BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS119E04

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365462.1|  PREDICTED: protein transport protein SEC23-like    220   2e-63   Solanum tuberosum [potatoes]
ref|XP_004239847.1|  PREDICTED: protein transport protein SEC23-like    220   2e-63   Solanum lycopersicum
ref|XP_009799069.1|  PREDICTED: protein transport protein SEC23-like    219   4e-63   Nicotiana sylvestris
ref|XP_009622558.1|  PREDICTED: protein transport protein SEC23-like    219   7e-63   Nicotiana tomentosiformis
ref|XP_006358773.1|  PREDICTED: protein transport protein SEC23-like    211   4e-60   Solanum tuberosum [potatoes]
ref|XP_004247906.1|  PREDICTED: protein transport protein SEC23-like    209   2e-59   Solanum lycopersicum
emb|CDP15130.1|  unnamed protein product                                206   4e-58   Coffea canephora [robusta coffee]
gb|KDO52832.1|  hypothetical protein CISIN_1g0042381mg                  197   2e-57   Citrus sinensis [apfelsine]
gb|KDP32574.1|  hypothetical protein JCGZ_13124                         199   1e-55   Jatropha curcas
ref|XP_006421049.1|  hypothetical protein CICLE_v10004373mg             197   3e-55   Citrus clementina [clementine]
ref|XP_003601725.1|  Protein transport protein Sec23                    196   7e-55   
ref|XP_003601724.1|  Protein transport protein Sec23                    196   8e-55   Medicago truncatula
ref|XP_010270294.1|  PREDICTED: protein transport protein SEC23-like    196   9e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009378161.1|  PREDICTED: protein transport protein SEC23-like    195   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004502262.1|  PREDICTED: protein transport protein SEC23-l...    195   2e-54   Cicer arietinum [garbanzo]
ref|XP_009373604.1|  PREDICTED: protein transport protein SEC23-like    195   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_007034166.1|  Sec23/Sec24 protein transport family protein       194   4e-54   Theobroma cacao [chocolate]
ref|XP_010028115.1|  PREDICTED: protein transport protein SEC23-like    194   5e-54   Eucalyptus grandis [rose gum]
ref|XP_008337484.1|  PREDICTED: protein transport protein SEC23         194   7e-54   
ref|XP_007153808.1|  hypothetical protein PHAVU_003G066300g             194   7e-54   Phaseolus vulgaris [French bean]
gb|EPS74608.1|  hypothetical protein M569_00146                         186   9e-54   Genlisea aurea
ref|XP_003552491.1|  PREDICTED: protein transport protein SEC23-l...    192   2e-53   Glycine max [soybeans]
ref|XP_011084141.1|  PREDICTED: protein transport protein SEC23-like    192   2e-53   Sesamum indicum [beniseed]
ref|XP_007221956.1|  hypothetical protein PRUPE_ppa001742mg             192   2e-53   Prunus persica
ref|XP_008222792.1|  PREDICTED: protein transport protein SEC23         192   2e-53   Prunus mume [ume]
ref|XP_010650390.1|  PREDICTED: protein transport protein SEC23-like    192   2e-53   Vitis vinifera
ref|XP_002516399.1|  protein transport protein sec23, putative          192   4e-53   Ricinus communis
ref|XP_009349001.1|  PREDICTED: protein transport protein SEC23-like    191   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_007163794.1|  hypothetical protein PHAVU_001G264700g             191   5e-53   Phaseolus vulgaris [French bean]
ref|XP_010683601.1|  PREDICTED: protein transport protein SEC23-like    191   8e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004296961.1|  PREDICTED: protein transport protein SEC23-like    190   1e-52   Fragaria vesca subsp. vesca
ref|XP_006492989.1|  PREDICTED: protein transport protein SEC23-like    190   1e-52   Citrus sinensis [apfelsine]
gb|KJB37898.1|  hypothetical protein B456_006G225300                    190   2e-52   Gossypium raimondii
ref|XP_010097955.1|  Protein transport protein SEC23                    190   2e-52   Morus notabilis
gb|KJB37899.1|  hypothetical protein B456_006G225300                    189   2e-52   Gossypium raimondii
gb|KHF97532.1|  Protein transport SEC23                                 189   2e-52   Gossypium arboreum [tree cotton]
gb|EYU38948.1|  hypothetical protein MIMGU_mgv1a001629mg                189   2e-52   Erythranthe guttata [common monkey flower]
