLLLTYGQEDAGISPDR  178



>ref|XP_003536418.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN17022.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1095

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARVNAVTELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGN+ CPQCKT YKR+KGSPRVEGDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRPCYEYERREGNKICPQCKTIYKRLKGSPRVEGDEEEEDIDDLENEFDIGSNIR  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+ EA L+AR N   G  +N  G TTPSE D + V + +PLLTY  ED GISADK
Sbjct  121  HDPHHVAEALLSARLNAARGSQMNAPGITTPSEFDAASVAADIPLLTYDHEDVGISADK  179



>gb|KJB59450.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=902

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 141/179 (79%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLGV--NGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G   + SG +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGSQPHVSGISTPAELDAASVAADIPLLTYGQEDVGISPDK  179



>ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao]
Length=1096

 Score =   230 bits (586),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 143/175 (82%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENGRIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
              + EA L AR N G G   N SG  T SE+D S   S +PLLTYGEE   ISAD
Sbjct  121  HQVAEAMLTARLNTGRGSHPNTSGIPTHSELDSSPPSSQIPLLTYGEEGSEISAD  175



>gb|KJB59451.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1064

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G    V+G  +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGSQPHVSGI-STPAELDAASVAADIPLLTYGQEDVGISPDK  179



>gb|KJB59449.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1090

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G    V+G  +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGSQPHVSGI-STPAELDAASVAADIPLLTYGQEDVGISPDK  179



>gb|KJB18372.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1008

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 142/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L AR N G G   N SG    SE+D S   S +PLLTYGEED  ISAD
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASGMPASSELDSSLPSSQIPLLTYGEEDSEISAD  175



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 141/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L    N G G   NGSG    SEVD S   S +PLLTYGEE   ISAD
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSGLPAHSEVDSSPPSSQIPLLTYGEEHSEISAD  175



>gb|KHG29218.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1090

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 141/179 (79%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLGV--NGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G   + SG +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGSQPHISGISTPAELDAASVATDIPLLTYGQEDVGISPDK  179



>gb|KJB18371.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=925

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 142/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L AR N G G   N SG    SE+D S   S +PLLTYGEED  ISAD
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASGMPASSELDSSLPSSQIPLLTYGEEDSEISAD  175



>gb|KJB59452.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1035

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G    V+G  +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGSQPHVSGI-STPAELDAASVAADIPLLTYGQEDVGISPDK  179



>gb|KJB18370.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1096

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 142/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L AR N G G   N SG    SE+D S   S +PLLTYGEED  ISAD
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASGMPASSELDSSLPSSQIPLLTYGEEDSEISAD  175



>gb|KJB18373.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1082

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 142/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYDASDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L AR N G G   N SG    SE+D S   S +PLLTYGEED  ISAD
Sbjct  121  QQVAEAMLNARLNTGRGTHQNASGMPASSELDSSLPSSQIPLLTYGEEDSEISAD  175



>gb|KHG24947.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1071

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 142/175 (81%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDASDP  120

Query  470  EHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L AR N G G + +       SE+D S   S +PLLTYGEED  ISAD
Sbjct  121  QQVAEAMLNARLNTGRGTHQNAYGMPASSELDSSLPSSQIPLLTYGEEDSEISAD  175



>ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1095

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 142/175 (81%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINADEIGRV SV+ELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MDTGGRLVAGSHNRNEFVLINADEIGRVKSVRELSGQICQICGDEVEITEDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GDEEE+  DDL++EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDEEEDGIDDLENEFDFRSRDT  120

Query  470  EHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +H  EA L++R N G G   N SG T      S ++  +PLLTYG+ED  IS D+
Sbjct  121  QHTAEAILSSRLNVGRGPNANASGVTMPSDHSSSLNPEIPLLTYGQEDAEISPDR  175



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 140/175 (80%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L    N G G   NGSG    SE+D     S +PLLTYGEE   ISAD
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSGLPAHSEIDSFPPSSQIPLLTYGEEHSEISAD  175



>gb|AFB18639.1| CESA9 [Gossypium hirsutum]
Length=1090

 Score =   226 bits (577),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 140/180 (78%), Gaps = 12/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AG HNRNEFVLINADE+ RVTSVKELSGQICQICGDE+EI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGPHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKG PRVE        D+ E EFD   H+ 
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVEGDEEEDGADDLENEFDIASHDR  120

Query  461  dYPEHMTEAALAARFNGGLG----VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+  A L+ R+N   G    V+G  +TP+E+D + V + +PLLTYG+ED GIS DK
Sbjct  121  RDPHHIAAAMLSGRYNINHGPQPHVSGI-STPAELDAASVAAGIPLLTYGQEDVGISPDK  179



>ref|XP_007213712.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14911.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=853

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVD-PSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA L++R N G G + +   P+  +  S + S VPLLTYGEED  IS+D+
Sbjct  121  MGPHQVAEAVLSSRLNIGRGSDCNVRIPTHSEHESPLGSEVPLLTYGEEDSEISSDR  177



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRMNTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDADISSDR  179



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 140/175 (80%), Gaps = 7/175 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYDALDP  120

Query  470  EHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            + + EA L    N G G   NGSG    SE+D     S +PLLTYGEE   ISAD
Sbjct  121  QQVAEAMLGGHLNTGRGFHPNGSGLPAHSEIDSFPPSSQIPLLTYGEEHSEISAD  175



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRINTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDAEISSDR  179



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRMNTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDADISSDR  179



>gb|AAT09898.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1096

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 145/179 (81%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRINTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDAEISSDR  179



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVD-PSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA L++R N G G + +   P+  +  S + S VPLLTYGEED  IS+D+
Sbjct  121  MGPHQVAEAVLSSRLNIGRGSDCNVRIPTHSEHESPLGSEVPLLTYGEEDSEISSDR  177



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEDDIDDLDNEFNYGNLDT  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVD-PSGVDSXVPLLTYGEEDDGISADK  628
              P  + EA L++R N G G + +   P+  +  S + S VPLLTYGEED  IS+D+
Sbjct  121  MGPHQVAEAVLSSRLNIGRGSDCNVRIPTHSEHESPLGSEVPLLTYGEEDSEISSDR  177



>gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas]
Length=1092

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 143/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSV+ELSGQICQICGDE+E T DGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEISRVTSVEELSGQICQICGDEIEFTRDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEE+ DDL++EFD      
Sbjct  61   CAFPVCRHCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEEDIDDLENEFDISAHDR  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+H+ EA L+A  N G   + + +   TPSE D       +PLLTY EED GIS+DK
Sbjct  121  RDPQHIAEAMLSAHLNIGRSTHANVSEFGTPSESDSVSAAPGIPLLTYREEDVGISSDK  179



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 146/178 (82%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDIDA  120

Query  467  --PEHMTEAALAARFNGGLGV-NGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+ M+E+  + R N G G  NGSG  T  E   S ++S +PLLTYGEED  IS+D+
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSGLATNLEHGSSALNSDIPLLTYGEEDPEISSDR  178



>ref|XP_002524299.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF38039.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1095

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 144/174 (83%), Gaps = 5/174 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY--PEH  475
            CAFPVCRPCYEYERREGN+ACPQCKT YKRIKGSPRVEGDEEEE+ DDL++EFD    ++
Sbjct  61   CAFPVCRPCYEYERREGNRACPQCKTIYKRIKGSPRVEGDEEEEDTDDLENEFDISASQN  120

Query  476  MTEAALAARFNGGLG--VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            + EA  +A  N      VN SG   P E+D   + S +PLLTY EED GIS+DK
Sbjct  121  IAEAIFSAHLNISTASQVNVSGFAAPPELDSVPIVSEIPLLTYHEEDVGISSDK  174



>ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1093

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFV+INADEIGRV SVKELSGQICQICGDEVEIT DGEPFVACNE
Sbjct  1    MYTGGRLVAGSHNRNEFVVINADEIGRVKSVKELSGQICQICGDEVEITDDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEH--  475
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGS RV+GDEEE+  DDL++EFD+  H  
Sbjct  61   CAFPVCRPCYEYERREGNQICPQCKTRYKRIKGSARVDGDEEEDGVDDLENEFDFGSHEM  120

Query  476  ----MTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                  EA L++R N G G   + + PS  D S +   +PLLTYG+ED GIS+D+
Sbjct  121  DSHQTAEAILSSRLNVGRGSYANASVPSNPDSSSLSPDIPLLTYGQEDAGISSDR  175



>gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=791

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+H+++AAL+AR      +N SG  T SE+D + + S +PLLTYGEEDD IS+D+
Sbjct  121  FGPQHVSDAALSAR------LNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDR  171



>ref|XP_002310628.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91078.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G     N SG  T  E+D S ++S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRMNTGRASHSNISGIPTHGELDSSPLNSKIPLLTYGEEDTEISSDR  179



>ref|XP_002310629.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
 gb|EEE91079.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
Length=1095

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C ICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNFDG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G     N SG  T  E+D S ++S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRMNTGRASHSNISGIPTHGELDSSPLNSKIPLLTYGEEDTEISSDR  179



>ref|XP_003548102.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 140/170 (82%), Gaps = 7/170 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRVEGDEEE++ DDL+ EFD      
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRVEGDEEEDDTDDLESEFD-----I  114

Query  482  EAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             +  +AR N G  VNGS    PSE D + V S +PLLTYG+ED GISADK
Sbjct  115  GSVFSARLNYGSQVNGSVIHAPSEFDAASVASEIPLLTYGQEDVGISADK  164



>gb|AHL45027.1| cellulose synthase 6A [Linum usitatissimum]
Length=1096

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 145/178 (81%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIQSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC+TR+KR+KGS RVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARVEGDEEEDDIDDLEHEFDYGNLES  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE +TE  LAAR N G G  VNG GT  S++D S   + VPLLTYGEED  IS+D+
Sbjct  121  LTPEQVTELMLAARLNTGRGSQVNGFGTPMSDLDSSPPGAKVPLLTYGEEDADISSDQ  178



>gb|AFZ78553.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRINTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDAEISSDR  179