gb|EPS72601.1|  hypothetical protein M569_02145                         189   3e-52   Genlisea aurea
ref|XP_003538532.1|  PREDICTED: protein transport protein SEC23-l...    189   3e-52   Glycine max [soybeans]
ref|XP_004172995.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    181   6e-52   
gb|KJB71965.1|  hypothetical protein B456_011G150700                    187   9e-52   Gossypium raimondii
gb|KHG15352.1|  Protein transport SEC23                                 187   1e-51   Gossypium arboreum [tree cotton]
ref|XP_008439044.1|  PREDICTED: protein transport protein SEC23         186   2e-51   Cucumis melo [Oriental melon]
ref|XP_010269071.1|  PREDICTED: protein transport protein SEC23-like    185   7e-51   Nelumbo nucifera [Indian lotus]
ref|XP_011045698.1|  PREDICTED: protein transport protein SEC23-like    185   7e-51   Populus euphratica
gb|KHG04907.1|  Protein transport SEC23                                 185   1e-50   Gossypium arboreum [tree cotton]
ref|XP_010532714.1|  PREDICTED: protein transport protein SEC23-l...    184   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_006370915.1|  transport family protein                           184   2e-50   
ref|XP_011046336.1|  PREDICTED: protein transport protein SEC23-like    184   2e-50   Populus euphratica
gb|KHG16267.1|  Protein transport Sec23A                                184   2e-50   Gossypium arboreum [tree cotton]
gb|KJB28028.1|  hypothetical protein B456_005G022700                    182   2e-50   Gossypium raimondii
emb|CDY12738.1|  BnaC04g29030D                                          183   3e-50   Brassica napus [oilseed rape]
ref|XP_010466720.1|  PREDICTED: protein transport protein SEC23-like    182   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010532717.1|  PREDICTED: protein transport protein SEC23-l...    182   5e-50   Tarenaya hassleriana [spider flower]
gb|KJB30033.1|  hypothetical protein B456_005G128200                    180   5e-50   Gossypium raimondii
ref|XP_002300208.1|  transport family protein                           182   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002892293.1|  hypothetical protein ARALYDRAFT_470552             182   7e-50   
gb|KGN57237.1|  hypothetical protein Csa_3G172420                       182   8e-50   Cucumis sativus [cucumbers]
ref|XP_004147649.1|  PREDICTED: protein transport protein SEC23-like    182   8e-50   
ref|XP_010512680.1|  PREDICTED: protein transport protein SEC23-l...    182   1e-49   Camelina sativa [gold-of-pleasure]
gb|KFK39665.1|  hypothetical protein AALP_AA3G273400                    182   1e-49   Arabis alpina [alpine rockcress]
gb|KJB28027.1|  hypothetical protein B456_005G022700                    181   1e-49   Gossypium raimondii
ref|XP_010485034.1|  PREDICTED: protein transport protein SEC23-like    181   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_974544.1|  sec23/sec24-like transport protein                    180   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527425.1|  PREDICTED: protein transport protein SEC23-l...    179   3e-49   Tarenaya hassleriana [spider flower]
gb|KFK42891.1|  hypothetical protein AALP_AA1G052100                    180   4e-49   Arabis alpina [alpine rockcress]
ref|XP_010527422.1|  PREDICTED: protein transport protein SEC23-l...    180   4e-49   Tarenaya hassleriana [spider flower]
ref|NP_563741.1|  sec23/sec24-like transport protein                    180   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08282.1|  At1g05520/T25N20_16                                     180   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30034.1|  hypothetical protein B456_005G128200                    179   5e-49   Gossypium raimondii
gb|AAF79733.1|AC005106_14  T25N20.17                                    180   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522277.1|  PREDICTED: protein transport protein SEC23         179   8e-49   Tarenaya hassleriana [spider flower]
ref|XP_006418018.1|  hypothetical protein EUTSA_v10006857mg             179   8e-49   Eutrema salsugineum [saltwater cress]
gb|KJB30032.1|  hypothetical protein B456_005G128200                    179   8e-49   Gossypium raimondii
ref|NP_193152.2|  sec23/sec24-like transport protein                    179   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10394.1|  AT4g14160/dl3120w                                       179   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10195.1|  transport protein                                      179   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849541.2|  sec23/sec24-like transport protein                    179   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90271.1|  BnaA08g17130D                                          179   1e-48   
ref|XP_002885585.1|  hypothetical protein ARALYDRAFT_479878             178   2e-48   
ref|XP_006414783.1|  hypothetical protein EUTSA_v10024465mg             178   2e-48   Eutrema salsugineum [saltwater cress]
emb|CDY12077.1|  BnaC03g59930D                                          177   3e-48   Brassica napus [oilseed rape]
emb|CDX86574.1|  BnaC08g01290D                                          177   4e-48   
ref|XP_009111051.1|  PREDICTED: protein transport protein SEC23         177   4e-48   Brassica rapa
ref|XP_010457640.1|  PREDICTED: protein transport protein SEC23-l...    177   5e-48   
gb|KFK22996.1|  hypothetical protein AALP_AAs50735U000600               177   5e-48   Arabis alpina [alpine rockcress]
emb|CDY01197.1|  BnaA04g06220D                                          176   9e-48   
ref|XP_010475248.1|  PREDICTED: protein transport protein SEC23-like    176   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006283156.1|  hypothetical protein CARUB_v10004186mg             176   2e-47   Capsella rubella
ref|XP_009139544.1|  PREDICTED: protein transport protein SEC23-like    174   4e-47   Brassica rapa
ref|XP_002870333.1|  hypothetical protein ARALYDRAFT_493493             174   6e-47   
ref|NP_189008.1|  Sec23/Sec24 protein transport family protein          174   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189956.1|  Sec23/Sec24 protein transport family protein       174   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297004.1|  hypothetical protein CARUB_v10012995mg             173   2e-46   Capsella rubella
ref|XP_006297005.1|  hypothetical protein CARUB_v10012995mg             173   2e-46   
emb|CBI39378.3|  unnamed protein product                                171   7e-46   Vitis vinifera
ref|XP_008785319.1|  PREDICTED: protein transport protein SEC23-like    169   3e-45   Phoenix dactylifera
ref|XP_010934373.1|  PREDICTED: protein transport protein SEC23-l...    167   6e-45   
ref|XP_009419583.1|  PREDICTED: protein transport protein SEC23-like    168   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934372.1|  PREDICTED: protein transport protein SEC23-l...    166   5e-44   Elaeis guineensis
ref|XP_009420223.1|  PREDICTED: protein transport protein SEC23-like    166   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006303716.1|  hypothetical protein CARUB_v10011838mg             166   8e-44   Capsella rubella
ref|XP_010908065.1|  PREDICTED: protein transport protein SEC23-l...    165   1e-43   
ref|XP_010908064.1|  PREDICTED: protein transport protein SEC23-l...    166   1e-43   Elaeis guineensis
ref|XP_006827919.1|  hypothetical protein AMTR_s00008p00163370          164   2e-43   Amborella trichopoda
ref|XP_010440522.1|  PREDICTED: protein transport protein SEC23-like    160   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008791501.1|  PREDICTED: protein transport protein SEC23-like    158   4e-41   Phoenix dactylifera
ref|XP_009414536.1|  PREDICTED: protein transport protein SEC23-like    158   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435181.1|  PREDICTED: protein transport protein SEC23-like    155   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009417946.1|  PREDICTED: protein transport protein SEC23-like    152   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB72955.1|  hypothetical protein B456_011G205900                    148   6e-38   Gossypium raimondii
ref|XP_010450096.1|  PREDICTED: protein transport protein SEC23-like    149   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003059046.1|  predicted protein                                  149   7e-38   Micromonas pusilla CCMP1545