>gb|AHL45028.1| cellulose synthase 6B [Linum usitatissimum]
Length=1096

 Score =   224 bits (570),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 145/178 (81%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC+TR+KR+KGS RVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE +TE  LAAR N G G  VNG GT  S++D S   + VPLLTYGEED  IS+D+
Sbjct  121  LTPEQVTELMLAARLNTGRGSQVNGFGTPMSDLDSSPPGAKVPLLTYGEEDADISSDQ  178



>ref|XP_003518592.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 140/170 (82%), Gaps = 7/170 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRVEGDEEE++ DDL+ EFD      
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRVEGDEEEDDSDDLESEFD-----I  114

Query  482  EAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             +  +AR N G  VNGS    PSE D + V S +PLLTYG+ED GISADK
Sbjct  115  GSVFSARLNYGSQVNGSVIHAPSEFDAASVASEIPLLTYGQEDVGISADK  164



>gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=1091

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+H+++AAL+AR      +N SG  T SE+D + + S +PLLTYGEEDD IS+D+
Sbjct  121  FGPQHVSDAALSAR------LNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDR  171



>gb|KHN00756.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 140/170 (82%), Gaps = 7/170 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRVEGDEEE++ DDL+ EFD      
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRVEGDEEEDDSDDLESEFD-----I  114

Query  482  EAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             +  +AR N G  VNGS    PSE D + V S +PLLTYG+ED GISADK
Sbjct  115  GSVFSARLNYGSQVNGSVIHAPSEFDAASVASEIPLLTYGQEDVGISADK  164



>ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=1091

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+H+++AAL+AR      +N SG  T SE+D + + S +PLLTYGEEDD IS+D+
Sbjct  121  FGPQHVSDAALSAR------LNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDR  171



>ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 gb|ESR41145.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=918

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQIC DE+EIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLDHEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT-TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P+H+++AAL+AR      +N SG  T SE+D + + S +PLLTYGEEDD IS+D+
Sbjct  121  FGPQHVSDAALSAR------LNASGIPTRSELDSAPLSSNIPLLTYGEEDDDISSDR  171



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++  N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSGMNTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDADISSDR  179



>gb|AAO25581.1| cellulose synthase [Populus tremuloides]
Length=1096

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDTDDLEHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++R   G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSRITLGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDAEISSDR  179



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLEHEFDYGNLDG  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGT---TPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              PE + EA L++  N G   + +     T  E+D S + S +PLLTYGEED  IS+D+
Sbjct  121  LSPEQVAEAMLSSGMNTGRASHSNTYGIPTQGELDSSPLSSKIPLLTYGEEDADISSDR  179



>ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 8/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ+CQICGDE+E   + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENIENNEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCY+YER EGNQACPQCKTRYKRIKG  RVEGDE+E++ DD+++E  Y     
Sbjct  61   CAFPVCRPCYDYEREEGNQACPQCKTRYKRIKGCARVEGDEDEDDLDDIENELKYVSNNR  120

Query  467  -PEHMTEAALAARFNGGLG-VNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             P+H+ EA  ++R + G    N SG +TP+E+DP+ V S   LLTYG+ED GIS+D+
Sbjct  121  DPQHIAEAIYSSRLSVGRAPSNASGLSTPAELDPAAVSSEQLLLTYGQEDTGISSDR  177



>gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum]
Length=1097

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 144/178 (81%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC+TRYKR+KG PRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               E + E  LAAR N G G  VNGSG   S++D S   + VPLLTYGEED  IS+D+
Sbjct  121  LTSEQVAELMLAARLNTGRGSQVNGSGYPGSDLDSSPPGAKVPLLTYGEEDADISSDQ  178



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 143/178 (80%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+EE  DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEEGSDDLDNEFDYGDFDA  120

Query  467  --PEHMTEAALAARFNGGLGVNGSG--TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               + M+E+  + R N G G NG+    T  E   + ++S +PLLTYGEED  IS+D+
Sbjct  121  MGTQPMSESLFSGRLNTGRGANGASGIGTNLEHGAAPLNSEIPLLTYGEEDPEISSDR  178



>gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum]
Length=1097

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 143/178 (80%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC+TRYKR+KG PRVEGDEEE++ DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRVEGDEEEDDIDDLEHEFDYGNLEG  120

Query  467  --PEHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               E + E  LAAR N G G  VNGSG    ++D S   + VPLLTYGEED  IS+D+
Sbjct  121  LTSEQVAELMLAARLNTGRGSQVNGSGYPGLDLDSSPPGAKVPLLTYGEEDAEISSDR  178



>ref|XP_008338760.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1097

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe-------f  460
            CAFPVCRPCYEYERREGNQACP CKTRYKRI+GSPRVEGDEEE++ DDLD+E        
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIRGSPRVEGDEEEDDIDDLDNEFNCGNLDA  120

Query  461  dYPEHMTEAALAARFNGGLGVNGSGTTP--SEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  + E+ L+AR N G G N +   P  SE + S + S +PLLTYGEED  IS+++
Sbjct  121  LGPHQVAESVLSARLNVGRGSNYNARIPAHSEHESSPLGSEIPLLTYGEEDTEISSNR  178



>ref|XP_008440995.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cucumis melo]
Length=1091

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDDIDDLDNEFDYGNLDD  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTT---PSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H  E +  +  N G G + + +     SE +PS + S +PLLTYGEED  ISAD+
Sbjct  121  FGPHHAAEGSYGSHLNSGRGSHPNASHIPGQSEHEPSPLGSEIPLLTYGEEDYEISADQ  179



>ref|XP_010027732.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW54322.1| hypothetical protein EUGRSUZ_I00286 [Eucalyptus grandis]
Length=1092

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 143/175 (82%), Gaps = 8/175 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQICQICGDEVEI  DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESSRIKSVKELSGQICQICGDEVEIA-DGELFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEE++ DDLD+EFDY    P
Sbjct  60   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDNEFDYDPSDP  119

Query  470  EHMTEAALAARFNGGLGV--NGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +H+ E   ++R N G G   N SG  P++V+ S + S +PLLTYG+ED  IS D+
Sbjct  120  QHVAEKTFSSRLNYGRGAHRNASG-MPTDVESSPLSSQIPLLTYGQEDAEISPDQ  173



>ref|XP_004141979.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 ref|XP_004160480.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 gb|KGN48397.1| hypothetical protein Csa_6G486700 [Cucumis sativus]
Length=1090

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEVE+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDE+E++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEDEDDIDDLDNEFDYGNLDD  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTT---PSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H  E +  +  N G G + + +     SE +PS + S +PLLTYGEED  ISAD+
Sbjct  121  FGPRHAAEGSYGSHLNSGRGSHPNASHIPGQSEHEPSPLGSEIPLLTYGEEDYEISADQ  179



>ref|XP_009350646.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Pyrus x bretschneideri]
Length=1097

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 140/178 (79%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe-------f  460
            CAFPVCRPCYEYERREGNQACP CKTRYKRIKGSPRVEGDEEE++ DDLD+E        
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFNCGNLDA  120

Query  461  dYPEHMTEAALAARFNGGLGVNGSGTTP--SEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  +  + L+AR N G G N +   P  SE + S + S +PLLTYGEED  IS+++
Sbjct  121  LGPHQVAGSVLSARLNVGRGSNYNARIPTHSEHESSPLGSEIPLLTYGEEDTEISSNQ  178



>ref|XP_009350645.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 140/178 (79%), Gaps = 9/178 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe-------f  460
            CAFPVCRPCYEYERREGNQACP CKTRYKRIKGSPRVEGDEEE++ DDLD+E        
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFNCGNLDA  120

Query  461  dYPEHMTEAALAARFNGGLGVNGSGTTP--SEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P  +  + L+AR N G G N +   P  SE + S + S +PLLTYGEED  IS+++
Sbjct  121  LGPHQVAGSVLSARLNVGRGSNYNARIPTHSEHESSPLGSEIPLLTYGEEDTEISSNQ  178



>ref|XP_010520165.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1066

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 7/169 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDYP+H++
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYPDHVS  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            E  L++R       + SG    ++D +   S +PLLTY  ED  IS+++
Sbjct  121  EGMLSSR-------HHSGIPQYDLDSAPPGSHIPLLTYDGEDMEISSER  162



>gb|AES62337.2| cellulose synthase-like protein [Medicago truncatula]
Length=1093

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 130/180 (72%), Gaps = 11/180 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCRPCYEYERREGNQACP CKT+YKRIKGSPRVE        D+ E EFD   +  
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRVEGDEEEDGIDDLENEFDIGSNIK  120

Query  461  dYPEHMTEAALAARFNG---GLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+TEA   +  N       +N S  TTPSE D + V + + LLTY  ED GIS+DK
Sbjct  121  HDPHHITEAMFFSHLNNIGRSSQMNASRITTPSEFDTASVAADISLLTYDHEDPGISSDK  180



>gb|KEH43649.1| cellulose synthase-like protein [Medicago truncatula]
Length=1097

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 130/180 (72%), Gaps = 11/180 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQICQICGDE+E TVD EPFVACNE
Sbjct  5    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  64

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-------gdeeeeefddldhef  460
            CAFPVCRPCYEYERREGNQACP CKT+YKRIKGSPRVE        D+ E EFD   +  
Sbjct  65   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRVEGDEEEDGIDDLENEFDIGSNIK  124

Query  461  dYPEHMTEAALAARFNG---GLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              P H+TEA   +  N       +N S  TTPSE D + V + + LLTY  ED GIS+DK
Sbjct  125  HDPHHITEAMFFSHLNNIGRSSQMNASRITTPSEFDTASVAADISLLTYDHEDPGISSDK  184



>gb|KHG03006.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1059

 Score =   214 bits (545),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 126/177 (71%), Positives = 137/177 (77%), Gaps = 9/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEI--TVDGEPFVAC  295
            MDT GRLIAGSHNRNEFVLINA E  R+ SVKELSGQ CQICGDE+EI  TVDGEPFVAC
Sbjct  1    MDTGGRLIAGSHNRNEFVLINAYENARIKSVKELSGQSCQICGDEIEIEITVDGEPFVAC  60

Query  296  NECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY---  466
            NECAFPVCR CYEY RREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY   
Sbjct  61   NECAFPVCRTCYEYGRREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFDYGTL  120

Query  467  -PEHMTEAALAARFNG--GLGVNGSGTTP-SEVDPSGVDSXVPLLTYGEEDDGISAD  625
             P+ +T+A L AR N   G  +N S     SE+  S   S +PLLTY EE   ISAD
Sbjct  121  DPQQVTDAMLTARLNAVRGSQLNSSRMAAHSELYSSPPSSQIPLLTYVEEGLEISAD  177



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 9/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQICQICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-PEHM  478
            CAFPVCRPCYEYER+EGNQACPQCKTR+KRIKGS RVEGDE+E++ DDLD+EFDY P+ M
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRFKRIKGSSRVEGDEDEDDTDDLDNEFDYDPDAM  120

Query  479  -----TEAALAARFNGGLGVNG--SGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 +++  A R N G G N   SGT      P  ++S +PLLTYGEED  IS+D+
Sbjct  121  RHQPISDSLFAGRLNTGRGSNANISGTNSENGSPP-LNSEIPLLTYGEEDPEISSDR  176



>ref|XP_007143558.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
 gb|ESW15552.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
Length=1093

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 139/176 (79%), Gaps = 7/176 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+A SHNRNEF++INAD+ GRV +V EL GQICQICGDE+EIT DGEPFVACNE
Sbjct  1    MDTTGRLVASSHNRNEFIIINADQTGRVNAVTELCGQICQICGDEIEITADGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHM-  478
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVEGDEEEE+ DDL++EFD   ++ 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEEDIDDLENEFDIGSNIR  120

Query  479  ---TEAALAARFNG--GLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                +A L+A  N   G  +N  G TTPSE   S   + +PLLTY  ED GISADK
Sbjct  121  HGHVDAMLSAHHNAEHGSQMNVPGITTPSEFGASSAAADIPLLTYDHEDIGISADK  176



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFP+CRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD++HEFDY     
Sbjct  63   CAFPICRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDIEHEFDYGVGSL  122

Query  482  EAALAAR---FNGGLGVNGS--GTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                + R     GG G  GS    T S  D S     +PLLTYGEED  IS+D+
Sbjct  123  GRQGSGRVPSVYGGSGHAGSYENATSSRQDSSTPGIEIPLLTYGEEDTQISSDQ  176



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 142/185 (77%), Gaps = 16/185 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGR------VTSVKELSGQICQICGDEVEITVDGEP  283
            MDT+GRLIAGSHNRNE +LINADE GR      + SVKELSGQ+CQICGDEVEITVDGE 
Sbjct  1    MDTRGRLIAGSHNRNELILINADENGRGDENGRIKSVKELSGQMCQICGDEVEITVDGEL  60

Query  284  FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefd  463
            FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFD
Sbjct  61   FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDLDNEFD  120

Query  464  Y-------PEHMTEAALAARFNGGLGV--NGSGTTP-SEVDPSGVDSXVPLLTYGEEDDG  613
            Y       P+   EA L +  N G G   N SG    S  + S + S +PLLTYGEED  
Sbjct  121  YGNLNGLGPQEGAEAMLYSHLNSGRGYHSNASGIPALSAHETSPLSSEIPLLTYGEEDSE  180

Query  614  ISADK  628
            IS+D+
Sbjct  181  ISSDR  185



>gb|KHN34038.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 9/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC TRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDVDA  120

Query  467  --PEHMTEAALAARFNGGLGV-NGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
              P+ M+E+  + R N G G  NGSG  T  E   +  +S +PLLTYGEED  IS++
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSGMATNLEHGSAPQNSDIPLLTYGEEDPEISSN  177



>ref|XP_003525098.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1097

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 142/177 (80%), Gaps = 9/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQICQICGDE+EITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREG QACPQC TRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYGDVDA  120

Query  467  --PEHMTEAALAARFNGGLGV-NGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
              P+ M+E+  + R N G G  NGSG  T  E   +  +S +PLLTYGEED  IS++
Sbjct  121  LGPQPMSESLYSGRPNTGRGANNGSGMATNLEHGSAPQNSDIPLLTYGEEDPEISSN  177



>ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1094

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD++HEFDY     
Sbjct  63   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDIEHEFDYSVGSL  122

Query  482  E---AALAARFNGGLGVNGS--GTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                +       GG G  GS    T S+ D S     +PLLTYGEED  + +D+
Sbjct  123  SRHGSGPVPSVYGGSGHAGSYENATSSKQDSSTPGIEIPLLTYGEEDAQMMSDQ  176



>ref|XP_006411737.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
 gb|ESQ53190.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
Length=1084

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 133/173 (77%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGD+EEE+  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDDEEEDDIDDLEYEFDHGMDP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH+ EAAL++R N G G  GS + P         S +PLLTY +EDD + +D+
Sbjct  121  EHVAEAALSSRLNTGRG--GSDSAPP-------GSQIPLLTYCDEDDDMYSDR  164



>ref|XP_010546378.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1075

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 139/174 (80%), Gaps = 12/174 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+ FVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQICQICGDEIELTVDGDSFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDTDDLDNEFDYRNGVG  120

Query  467  PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            P+ ++E  L +R N       SG   S++D +   S +PLLTY  ED  IS+D+
Sbjct  121  PDQVSEGMLFSRRN-------SGIPQSDLDSAPPGSQIPLLTYDNEDIDISSDR  167



>ref|XP_002878571.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54830.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADETARIRSVQELSGQTCKICRDEIELTENGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef--dYPEH  475
            CAFPVCRPCYEYER+EGNQACPQC+TRYKRIKGSPRVEGDEE+++ DDL++EF    PEH
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCRTRYKRIKGSPRVEGDEEDDDIDDLEYEFYGMDPEH  120

Query  476  MTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            + EAAL+ R N G G N      S + P+  +S VPLLTY +ED  + +D+
Sbjct  121  VAEAALSMRLNTGRGTNEV----SHLYPAPEESQVPLLTYCDEDADMYSDR  167



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 9/177 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQIC ICGDE+E+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICMICGDEIEVTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYER+EGNQACPQCKTRYKR+KGSPRVEGDEEE+  DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRYKRLKGSPRVEGDEEEDGDDDLDNEFDYDLDDM  120

Query  467  -PEHMTEAALAARFNGGLG--VNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              +  +++  + R N G G   N SG       P  ++  +PLLTYGEED  IS+D+
Sbjct  121  GQQAHSDSLFSGRLNTGRGSNTNISGANSEHGSPP-LNPEIPLLTYGEEDPEISSDR  176



>ref|XP_002866842.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43101.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
Length=1084

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 130/173 (75%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EEE  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEEDIDDLEYEFNHGMDP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH  EAAL++R N G G          +D +   S +PLLTY +ED  + +D+
Sbjct  121  EHAAEAALSSRLNTGRG---------GLDSAPPGSQIPLLTYCDEDADMYSDR  164



>ref|XP_006394118.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
 gb|ESQ31404.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
Length=798

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 137/175 (78%), Gaps = 13/175 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DDLD+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDIDDLDNEFDYGNNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R N       SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGMSISRRN-------SGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  168



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 12/174 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+TVDG+PFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGDPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP----  469
            CAFPVCRPC+EYERREGNQACPQCKTRYKRIKGSPRVEGDEEE+  DDLD+EFDY     
Sbjct  61   CAFPVCRPCFEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDGIDDLDNEFDYKNGVG  120

Query  470  -EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             + ++E  L++  N       SG   S++D +   S +PLLTY EED  IS+ +
Sbjct  121  TDQVSEGILSSHLN-------SGIPQSDLDSAPPGSQIPLLTYDEEDIEISSGR  167



>emb|CDY42621.1| BnaC01g00330D [Brassica napus]
Length=1069

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 14/170 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe-gdeeeeefddldhefdYPEHM  478
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+  DEE+++ D        PE +
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDHDGMMDPELV  120

Query  479  TEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             EAAL++R N      G G +P         S +PLLTYG+EDD + +D+
Sbjct  121  AEAALSSRLN-----TGRGGSPG--------SQIPLLTYGDEDDDMYSDR  157



>ref|XP_006283042.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
 gb|EOA15940.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
Length=1084

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 129/173 (75%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVTSELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLEYEFDHGMHP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH  EAAL++R N G G          +D +   S +PLLTY +ED  + +D+
Sbjct  121  EHAVEAALSSRLNTGRG---------GLDSAPPGSQIPLLTYCDEDADMYSDR  164



>ref|XP_010431901.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1074

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 129/173 (75%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCHICRDEIELTVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLENEFDHGMHP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH  EAAL++R N G G          +D S   S +PLLTY +ED  + +D+
Sbjct  121  EHAVEAALSSRLNTGRG---------GLDSSPPGSQIPLLTYCDEDADMYSDR  164



>ref|XP_009115076.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Brassica rapa]
Length=1074

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 16/172 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  472
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  473  HMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             + EAAL++R N      G G +P         S +PLLTYG+EDD + +D+
Sbjct  121  LVAEAALSSRLN-----TGRGGSPG--------SQIPLLTYGDEDDDMYSDR  159



>emb|CDY41973.1| BnaA01g05450D [Brassica napus]
Length=1074

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 16/172 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  472
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  473  HMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             + EAAL++R N      G G +P         S +PLLTYG+EDD + +D+
Sbjct  121  LVAEAALSSRLN-----TGRGGSPG--------SQIPLLTYGDEDDDMYSDR  159



>dbj|BAF01335.1| cellulose synthase [Arabidopsis thaliana]
Length=771

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (79%), Gaps = 13/175 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R N       SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGMSISRRN-------SGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>gb|ACS68191.1| cellulose synthase 2.1 catalytic subunit [Brassica napus]
Length=1074

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 16/172 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ CQICGD++E++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe---gdeeeeefddldhefdYPE  472
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+    ++++++ D        PE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQGDDEEDDDDDLDLDHDGMMDPE  120