gb|KJB72954.1|  hypothetical protein B456_011G205900                    148   7e-38   Gossypium raimondii
gb|KJB72956.1|  hypothetical protein B456_011G205900                    149   8e-38   Gossypium raimondii
ref|XP_010939455.1|  PREDICTED: protein transport protein SEC23 i...    148   9e-38   
gb|KJB72952.1|  hypothetical protein B456_011G205900                    149   1e-37   Gossypium raimondii
ref|XP_008797249.1|  PREDICTED: protein transport protein sec23 i...    148   1e-37   
ref|XP_010939452.1|  PREDICTED: protein transport protein SEC23 i...    148   1e-37   Elaeis guineensis
ref|XP_007011443.1|  Sec23/Sec24 protein transport family protein...    148   2e-37   Theobroma cacao [chocolate]
ref|XP_010255698.1|  PREDICTED: protein transport protein SEC23-like    148   2e-37   Nelumbo nucifera [Indian lotus]
gb|KJB78641.1|  hypothetical protein B456_013G010400                    146   2e-37   Gossypium raimondii
ref|XP_002508348.1|  predicted protein                                  148   2e-37   Micromonas commoda
ref|XP_002526529.1|  protein transport protein sec23, putative          147   2e-37   Ricinus communis
ref|XP_008797246.1|  PREDICTED: protein transport protein SEC23 i...    147   3e-37   Phoenix dactylifera
gb|KDP24898.1|  hypothetical protein JCGZ_24276                         149   3e-37   Jatropha curcas
ref|XP_009387153.1|  PREDICTED: protein transport protein SEC23         147   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ07329.1|  hypothetical protein OsI_29578                          143   5e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_007011442.1|  Sec23/Sec24 protein transport family protein...    147   6e-37   
gb|KJB78640.1|  hypothetical protein B456_013G010400                    145   6e-37   Gossypium raimondii
ref|XP_003577593.1|  PREDICTED: protein transport protein SEC23-like    146   7e-37   Brachypodium distachyon [annual false brome]
gb|KJB78639.1|  hypothetical protein B456_013G010400                    145   9e-37   Gossypium raimondii
gb|KJB78638.1|  hypothetical protein B456_013G010400                    145   1e-36   Gossypium raimondii
gb|KJB78636.1|  hypothetical protein B456_013G010400                    145   1e-36   Gossypium raimondii
ref|XP_001762459.1|  predicted protein                                  146   1e-36   
gb|KJB78634.1|  hypothetical protein B456_013G010400                    145   1e-36   Gossypium raimondii
gb|EEE67142.1|  hypothetical protein OsJ_24197                          145   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774792.1|  predicted protein                                  145   1e-36   
ref|XP_002444510.1|  hypothetical protein SORBIDRAFT_07g023060          145   1e-36   Sorghum bicolor [broomcorn]
emb|CAN81541.1|  hypothetical protein VITISV_008772                     141   2e-36   Vitis vinifera
ref|XP_008375693.1|  PREDICTED: protein transport protein SEC23-like    143   2e-36   
ref|XP_008344490.1|  PREDICTED: protein transport protein SEC23-like    140   2e-36   
ref|XP_010097714.1|  Protein transport protein SEC23                    144   3e-36   
ref|XP_004973675.1|  PREDICTED: protein transport protein SEC23-l...    144   3e-36   Setaria italica
gb|EMS65767.1|  Protein transport protein SEC23                         143   4e-36   Triticum urartu
ref|XP_010278786.1|  PREDICTED: protein transport protein SEC23-l...    144   6e-36   
ref|XP_004973674.1|  PREDICTED: protein transport protein SEC23-l...    144   7e-36   Setaria italica
ref|XP_010278785.1|  PREDICTED: protein transport protein SEC23-l...    143   7e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010278787.1|  PREDICTED: protein transport protein SEC23-l...    143   7e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010278782.1|  PREDICTED: protein transport protein SEC23-l...    144   7e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010278781.1|  PREDICTED: protein transport protein SEC23-l...    143   8e-36   
ref|NP_001062030.1|  Os08g0474700                                       143   1e-35   