Query  473  HMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             + EAAL++R N      G G +P         S +PLLTYG+EDD + +D+
Sbjct  121  LVAEAALSSRLN-----TGRGGSPG--------SQIPLLTYGDEDDDMYSDR  159



>gb|KHN41284.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=847

 Score =   201 bits (512),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQICQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRIKGSPRV
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>emb|CDY14504.1| BnaC03g49550D [Brassica napus]
Length=1082

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 136/180 (76%), Gaps = 23/180 (13%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDIDDLDNEFEYE----  116

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  117  --------NGGVGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  168



>ref|XP_009150553.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Brassica rapa]
Length=1082

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 136/180 (76%), Gaps = 23/180 (13%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDIDDLDNEFEYE----  116

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  117  --------NGGVGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  168



>emb|CDY08854.1| BnaA06g23700D [Brassica napus]
Length=1082

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 136/180 (76%), Gaps = 23/180 (13%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDIDDLDNEFEYE----  116

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  117  --------NGGVGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  168



>ref|NP_195645.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48947.1|CESA2_ARATH RecName: Full=Cellulose synthase A catalytic subunit 2 [UDP-forming]; 
Short=AtCesA2; Short=Ath-A [Arabidopsis thaliana]
 gb|AAC39335.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAB43650.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 emb|CAB80598.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AEE87059.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38978.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 128/173 (74%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVSSELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD+EEEE  D           P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDEEEEDIDDLEYEFDHGMDP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH  EAAL++R N G G          +D +   S +PLLTY +ED  + +D+
Sbjct  121  EHAAEAALSSRLNTGRG---------GLDSAPPGSQIPLLTYCDEDADMYSDR  164



>ref|NP_201279.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q94JQ6.2|CESA6_ARATH RecName: Full=Cellulose synthase A catalytic subunit 6 [UDP-forming]; 
Short=AtCesA6; AltName: Full=AraxCelA; AltName: Full=Isoxaben-resistant 
protein 2; AltName: Full=Protein PROCUSTE 
1; AltName: Full=Protein QUILL [Arabidopsis thaliana]
 dbj|BAB10307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED97945.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66000.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (79%), Gaps = 13/175 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R N       SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGMSISRRN-------SGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>ref|XP_006279743.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
 gb|EOA12641.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
Length=1084

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y  +  
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNGI  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 +  N  +    SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSE-NMSISRRNSGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Sesamum indicum]
Length=1090

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 137/173 (79%), Gaps = 6/173 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELSGQ CQICGDEVEITVDGE FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSGQTCQICGDEVEITVDGELFVACNE  62

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----P  469
            CAFPVCR CYEYER+EG Q CPQCKTRYKRIKGSPRVEGDE+E++ DDL+HEFDY     
Sbjct  63   CAFPVCRTCYEYERKEGTQCCPQCKTRYKRIKGSPRVEGDEDEDDVDDLEHEFDYGDIEA  122

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               T++A  A  +G  G+ GS  T S+ DPS     +PLLTYGEED  I+ ++
Sbjct  123  SGFTQSA-GAVTSGHGGLAGSAKT-SKQDPSAQGLEIPLLTYGEEDAEIAYNQ  173



>ref|XP_010526630.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Tarenaya hassleriana]
Length=1073

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADETARIRSVQELSGQNCQICGDEIEFTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVe--gdeeeeefddldhefdYPEH  475
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVE   +E+  +  + + +   PE+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVEGDEEEDGIDDLEHEFDGMDPEY  120

Query  476  MTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            + EA      N G   N SG   S++D +   S +PLLTY EED  + +D+
Sbjct  121  VAEAM----HNTGRVPNASG---SDMDSAPPGSQIPLLTYCEEDADMYSDR  164



>emb|CDX81249.1| BnaC09g06600D [Brassica napus]
Length=1084

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 135/180 (75%), Gaps = 22/180 (12%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVE DEEE++ DD+D+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVENDEEEDDIDDIDNEFDYMN---  117

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  118  --------NGGIGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  169



>emb|CDY18696.1| BnaA09g06990D [Brassica napus]
Length=1084

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 135/180 (75%), Gaps = 22/180 (12%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVE DEEE++ DD+D+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVENDEEEDDIDDIDNEFDYMN---  117

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  118  --------NGGIGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  169



>ref|XP_010437052.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Camelina sativa]
Length=1074

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 129/173 (75%), Gaps = 13/173 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVNGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef----dYP  469
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV+GD++EE+  D          +P
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGDDDEEDDIDDLEYEFDHGMHP  120

Query  470  EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            EH  EAAL++  N G G          +D +   S +PLLTY +ED  + +D+
Sbjct  121  EHAVEAALSSHLNTGRG---------GLDSAPPGSQIPLLTYCDEDADMYSDR  164



>ref|XP_009112155.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1083

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 135/180 (75%), Gaps = 22/180 (12%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVE DEEE++ DD+D+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVENDEEEDDIDDIDNEFDYMN---  117

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  118  --------NGGIGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  169



>ref|XP_010444419.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1090

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGN+ACPQCKTRYKR+KGSPRVEGDEEE++ DDLD+EF+Y  +  
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDNEFEYGSNGM  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 +  N  +    SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSE-NMSISRRTSGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>gb|ACS68196.1| cellulose synthase 6.1 catalytic subunit [Brassica napus]
Length=1084

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 135/180 (75%), Gaps = 22/180 (12%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DEVE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSPRVE DEEE++ DD+D+EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVENDEEEDDIDDIDNEFDYMN---  117

Query  482  EAALAARFNGGLGVN-----------GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                    NGG+G +            SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  118  --------NGGIGFDQVSEGMSVSRRHSGFPQSDLDSAPPGSQIPLLTYGDEDIEISSDR  169



>gb|AEK86669.1| cellulose synthase 5 [Arabidopsis thaliana]
Length=996

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 130/168 (77%), Gaps = 10/168 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYSRSGL  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            E+   +R N    +  +        P G  S +PLLTYGEED  IS+D
Sbjct  121  ESETFSRRNSEFDLASA--------PPG--SQIPLLTYGEEDVEISSD  158



>emb|CDP12843.1| unnamed protein product [Coffea canephora]
Length=1093

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSHNRNEFVLINAD+IG++ SV+ELSGQICQICGDEVEITVDGE FVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADDIGKIKSVQELSGQICQICGDEVEITVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKG PRVEGDEEE+  DDL+HEFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGDPRVEGDEEEDNIDDLEHEFDYNYIDS  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
              P H   AA      GG   +  G         G+D  +PLLTYGEED  IS+D
Sbjct  121  LSPPHAVGAA-GRHARGGEASSSGGGIAGHNSSHGLD--IPLLTYGEEDAEISSD  172



>ref|NP_196549.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q8L778.2|CESA5_ARATH RecName: Full=Cellulose synthase A catalytic subunit 5 [UDP-forming]; 
Short=AtCesA5 [Arabidopsis thaliana]
 dbj|BAB09408.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED91458.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
Length=1069

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 130/168 (77%), Gaps = 10/168 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYSRSGL  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            E+   +R N    +  +        P G  S +PLLTYGEED  IS+D
Sbjct  121  ESETFSRRNSEFDLASA--------PPG--SQIPLLTYGEEDVEISSD  158



>ref|XP_010462809.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1084

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGN+ACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y  +  
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGSNGM  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 +  N  +    SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSE-NMSISRRTSGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>gb|KFK25282.1| hypothetical protein AALP_AA8G091900 [Arabis alpina]
Length=1071

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 131/171 (77%), Gaps = 11/171 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELSDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV GDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVVGDEEDDGIDDLDFEFDYRSGLG  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVD--SXVPLLTYGEEDDGISADK  628
               +   F+            SE D + V   S VP+LTYGEE+D IS+D+
Sbjct  121  SEQVFDTFS---------RRDSEFDLASVAHGSQVPMLTYGEEEDDISSDR  162



>ref|XP_010088737.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXB36918.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1082

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  134  GRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFP  313
            GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+EITVDGE FVACNECAFP
Sbjct  4    GRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGELFVACNECAFP  63

Query  314  VCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMTEAAL  493
            VCRPCYEYERREGNQACPQCKT+YKRIKGSPRVEGDEEE+  DD+D+EF+Y     +A+ 
Sbjct  64   VCRPCYEYERREGNQACPQCKTQYKRIKGSPRVEGDEEEDGIDDIDNEFEYGN--LDASG  121

Query  494  AARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            A +   G     S     E  P G  S +PLLTYGEED  IS+D+
Sbjct  122  AHQVADGSHPYSSAVLERESSPLG--SEIPLLTYGEEDSEISSDR  164



>ref|XP_002871389.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47648.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1069

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 130/168 (77%), Gaps = 10/168 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFD+     
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDFSRSGL  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            E+   +R N    +  +        P G  S +PLLTYGEED  IS+D
Sbjct  121  ESETFSRRNSEFDLASA--------PPG--SQIPLLTYGEEDVEISSD  158



>ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis]
Length=1092

 Score =   199 bits (506),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 134/179 (75%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEH--  475
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRVEGDEEEE  DDL+ EFD  E   
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVEGDEEEENTDDLEREFDIGESGR  119

Query  476  -----MTEAALAARFNGG--LGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 M E   +   N G  L  + SG TTPSE+D S V   +PLLTYG+E+ GIS +K
Sbjct  120  GNLHCMAEGMPSTHLNFGPNLQTHASGFTTPSELDASSVVPEIPLLTYGQENVGISFNK  178



>ref|XP_010484268.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Camelina sativa]
Length=1084

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TV GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVGGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGN+ACPQCKTRYKR+KGSPRVEGDEEE++ DDLD+EF+Y  +  
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRVEGDEEEDDIDDLDNEFEYGSNGM  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 +  N  +    SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSE-NMSISRRTSGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  168



>gb|KHG02517.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1106

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 134/186 (72%), Gaps = 18/186 (10%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQIC-----------QICGDEVEIT  268
            MDT GRLIAGSHNRNEFVLINADE  R  + +  +  +            QICGDE+EIT
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARDCANRTFTTALVCTGFVVLAFHNQICGDEIEIT  60

Query  269  VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddl  448
            VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DDL
Sbjct  61   VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDIDDL  120

Query  449  dhefdY----PEHMTEAALAARFNGGLGV--NGSGT-TPSEVDPSGVDSXVPLLTYGEED  607
            D+EFDY    P+ + EA L    N G G   NGSG    SE+D     S +PLLTYGEE 
Sbjct  121  DNEFDYDALDPQQVAEAMLGGHLNTGRGFHPNGSGLPAHSEIDSFPPSSQIPLLTYGEEH  180

Query  608  DGISAD  625
              ISAD
Sbjct  181  SEISAD  186



>ref|XP_002864919.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41178.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 16/175 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R N       SG   S++D +   S +PLLTYG+E   IS+D+
Sbjct  121  GFDQVSEGMSISRRN-------SGFPQSDLDSAPPGSQIPLLTYGDE---ISSDR  165



>gb|AAC29067.1| cellulose synthase [Arabidopsis thaliana]
Length=1081

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 134/170 (79%), Gaps = 13/170 (8%)
 Frame = +2

Query  137  RLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPV  316
            RLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQIC DE+E+TVDGEPFVACNECAFPV
Sbjct  3    RLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNECAFPV  62

Query  317  CRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY------PEHM  478
            CRPCYEYERREGNQACPQCKTR+KR+KGSPRVEGDEEE++ DDLD+EF+Y       + +
Sbjct  63   CRPCYEYERREGNQACPQCKTRFKRLKGSPRVEGDEEEDDIDDLDNEFEYGNNGIGFDQV  122

Query  479  TEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +E    +R N       SG   S++D +   S +PLLTYG+ED  IS+D+
Sbjct  123  SEGMSISRRN-------SGFPQSDLDSAPPGSQIPLLTYGDEDVEISSDR  165



>ref|XP_006399471.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
 gb|ESQ40924.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
Length=1073

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 132/173 (76%), Gaps = 15/173 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQICQICGDE+E+T DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELTDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYRSGIG  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVD----PSGVDSXVPLLTYGEEDDGISADK  628
               ++  F+            SE D    P G  S +PLLTYG+ED  IS+D+
Sbjct  121  SEQVSDTFS---------RRNSEFDLASAPPG--SQIPLLTYGDEDVEISSDR  162



>gb|AFD33697.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1092

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 133/179 (74%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+IC+IC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICRICADEIEITGDGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEH--  475
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRVEGDEEEE  DDL+ EFD  E   
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVEGDEEEENTDDLEREFDIGESGR  119

Query  476  -----MTEAALAARFNGG--LGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 M E   +   N G  L  +  G TTPSE+D S V   +PLLTYG+E+ GIS +K
Sbjct  120  GNLHCMAEGMPSTHLNFGPNLQTHAPGFTTPSELDASSVVPEIPLLTYGQENVGISFNK  178



>ref|XP_010491630.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Camelina sativa]
Length=1068

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 126/170 (74%), Gaps = 15/170 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRV GDEE++  DDLD EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVVGDEEDDGMDDLDFEFDY-----  115

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVD--SXVPLLTYGEEDDGISAD  625
                      GL  +      SE D +     S +PLLTYGEED  IS++
Sbjct  116  --------RSGLETDTFSLRNSEFDLASAPPGSHIPLLTYGEEDVEISSE  157



>ref|XP_010446473.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1075

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 127/174 (73%), Gaps = 14/174 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C+IC DE+E+TV GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVTGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef-----dY  466
            CAFPVCRPCYE ERREG QACPQCKTR+KRIKGSPRV+GD++EE+  D           +
Sbjct  61   CAFPVCRPCYEDERREGKQACPQCKTRFKRIKGSPRVDGDDDEEDDIDDLEYEFDHHGMH  120

Query  467  PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            PEH  EAAL++R N G G          +D +   S +PLLTY +ED  + +D+
Sbjct  121  PEHAVEAALSSRLNTGRG---------GLDSAPPGSQIPLLTYCDEDADMYSDR  165



>ref|XP_010452989.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Camelina sativa]
Length=1068

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 128/170 (75%), Gaps = 15/170 (9%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY     
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGMDDLDFEFDY-----  115

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVD--SXVPLLTYGEEDDGISAD  625
                      GL  +      +E D + V   S +PLLTYGEED  IS++
Sbjct  116  --------RSGLESDTFSRRNAEFDLASVPPGSQIPLLTYGEEDVEISSE  157



>ref|NP_179768.1| cellulose synthase A9 [Arabidopsis thaliana]
 sp|Q9SJ22.1|CESA9_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
9 [UDP-forming]; Short=AtCesA9 [Arabidopsis thaliana]
 gb|AAD20396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07220.1| cellulose synthase A9 [Arabidopsis thaliana]
Length=1088

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 7/172 (4%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINAD+  R+ S +ELSGQ C+IC DE+E+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSGQTCKICRDEIELTDNGEPFIACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhef--dYPEH  475
            CAFP CRPCYEYERREGNQACPQC TRYKRIKGSPRVEGDEE+++ DDL+HEF    PEH
Sbjct  61   CAFPTCRPCYEYERREGNQACPQCGTRYKRIKGSPRVEGDEEDDDIDDLEHEFYGMDPEH  120

Query  476  MTEAAL-AARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            +TEAAL   R N G G +      S +  +   S VPLLTY +ED  + +D+
Sbjct  121  VTEAALYYMRLNTGRGTDEV----SHLYSASPGSEVPLLTYCDEDSDMYSDR  168



>emb|CDY31305.1| BnaA02g34360D [Brassica napus]
Length=1079

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 133/175 (76%), Gaps = 17/175 (10%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DD+D+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDVDDIDNEFEYGGNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R + G           ++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGVSVSRRHSG-----------DLDSAPPGSQIPLLTYGDEDIEISSDR  164



>ref|XP_010063851.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71112.1| hypothetical protein EUGRSUZ_F04212 [Eucalyptus grandis]
Length=1091

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 131/179 (73%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ICQIC DE+EIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEH--  475
            CAFPVCR CYEYER EG QACP CKTRYKRIKGSPRVEGDEEEE  DDL+ EFD  E   
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVEGDEEEENTDDLEREFDIGESGR  119

Query  476  -----MTEAALAARFNGG--LGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
                 M E   +   N G  L  +  G TTPSE+D S V   +PLL YG+E+  IS +K
Sbjct  120  GNLHCMAEGMPSTHLNFGPNLQTHAPGVTTPSELDASSVVPEIPLLNYGQENVEISFNK  178



>ref|XP_009130469.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1079

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 17/175 (10%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GR+IAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TVDGEPFVACNE
Sbjct  1    MNTGGRVIAGSHNRNEFVLINADENARIRSVQELKGQTCEICRDEIESTVDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DD+D+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDVDDIDNEFEYGGNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R + G           ++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGVSVSRRHSG-----------DLDSAPPGSQIPLLTYGDEDIEISSDR  164



>ref|XP_006286951.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
 gb|EOA19849.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
Length=1068

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 130/168 (77%), Gaps = 11/168 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL+GQ CQICGDE+E+ +DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELTGQTCQICGDEIELNLDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKRI+GSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIQGSPRVEGDEEDDGIDDLDFEFDYRSGL-  119

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
            E+   +R N    +  +        P G  S +PLLTYGEED  IS++
Sbjct  120  ESETFSRRNSEFDLASA--------PPG--SQIPLLTYGEEDVEISSE  157



>emb|CDY46820.1| BnaC02g43280D [Brassica napus]
Length=1079

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 17/175 (10%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ C+IC DE+E TV+GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVEGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE DEEE++ DD+D+EF+Y     
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVENDEEEDDVDDIDNEFEYGGNGI  120

Query  467  -PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              + ++E    +R + G           ++D +   S +PLLTYG+ED  IS+D+
Sbjct  121  GFDQVSEGVSVSRRHSG-----------DLDSAPPGSQIPLLTYGDEDIEISSDR  164



>ref|XP_006847152.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
 gb|ERN08733.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
Length=1087

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 133/176 (76%), Gaps = 13/176 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRL+AGSHNRNEFV+INADE      ++ELSGQ CQICGDE+EITVDGE FVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVVINADE---PKPLRELSGQTCQICGDEIEITVDGEAFVACNE  57

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhe-----fdY  466
            CAFPVCRPCYEYERREGNQACPQCKTRYKR KGSPRVEGDEEEE+ DD+++E     +D+
Sbjct  58   CAFPVCRPCYEYERREGNQACPQCKTRYKRHKGSPRVEGDEEEEDVDDIENEFDLGGWDW  117

Query  467  PEHMTEAA--LAARFNGGLGVN-GSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
             +   +AA     R N G G + G+G     +D   V   VPLLTYG+ED GIS D
Sbjct  118  RDSQCDAAAIFHGRLNFGRGSDGGAGIEARPLD--SVTPGVPLLTYGQEDAGISPD  171



>emb|CDX81145.1| BnaC03g03990D [Brassica napus]
Length=1070

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYKSGLR  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGV--DSXVPLLTYGEEDDGISADK  628
             +  A+        +      SE D +     S +PLLTYG+ED  IS+D+
Sbjct  121  GSEQAS--------DTFSRRNSEFDLASAAHSSQIPLLTYGDEDVEISSDR  163



>ref|XP_003592086.1| Cellulose synthase [Medicago truncatula]
Length=1135

 Score =   189 bits (481),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVT--SVKELSGQICQICGDEVEITVDGEPFVAC  295
            MDT GRL+AGSHNRNEFVLINAD+  RV+  +V ELSGQICQICGDE+E TVD EPFVAC
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVSVNAVTELSGQICQICGDEIEFTVDDEPFVAC  60