gb|KHG07260.1|  Protein transport SEC23                                 143   1e-35   Gossypium arboreum [tree cotton]
ref|XP_009361354.1|  PREDICTED: protein transport protein SEC23-like    143   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_007220245.1|  hypothetical protein PRUPE_ppa001813mg             142   1e-35   Prunus persica
ref|XP_011024746.1|  PREDICTED: protein transport protein SEC23-l...    142   1e-35   Populus euphratica
ref|XP_011024747.1|  PREDICTED: protein transport protein SEC23-l...    142   1e-35   Populus euphratica
ref|XP_004964627.1|  PREDICTED: protein transport protein SEC23-l...    142   2e-35   
ref|XP_008460075.1|  PREDICTED: protein transport protein SEC23         142   2e-35   Cucumis melo [Oriental melon]
ref|XP_008232223.1|  PREDICTED: protein transport protein SEC23         142   2e-35   Prunus mume [ume]
ref|XP_004153079.1|  PREDICTED: protein transport protein SEC23-like    142   2e-35   
ref|XP_004160683.1|  PREDICTED: protein transport protein SEC23-like    142   2e-35   
ref|XP_004145019.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    142   2e-35   
ref|XP_001702936.1|  COP-II coat subunit                                142   2e-35   Chlamydomonas reinhardtii
ref|XP_010052697.1|  PREDICTED: protein transport protein SEC23         142   3e-35   Eucalyptus grandis [rose gum]
ref|XP_002460346.1|  hypothetical protein SORBIDRAFT_02g026780          142   3e-35   Sorghum bicolor [broomcorn]
ref|XP_002265101.1|  PREDICTED: protein transport protein SEC23         141   4e-35   Vitis vinifera
ref|XP_003578242.1|  PREDICTED: protein transport protein SEC23-like    141   4e-35   Brachypodium distachyon [annual false brome]
gb|EAY80788.1|  hypothetical protein OsI_35968                          141   4e-35   Oryza sativa Indica Group [Indian rice]
emb|CBI38071.3|  unnamed protein product                                141   5e-35   Vitis vinifera
ref|XP_011010741.1|  PREDICTED: protein transport protein SEC23-like    141   5e-35   Populus euphratica
gb|AAX96396.1|  At1g05520/T25N20_16                                     141   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004307298.1|  PREDICTED: protein transport protein SEC23         141   5e-35   Fragaria vesca subsp. vesca
ref|XP_005843379.1|  hypothetical protein CHLNCDRAFT_141205             139   5e-35   Chlorella variabilis
gb|EMT27989.1|  Protein transport protein sec-23                        142   6e-35   
ref|XP_002946892.1|  hypothetical protein VOLCADRAFT_103128             141   7e-35   Volvox carteri f. nagariensis
ref|XP_006375610.1|  hypothetical protein POPTR_0014s17660g             140   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002320574.1|  transport family protein                           140   8e-35   
ref|XP_006659495.1|  PREDICTED: protein transport protein SEC23-like    140   9e-35   Oryza brachyantha
ref|XP_009376310.1|  PREDICTED: protein transport protein SEC23-like    140   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008344985.1|  PREDICTED: protein transport protein SEC23         140   2e-34   
gb|EEC82002.1|  hypothetical protein OsI_25948                          140   2e-34   Oryza sativa Indica Group [Indian rice]
gb|KDO85352.1|  hypothetical protein CISIN_1g004199mg                   137   2e-34   Citrus sinensis [apfelsine]
ref|XP_008668489.1|  PREDICTED: uncharacterized protein LOC100384...    140   2e-34   
tpg|DAA40251.1|  TPA: hypothetical protein ZEAMMB73_365624              139   3e-34   
ref|XP_003626854.1|  Protein transport protein SEC23                    139   3e-34   Medicago truncatula
gb|KDO85351.1|  hypothetical protein CISIN_1g004199mg                   137   4e-34   Citrus sinensis [apfelsine]
ref|XP_002461253.1|  hypothetical protein SORBIDRAFT_02g043632          132   4e-34   
dbj|BAJ93511.1|  predicted protein                                      137   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004510207.1|  PREDICTED: protein transport protein SEC23-like    138   6e-34   Cicer arietinum [garbanzo]
ref|XP_006445524.1|  hypothetical protein CICLE_v10019144mg             137   7e-34   
gb|KDO85350.1|  hypothetical protein CISIN_1g004199mg                   137   1e-33   Citrus sinensis [apfelsine]