Query  296  NECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSP  406
            NECAFPVCRPCYEYERREGNQACP CKT+YKRIKG P
Sbjct  61   NECAFPVCRPCYEYERREGNQACPHCKTKYKRIKGKP  97



>gb|ACS68195.1| cellulose synthase 5.1 catalytic subunit [Brassica napus]
Length=1070

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYKSGLG  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGV--DSXVPLLTYGEEDDGISADK  628
             +  A+        +      SE D +     S +PLLTYG+ED  IS+D+
Sbjct  121  GSEQAS--------DTFSRRNSEFDLASAAHSSQIPLLTYGDEDVEISSDR  163



>ref|XP_009131129.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Brassica rapa]
Length=1072

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYKSGLG  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVD--SXVPLLTYGEEDDGISADK  628
             +  A+        +      SE D +     S +PLLTYG+ED  IS+D+
Sbjct  121  GSEQAS--------DTFSRRNSEFDLASAAHGSQIPLLTYGDEDVEISSDR  163



>emb|CDY56540.1| BnaA03g55860D [Brassica napus]
Length=1074

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDE+E++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREGNQ+CPQCKTRYKRIKGSPRVEGDEE++  DDLD EFDY   + 
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRVEGDEEDDGIDDLDFEFDYKSGLG  120

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVD--SXVPLLTYGEEDDGISADK  628
             +  A+        +      SE D +     S +PLLTYG+ED  IS+D+
Sbjct  121  GSEQAS--------DTFSRRNSEFDLASAAHGSQIPLLTYGDEDVEISSDR  163



>ref|XP_002277635.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
 emb|CAN72601.1| hypothetical protein VITISV_012984 [Vitis vinifera]
Length=1097

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 133/179 (74%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KGSPRVEGDEEE++ DDL+HEFDY    T
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGSPRVEGDEEEDDIDDLEHEFDYANSNT  120

Query  482  EA---------ALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             A          +    + G   + SG +T SE+    + S VPLL+Y  E+  I AD+
Sbjct  121  WATQEVAGEMLTVCLDIDCGNHDSASGISTCSELVSPPLSSQVPLLSYPMENADIHADQ  179



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 123/167 (74%), Gaps = 10/167 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELS Q CQICGDE+EIT D E FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSDQTCQICGDELEITADRELFVACNE  62

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREG+Q CPQC+TRYKRIKGSPRVEGDE+E+  DDL+HEFDY +   
Sbjct  63   CAFPVCRTCYEYERREGSQCCPQCRTRYKRIKGSPRVEGDEDEDGADDLEHEFDYGD---  119

Query  482  EAALAARFNGGLGVNGSG-----TTPSEVDPSGVDSXVPLLTYGEED  607
                A R+  G G   S         S  D +     +PLLTYGEED
Sbjct  120  --IEALRYLQGAGATASAHGGRLVVDSRHDSASQTPEIPLLTYGEED  164



>emb|CBI21555.3| unnamed protein product [Vitis vinifera]
Length=1097

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 133/179 (74%), Gaps = 10/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQIC ICGD VEITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KG+PRVEGDEEE++ DDL+HEFDY    T
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGNPRVEGDEEEDDIDDLEHEFDYANSNT  120

Query  482  EA---------ALAARFNGGLGVNGSG-TTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             A          +    + G   + SG +T SE+    + S VPLL+Y  E+  I AD+
Sbjct  121  WATQEVAGEMLTVCLDIDCGNHDSASGISTCSELVSPPLSSQVPLLSYPMENADIHADQ  179



>ref|XP_004502891.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cicer arietinum]
Length=1084

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNRNE VLINA+E G++ SV+ELSGQICQICGDE+EI   GE FVACNE
Sbjct  1    MNTGGRLVAGSHNRNELVLINAEENGKIKSVQELSGQICQICGDEIEIMDQGEIFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFP+CRPCYEYER EGNQACPQCKTR+KRI+GSPRVEGDEEE + DDLD EF Y +   
Sbjct  61   CAFPICRPCYEYERLEGNQACPQCKTRFKRIRGSPRVEGDEEEVQTDDLDKEFGYKD---  117

Query  482  EAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
              A   +       N  G   +    + ++  +PLLTYGEED  IS+D+
Sbjct  118  SDASGQQPTSDSNSNTCGIPTNSEQDAHLNPKIPLLTYGEEDPDISSDR  166



>gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlisea aurea]
Length=1015

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 129/172 (75%), Gaps = 8/172 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ CQICGDEVEI+  G+ FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVQELSGQTCQICGDEVEISA-GDLFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREG Q CPQC+TRYKRIKGSPRVEGDE+E+  DDL+HEFDY +   
Sbjct  60   CAFPVCRTCYEYERREGTQCCPQCQTRYKRIKGSPRVEGDEDEDGADDLEHEFDYGDMQ-  118

Query  482  EAALAARFNGGLGVNGSGTTPSEVDP----SGVDSXVPLLTYGEEDDGISAD  625
              AL      G      G+  S V+P    + ++  +PLL YG+ED   +AD
Sbjct  119  --ALGFLQGAGTSTIYRGSAVSSVNPGQDSTALNPEIPLLAYGDEDVDSAAD  168



>gb|EYU31127.1| hypothetical protein MIMGU_mgv1a000549mg [Erythranthe guttata]
Length=1082

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T GRL+AGSHNR EFVLINADEIG + SV+ELSGQ C+ICGDEVEIT+DGE FVACNE
Sbjct  1    MNTGGRLVAGSHNRKEFVLINADEIGSIKSVQELSGQTCKICGDEVEITLDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            CAFPVCRPCYEYER+EGNQ+CPQCKTRYKRIKGSPRV
Sbjct  61   CAFPVCRPCYEYERKEGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_006351001.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum tuberosum]
Length=1090

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 129/173 (75%), Gaps = 5/173 (3%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT GRLIAGSH RNEFVLI ADE GRV SV  LS ++CQICGDE+EIT DGE FVACNE
Sbjct  4    MDTSGRLIAGSHIRNEFVLIKADEFGRVESVHALSARMCQICGDELEIT-DGELFVACNE  62

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEE++ DD++HEFDY   + 
Sbjct  63   CAFPVCRLCYEYERREGNQACPQCKTRYKRIKGSPRVEGDEEEDDTDDIEHEFDYGVGIL  122

Query  482  E--AALAARFNGGLGVNGS--GTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               +   +   GG G  GS    + S    S     +PLLTYGEED  IS+++
Sbjct  123  RQGSGPVSFVYGGSGHAGSYENGSSSRQGSSTDGMEIPLLTYGEEDSQISSNQ  175



>ref|XP_010312466.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 132/177 (75%), Gaps = 7/177 (4%)
 Frame = +2

Query  113  VGLMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVA  292
            + +MDT GRLIAGSH RNEFVLI ADE GRV SV ELS Q+CQICGDE+E T DGE FVA
Sbjct  1    MAMMDTGGRLIAGSHIRNEFVLIKADEFGRVESVHELSEQMCQICGDELE-TSDGELFVA  59

Query  293  CNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-P  469
            CNECAFPVCR CYEYERREG QACPQCKTRYKRIKGSPRVEGDEEE++ DD++HEFDY  
Sbjct  60   CNECAFPVCRLCYEYERREGTQACPQCKTRYKRIKGSPRVEGDEEEDDTDDIEHEFDYGV  119

Query  470  EHMTEAALAARF----NGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
            E + + +    F    +G  G    G++ S    S     +PLLTYGEED  IS+++
Sbjct  120  EILRQGSGPVSFVYGRSGHAGTYEYGSS-SRQGSSTDGMEIPLLTYGEEDSQISSNQ  175



>gb|KJB49074.1| hypothetical protein B456_008G100100 [Gossypium raimondii]
Length=255

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 115/148 (78%), Gaps = 7/148 (5%)
 Frame = +2

Query  203  VTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTR  382
            + SVKELSGQ CQICGDE+EITVDGEPFVACNECAFPVCR CYEYERREGNQACPQCKTR
Sbjct  1    MKSVKELSGQSCQICGDEIEITVDGEPFVACNECAFPVCRTCYEYERREGNQACPQCKTR  60

Query  383  YKRIKGSPRVegdeeeeefddldhefdY----PEHMTEAALAARFNGGLGVN-GSGTTP-  544
            YKRIKGSPRVEGDEEE++ DDLD+EFDY    P+ +T+A LAAR N   G    S   P 
Sbjct  61   YKRIKGSPRVEGDEEEDDIDDLDNEFDYGTLDPQQVTDAMLAARLNAVRGSQLNSSRMPA  120

Query  545  -SEVDPSGVDSXVPLLTYGEEDDGISAD  625
             SE+  S   S +PLLTY EE   ISAD
Sbjct  121  HSELYSSPPSSQIPLLTYVEEGLEISAD  148



>ref|XP_011466718.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=1097

 Score =   171 bits (434),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 9/152 (6%)
 Frame = +2

Query  200  RVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKT  379
            ++ SV+ELSGQICQICGD +EIT DGE FVACNECAFPVCR CY+YERREGNQACPQCKT
Sbjct  29   QIKSVEELSGQICQICGDGIEITDDGEIFVACNECAFPVCRGCYQYERREGNQACPQCKT  88

Query  380  RYKRIKGSPRVegdeeeeefddldhefdY-------PEHMTEAALAARFNGGLGVNGSGT  538
            RYKRIKG+PRVEGDEEE++ DDLD+EF Y          + EA L++  N G G + + +
Sbjct  89   RYKRIKGTPRVEGDEEEDDIDDLDNEFSYGNLDALGSHRVAEAVLSSHLNVGCGSHYNAS  148

Query  539  TPS--EVDPSGVDSXVPLLTYGEEDDGISADK  628
             P+  E D S + S +PLLTYGEED  IS+D+
Sbjct  149  IPTHREHDSSTLGSEIPLLTYGEEDPEISSDQ  180



>ref|XP_010927397.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Elaeis guineensis]
Length=1097

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 126/179 (70%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVD-GEPFVACN  298
            MDT GRL+AGS NRNEFV+INAD+ GR  SV++ +G  CQICGD++EI  +  EPFVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKSVQDSNGLNCQICGDDIEILEEEKEPFVACN  60