ref|XP_006464334.1|  PREDICTED: protein transport protein SEC23-like    137   1e-33   Citrus sinensis [apfelsine]
gb|EMS46122.1|  Protein transport protein SEC23                         136   2e-33   Triticum urartu
gb|KDO85349.1|  hypothetical protein CISIN_1g004199mg                   137   2e-33   Citrus sinensis [apfelsine]
gb|EMT03462.1|  Protein transport protein SEC23                         136   3e-33   
dbj|BAJ85358.1|  predicted protein                                      135   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01218.1|  predicted protein                                      135   5e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002102257.1|  GD19805                                            127   5e-33   
ref|XP_010691934.1|  PREDICTED: protein transport protein SEC23         135   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002982254.1|  hypothetical protein SELMODRAFT_155031             135   7e-33   Selaginella moellendorffii
ref|XP_002966180.1|  hypothetical protein SELMODRAFT_168140             135   7e-33   Selaginella moellendorffii
ref|XP_006854134.1|  hypothetical protein AMTR_s00048p00165750          135   8e-33   Amborella trichopoda
ref|XP_002986965.1|  hypothetical protein SELMODRAFT_124893             134   1e-32   
ref|XP_002977937.1|  hypothetical protein SELMODRAFT_107900             134   1e-32   
ref|XP_010235206.1|  PREDICTED: protein transport protein SEC23-l...    133   3e-32   
ref|XP_003574621.1|  PREDICTED: protein transport protein SEC23-l...    133   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_008224182.1|  PREDICTED: protein transport protein SEC23         133   5e-32   Prunus mume [ume]
emb|CCO26910.1|  Protein transport protein SEC23                        124   6e-32   Rhizoctonia solani AG-1 IB
ref|XP_009629158.1|  PREDICTED: protein transport protein SEC23         132   7e-32   Nicotiana tomentosiformis
ref|XP_003521007.1|  PREDICTED: protein transport protein SEC23-like    132   1e-31   Glycine max [soybeans]
gb|KDP40275.1|  hypothetical protein JCGZ_02273                         132   1e-31   Jatropha curcas
ref|XP_004229519.1|  PREDICTED: protein transport protein SEC23         132   1e-31   Solanum lycopersicum
gb|EPX71940.1|  GTPase activating protein Sec23a                        131   1e-31   Schizosaccharomyces octosporus yFS286
gb|EPY49891.1|  GTPase activating protein Sec23a                        131   1e-31   Schizosaccharomyces cryophilus OY26
ref|XP_009800228.1|  PREDICTED: protein transport protein SEC23         131   2e-31   Nicotiana sylvestris
ref|XP_780042.1|  PREDICTED: protein transport protein Sec23A iso...    131   2e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001774442.1|  predicted protein                                  131   2e-31   
ref|XP_008482918.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    129   2e-31   
ref|XP_007225252.1|  hypothetical protein PRUPE_ppa001670mg             131   2e-31   Prunus persica
ref|XP_009101771.1|  PREDICTED: protein transport protein SEC23         130   3e-31   Brassica rapa
ref|XP_011030584.1|  PREDICTED: protein transport protein sec23-1       130   3e-31   Populus euphratica
ref|XP_010149983.1|  PREDICTED: protein transport protein Sec23A-...    124   3e-31   Eurypyga helias
ref|XP_006354587.1|  PREDICTED: protein transport protein SEC23-like    130   4e-31   Solanum tuberosum [potatoes]
dbj|BAM19569.1|  protein transport protein sec23                        123   4e-31   Papilio xuthus [Chinese swallowtail]
gb|KIJ06392.1|  hypothetical protein PAXINDRAFT_103385                  121   5e-31   Paxillus involutus ATCC 200175
ref|XP_010495646.1|  PREDICTED: protein transport protein SEC23-like    127   5e-31   Camelina sativa [gold-of-pleasure]
emb|CCA74741.1|  probable SEC23-component of COPII coat of ER-gol...    130   5e-31   Serendipita indica DSM 11827
ref|XP_011091114.1|  PREDICTED: protein transport protein SEC23         130   6e-31   Sesamum indicum [beniseed]
ref|XP_008042194.1|  copii coat protein                                 129   7e-31   Trametes versicolor FP-101664 SS1