Query  299  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHM  478
            ECAFPVCR CYEYERREG+Q+CPQC+TRYKR KGS RVEGDEEE+  DD++ EF +    
Sbjct  61   ECAFPVCRTCYEYERREGSQSCPQCRTRYKRHKGSARVEGDEEEDGDDDIEKEFSFGNFD  120

Query  479  TEAALA---ARFNGGLGVNGSGTTPSEVDPSGV-------DSXVPLLTYGEEDDGISAD  625
            T+  L    ++ +  L +     T S +  S V       D+ +PLLTYGEE  GIS+D
Sbjct  121  TKETLTVSGSKLHSQLSIRQGSFTGSAIGTSSVHNPSFFTDTNIPLLTYGEEAGGISSD  179



>ref|XP_010912005.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Elaeis guineensis]
Length=1099

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 129/180 (72%), Gaps = 13/180 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEP-FVACN  298
            MDT GRL+AGS NRNEFV+INAD+ GR  + K+ +GQIC ICGD++EI  + +  FVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKAAKDSNGQICHICGDDIEILEEEKELFVACN  60

Query  299  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----  466
            ECAFPVCR CYEYERREG+QACPQCKTRYKR KGS RVEGDEEE+  DD++ EF++    
Sbjct  61   ECAFPVCRTCYEYERREGSQACPQCKTRYKRHKGSARVEGDEEEDGDDDIEKEFNFGYFD  120

Query  467  PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGV-------DSXVPLLTYGEEDDGISAD  625
            P+  T +   ++ +  L +  S  T S +  S V       ++ +PLLTYGEE DGISAD
Sbjct  121  PKE-TSSISGSKLHSQLRIGQSSFTGSVIGTSSVHNPNFCTNTNIPLLTYGEEVDGISAD  179



>ref|XP_011466721.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=919

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 10/181 (6%)
 Frame = +2

Query  113  VGLMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVA  292
            +  ++   R I   H++   +LI    + ++ SV+ELSGQICQICGD +EIT DGE FVA
Sbjct  1    MKFLEDVKRWIYTLHSKLPSLLICFG-VLQIKSVEELSGQICQICGDGIEITDDGEIFVA  59

Query  293  CNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY--  466
            CNECAFPVCR CY+YERREGNQACPQCKTRYKRIKG+PRVEGDEEE++ DDLD+EF Y  
Sbjct  60   CNECAFPVCRGCYQYERREGNQACPQCKTRYKRIKGTPRVEGDEEEDDIDDLDNEFSYGN  119

Query  467  -----PEHMTEAALAARFNGGLGVNGSGTTPS--EVDPSGVDSXVPLLTYGEEDDGISAD  625
                    + EA L++  N G G + + + P+  E D S + S +PLLTYGEED  IS+D
Sbjct  120  LDALGSHRVAEAVLSSHLNVGCGSHYNASIPTHREHDSSTLGSEIPLLTYGEEDPEISSD  179

Query  626  K  628
            +
Sbjct  180  Q  180



>gb|EYU17477.1| hypothetical protein MIMGU_mgv1a016004mg [Erythranthe guttata]
Length=137

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 4/91 (4%)
 Frame = +2

Query  152  SHNRNEFV----LINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVC  319
            SH   E +    ++ A     VTSVKELSGQICQICGDEVE TVDGEPFVACNECAFPVC
Sbjct  42   SHKHKEHLGEMGVVAASAFALVTSVKELSGQICQICGDEVEFTVDGEPFVACNECAFPVC  101

Query  320  RPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            R CYEY+RREGNQ+CPQCKTR+KRIKGSPRV
Sbjct  102  RSCYEYDRREGNQSCPQCKTRFKRIKGSPRV  132



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   156 bits (395),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDEV IT +G+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKALDGQVCEICGDEVGITAEGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>gb|KCW78813.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1012

 Score =   156 bits (395),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_008785840.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1099

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 126/179 (70%), Gaps = 11/179 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEP-FVACN  298
            M T GRL+AGS NRNEFV+INAD+ GR  + ++ +GQICQICGD++EI  + +  FVACN
Sbjct  1    MATGGRLVAGSRNRNEFVVINADDFGRSKAAQDSNGQICQICGDDIEILEEEKELFVACN  60

Query  299  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHM  478
            ECAFPVCR CYEYERREG+QACPQCKTRYKR KGS RVEGDEEE+  DD++ EF++    
Sbjct  61   ECAFPVCRTCYEYERREGSQACPQCKTRYKRHKGSARVEGDEEEDGDDDIEKEFNFGNFD  120

Query  479  TEAALAARFN--------GGLGVNGSGTTPSEV-DPSG-VDSXVPLLTYGEEDDGISAD  625
             +  L+   +        G     GS T  S V +PS   +  VPLLTYGEE DGIS+D
Sbjct  121  AKETLSVSGSKHHSQPSIGQSSFTGSVTGTSHVHNPSFYTNIDVPLLTYGEEVDGISSD  179



>ref|XP_009414591.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1097

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            MDT  RL+AGS NRNEFV+INAD+  R    +  S QICQICGD++E+ V+ E FVACNE
Sbjct  1    MDTGRRLVAGSRNRNEFVVINADDFERPKFAQVSSRQICQICGDDIEVLVEEEFFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHMT  481
            CAFPVCR CYEYERREG QACPQCKTRYKR KGSPRVEGDEEE+  DDL+ EF++    +
Sbjct  61   CAFPVCRTCYEYERREGTQACPQCKTRYKRHKGSPRVEGDEEEDGDDDLEKEFNFGNFDS  120

Query  482  EAALAARFN--------GGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
               L             G   ++G GT+   V  +G +  + LLT  EE DGIS D
Sbjct  121  NETLNDPLTNLERPCGVGQSSLSGLGTSNPIVQSNGTN--ILLLTDAEEVDGISPD  174



>gb|AFR38707.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38708.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38709.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38710.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38711.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38712.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38713.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38714.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38715.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38716.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38717.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38718.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38719.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38720.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38721.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38722.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38731.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38733.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38734.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38738.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38742.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38743.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38744.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38745.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38746.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38747.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38748.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38749.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38750.1| cellulose synthase, partial [Populus nigra]
Length=98

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR38732.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38736.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38737.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38739.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38740.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38741.1| cellulose synthase, partial [Populus fremontii]
Length=97

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR38724.1| cellulose synthase, partial [Populus alba]
 gb|AFR38725.1| cellulose synthase, partial [Populus alba]
 gb|AFR38727.1| cellulose synthase, partial [Populus alba]
Length=98

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR38723.1| cellulose synthase, partial [Populus alba]
 gb|AFR38729.1| cellulose synthase, partial [Populus alba]
Length=96

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR38726.1| cellulose synthase, partial [Populus alba]
 gb|AFR38728.1| cellulose synthase, partial [Populus alba]
Length=97

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|AFR38730.1| cellulose synthase, partial [Populus fremontii]
Length=96

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAXAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 120/175 (69%), Gaps = 11/175 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  +  G V  +K L+GQ+CQICGD+V  TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRQEGDG-VKPLKHLNGQVCQICGDDVGCTVDGELFVACNE  59

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPE---  472
            CAFPVCRPCYEYER++GNQ+CPQCKTRY+R KGSPRVEGDE+E++ DDL++EF++ E   
Sbjct  60   CAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPRVEGDEDEDDVDDLENEFNFNEDRQ  119

Query  473  ----HMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
                H+ EA L    + G G +     P  + P  +    PLLT GE   GI  D
Sbjct  120  ERQQHIAEAMLHGHMSYGRG-DEQDLPPDMMQP--IQPRHPLLTNGEMLHGIPPD  171



>gb|AFR38984.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38985.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38986.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38987.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38988.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38990.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38992.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38993.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38994.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38995.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38996.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38997.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38998.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38999.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39000.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39001.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39002.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39003.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39004.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39005.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39006.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39007.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39008.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39010.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39011.1| cellulose synthase, partial [Populus nigra]
Length=100

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FP CRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPACRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>dbj|BAM05571.1| cellulose synthase 3, partial [Eucalyptus globulus subsp. globulus]
Length=259

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010932185.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Elaeis guineensis]
Length=1090

 Score =   154 bits (388),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 91/176 (52%), Positives = 115/176 (65%), Gaps = 12/176 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPKPLQQLSGQICQICGDDVGLTTDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP----  469
            CAFP+CR CYEYERREGNQ CPQCKTR+KR+KG  RV GDEEE++ DDL++EF++     
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCARVAGDEEEDDIDDLENEFNFTGGDK  120

Query  470  ---EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               ++M EA L    + G G  G    P  V        VPLLT G+  D I  ++
Sbjct  121  QDMQYMAEAMLQGHMSYGRG--GDVDMPQVVHTM---PQVPLLTNGQMVDDIPPEQ  171



>gb|KHG22630.1| Cellulose synthase A catalytic subunit 9 [UDP-forming] [Gossypium 
arboreum]
Length=256

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KHG19971.1| Cellulose synthase A catalytic subunit 9 [UDP-forming] [Gossypium 
arboreum]
Length=267

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E      +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009385959.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 121/177 (68%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINAD-EIGRVTSVKELSGQICQICGDEVEITVDGEPFVACN  298
            M+    L+AGSHNRNE V+I  D E+G    +++LSGQICQICGD+V +TVDG+ FVACN
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGELGP-KPLQQLSGQICQICGDDVGLTVDGDLFVACN  59

Query  299  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY----  466
            ECAFP+CR CYEYERREGNQ CPQCKTR+KR+KG PRV GDEEE++ DDL++EF++    
Sbjct  60   ECAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRVAGDEEEDDVDDLENEFNFVGGD  119

Query  467  ---PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               P++M E  L    + G  V+ +    +   P      VPLLT GE  D I  D+
Sbjct  120  QQDPKYMAEVMLQGHGSYGRRVDINTPHVAHAVPQ-----VPLLTNGEMVDDIPPDQ  171



>ref|XP_009417280.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 12/176 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESGPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREGNQ CPQCKTR+KR+KG PRV GD+EE++ DDL++EF++     
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCKTRFKRLKGCPRVAGDDEEDDVDDLENEFNFVPGEK  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               ++M EA L    +   G  G   TP  V        VPLLT GE  D I  ++
Sbjct  121  QDSQYMAEAMLQGHMS--YGRRGDLNTPYVVH---TMPQVPLLTNGEMVDDIPPEQ  171



>ref|XP_006849886.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
 gb|ERN11467.1| hypothetical protein AMTR_s00022p00086120 [Amborella trichopoda]
Length=1095

 Score =   152 bits (385),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPRPLQQLSGQICQICGDDVGLTADGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            CAFPVCR CYEYERREGNQ CPQCKTR++R+KGS RV
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCKTRFRRLKGSARV  97



>ref|XP_008796456.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Phoenix dactylifera]
Length=1090

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 91/176 (52%), Positives = 114/176 (65%), Gaps = 12/176 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  +       +++LSGQICQICGD+V +T DGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRREGESGPKPLQQLSGQICQICGDDVGLTTDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYP----  469
            CAFP+CR CYEYERREGNQ CPQCKTR KR+KG  RV GDEEE++ DDL++EF++     
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRLKRLKGCARVAGDEEEDDIDDLENEFNFTGGDK  120

Query  470  ---EHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               ++M EA L    + G G  G    P  V        VPLLT G+  D I  ++
Sbjct  121  NDMQYMAEAMLQGHMSYGRG--GDVDMPQVVHTM---PQVPLLTNGQMVDDIPPEQ  171



>ref|XP_009411928.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1096

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 122/177 (69%), Gaps = 11/177 (6%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEP-FVACN  298
            M+T  RL+AGS NRNEFV+INAD+ G+  S  + +GQICQICGD++EI  + +  FVACN
Sbjct  1    METGRRLVAGSRNRNEFVVINADDFGKSKSAHDSNGQICQICGDDIEILEEEKELFVACN  60

Query  299  ECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdYPEHM  478
            ECAFPVCR CYEYERREG+QACP+CKTRYKR KGS RVEGDE+E+  DD+  E +Y    
Sbjct  61   ECAFPVCRTCYEYERREGSQACPRCKTRYKRHKGSARVEGDEDEDGDDDIYKELNYYNFN  120

Query  479  TEAALAA--------RFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISAD  625
             +  ++          + G   ++G G   + V  +G  S +PLLTYGEE DGIS D
Sbjct  121  GKETVSVPDPKLYGYPYVGQGSLSGLGIPSNNVQQNG--SNIPLLTYGEEVDGISCD  175



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--PLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--PLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L+GQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--PLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREGNQ CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>gb|AFR38735.1| cellulose synthase, partial [Populus fremontii]
Length=94

 Score =   138 bits (348),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 2/90 (2%)
 Frame = +2

Query  143  IAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNECAFPVCR  322
            +AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNEC FPVCR
Sbjct  4    VAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNECGFPVCR  61

Query  323  PCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            PCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  62   PCYEYERREGTQNCPQCKTRYKRLKGSPRV  91



>dbj|BAM05574.1| cellulose synthase 3, partial [Eucalyptus pyrocarpa]
 dbj|BAM05575.1| cellulose synthase 3, partial [Eucalyptus pilularis]
Length=473

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KDP36709.1| hypothetical protein JCGZ_08000 [Jatropha curcas]
Length=1089

 Score =   150 bits (380),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  D       +++LSGQIC ICGD+V +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICHICGDDVGLTVDGELFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            CAFP+CR CYEYERREG Q CPQCKTR+KR+KG  RV
Sbjct  61   CAFPICRTCYEYERREGTQVCPQCKTRFKRLKGCARV  97



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E      +K LSGQ+C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLSGQVCEICGDEIGLTVDGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +  ++K LSGQ C+ICGDEV +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--TLKNLSGQDCEICGDEVGLTVDGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREGNQ CPQCKTR+KR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGNQLCPQCKTRFKRLKGSPRV  95



>ref|XP_009622822.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1041

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009622821.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1079

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009408434.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 116/176 (66%), Gaps = 12/176 (7%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  D       +++LSGQICQICGD+V +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFP+CR CYEYERREGNQ CPQCKTR+KR+KG PRV GD+EE+  DDL++EF++     
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRVAGDDEEDGVDDLENEFNFVGGHK  120

Query  467  --PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
               ++M +A L    + G   + +    +   P      VPLLT GE  D I  ++
Sbjct  121  QESQYMADAMLQGHMSYGRWGDINAPNMAHNAPQ-----VPLLTNGEMVDDIPPEQ  171



>gb|AFW69155.1| putative cellulose synthase family protein [Zea mays]
Length=981

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_002960719.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
 gb|EFJ38258.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
Length=1082

 Score =   149 bits (376),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 89/170 (52%), Positives = 115/170 (68%), Gaps = 17/170 (10%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSH RNE ++I  D +  +   ++   Q+CQICGD+V +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHIRNELLVIRGDVVKPLNHAEQ---QVCQICGDDVGLTVDGDLFVACNE  57

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCRPCY+YER++GNQACPQCKTRYKR KGSPRVEGD++EEEFDDLD EF+      
Sbjct  58   CAFPVCRPCYDYERKDGNQACPQCKTRYKRHKGSPRVEGDDDEEEFDDLDSEFNIHDEVD  117

Query  467  ---PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEED  607
                + + EA L  R + G   +       E++  G+   VPLLT G+ D
Sbjct  118  KMDRQQLAEAMLHGRMSYGRAED------HEIEMPGLQPPVPLLTNGQMD  161



>ref|XP_003598145.1| Cellulose synthase [Medicago truncatula]
 gb|AES68396.1| cellulose synthase-like protein [Medicago truncatula]
Length=1050

 Score =   149 bits (376),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+T   L+AGSHN+NEF++I  D     T ++EL G  CQ+CG+++ +  DG+PFVACNE
Sbjct  1    METNFGLVAGSHNKNEFIIIRQDGDYARTDLQELDGDTCQLCGEDIGVNADGDPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            CAFPVCR CYEYERREGNQ CPQCKT++KR+KG  RV
Sbjct  61   CAFPVCRNCYEYERREGNQVCPQCKTKFKRLKGCARV  97



>ref|XP_004956855.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Setaria italica]
Length=1050

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|ACL36368.1| cellulose synthase CesA10 [Bambusa oldhamii]
Length=265

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 113/174 (65%), Gaps = 8/174 (5%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  D       +++ +GQ+CQICGD+V +T DGEPFVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGDPGPKPLRQQNGQVCQICGDDVGLTPDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREG Q CPQC+TR+KR+KG  RV GDEEE+  DDL++EF++     
Sbjct  61   CAFPVCRDCYEYERREGTQNCPQCRTRFKRLKGCARVPGDEEEDGVDDLENEFNWRDRND  120

Query  467  PEHMTEAALAARFNGGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             +++ E+ L A  + G G       P    P      +PLLT G+  D I  ++
Sbjct  121  SQYVAESMLHAHMSYGRGGADLNAMPQPFQPI---PNLPLLTNGQMVDDIPPEQ  171



>ref|XP_002460229.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
 gb|EER96750.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
Length=1049

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_008670200.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Zea mays]
 tpg|DAA40096.1| TPA: putative cellulose synthase family protein [Zea mays]
 gb|AIL25252.1| cellulose synthase catalytic subunit 13 [Zea mays]
Length=1052

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEEPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ+C ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_008794369.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1049

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEEPK--PLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010929171.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Elaeis guineensis]
Length=1048

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   +K L+GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEEPK--PLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78812.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|NP_001289644.1| cellulose synthase A catalytic subunit 7 [Eucalyptus grandis]
 gb|AAY60845.1| cellulose synthase 3 [Eucalyptus grandis]
Length=1040

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|EPS60781.1| hypothetical protein M569_14019 [Genlisea aurea]
Length=1043

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +  +VK LSGQ+C+ICGD V +TV GE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--AVKNLSGQVCEICGDRVGVTVGGELFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|AFR58756.2| cellulose synthase 3 [Eucalyptus tereticornis]
Length=1040

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78815.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1041

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AGE09566.1| cellulose synthase-like protein [Eucalyptus cladocalyx]
Length=1041

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78814.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AGJ71354.1| cellulose synthase 3 [Eucalyptus urophylla]
Length=1040

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AEK31217.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1040

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>tpg|DAA61529.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1056

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ+C+ICGDEV +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KG+PRV
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGTPRV  95



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I   E  +   +K+LSGQ+C+ICGDE+ ++VDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIQGHEEPK--PLKDLSGQVCEICGDEIGLSVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRV  95



>gb|KHG11460.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=996

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG+Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>gb|ACL36367.1| cellulose synthase CesA9 [Bambusa oldhamii]
Length=266

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 14/177 (8%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I  D       +++ +GQ+CQICGD+V +T DGEPFVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGDPGPKPLRQQNGQVCQICGDDVGLTPDGEPFVACNE  60

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVegdeeeeefddldhefdY-----  466
            CAFPVCR CYEYERREG Q CPQCKTR+KR+KG  RV GDEEE+  DDL++EF++     
Sbjct  61   CAFPVCRDCYEYERREGTQNCPQCKTRFKRLKGCARVPGDEEEDGVDDLENEFNWRDRND  120

Query  467  PEHMTEAALAARFN---GGLGVNGSGTTPSEVDPSGVDSXVPLLTYGEEDDGISADK  628
             +++ E+ L A  +   GG  +NG    P +  P      VPLLT G+  D I  ++
Sbjct  121  SQYVAESMLHAHMSYGRGGTDLNGV-RQPFQPIPD-----VPLLTNGQMVDDIPPEQ  171



>gb|KJB07760.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=755

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  122  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEITVDGEPFVACNE  301
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ+C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEPK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  302  CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  412
            C FPVCRPCYEYERREG Q CPQCKTRYKR+KGSPRV
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250