ref|XP_007660591.1|  PREDICTED: protein transport protein Sec23A-...    120   7e-31   
gb|KIM24219.1|  hypothetical protein M408DRAFT_331867                   129   1e-30   Serendipita vermifera MAFF 305830
gb|ABQ12917.1|  Sec23 (S. cerevisiae) homolog B                         120   1e-30   Bos taurus [bovine]
ref|XP_002173747.1|  GTPase activating protein Sec23a                   129   1e-30   Schizosaccharomyces japonicus yFS275
emb|CAB81549.1|  putative Sec23 protein                                 129   1e-30   Drosophila melanogaster
ref|XP_008477629.1|  PREDICTED: protein transport protein Sec23A-...    128   1e-30   
ref|XP_011279270.1|  PREDICTED: protein transport protein Sec23B-...    121   1e-30   
emb|CDY22339.1|  BnaA06g36610D                                          128   1e-30   Brassica napus [oilseed rape]
ref|XP_010481838.1|  PREDICTED: protein transport protein SEC23-like    129   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009396065.1|  PREDICTED: protein transport protein sec23-1       129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN32738.1|  Protein transport protein SEC23                         128   2e-30   Glycine soja [wild soybean]
ref|XP_010274198.1|  PREDICTED: protein transport protein Sec23A        128   2e-30   Nelumbo nucifera [Indian lotus]
gb|AAN71374.1|  RE35250p                                                128   2e-30   Drosophila melanogaster
ref|XP_002517022.1|  protein transport protein sec23, putative          128   2e-30   Ricinus communis
ref|XP_007370480.1|  hypothetical protein DICSQDRAFT_183604             128   2e-30   Dichomitus squalens LYAD-421 SS1
ref|NP_730978.1|  Sec23 ortholog, isoform A                             128   3e-30   Drosophila melanogaster
ref|NP_001246933.1|  Sec23 ortholog, isoform F                          128   3e-30   Drosophila melanogaster
ref|XP_002098055.1|  GE10151                                            127   3e-30   Drosophila yakuba
ref|XP_001978970.1|  GG12978                                            127   3e-30   Drosophila erecta
ref|NP_001246932.1|  Sec23 ortholog, isoform E                          127   3e-30   Drosophila melanogaster
ref|XP_002385801.1|  hypothetical protein MPER_16204                    120   3e-30   
ref|XP_002863641.1|  hypothetical protein ARALYDRAFT_494637             127   3e-30   
ref|XP_006280033.1|  hypothetical protein CARUB_v10025910mg             127   3e-30   Capsella rubella
ref|XP_001631204.1|  predicted protein                                  127   3e-30   Nematostella vectensis
ref|XP_004234029.1|  PREDICTED: protein transport protein SEC23         127   4e-30   Solanum lycopersicum
ref|XP_006356052.1|  PREDICTED: protein transport protein SEC23-like    127   4e-30   Solanum tuberosum [potatoes]
ref|XP_002315735.1|  transport family protein                           127   4e-30   
ref|XP_008312513.1|  PREDICTED: protein transport protein Sec23A        127   4e-30   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010441998.1|  PREDICTED: protein transport protein SEC23-like    127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007004395.1|  hypothetical protein TREMEDRAFT_71580              127   4e-30   Tremella mesenterica DSM 1558
ref|XP_001751286.1|  predicted protein                                  127   4e-30   
dbj|BAB08946.1|  protein transport protein SEC23                        127   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KDE07582.1|  protein transporter SEC23                               127   5e-30   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KDN53244.1|  hypothetical protein K437DRAFT_253260                   127   5e-30   Tilletiaria anomala UBC 951
ref|XP_007301896.1|  hypothetical protein STEHIDRAFT_166914             127   5e-30   Stereum hirsutum FP-91666 SS1
gb|EGI70064.1|  Protein transport protein Sec23A                        127   5e-30   Acromyrmex echinatior
ref|XP_011410444.1|  PREDICTED: protein transport protein Sec23A-...    127   5e-30   Amphimedon queenslandica
ref|XP_006403208.1|  hypothetical protein EUTSA_v10003153mg             127   5e-30   Eutrema salsugineum [saltwater cress]
gb|EKC99299.1|  protein transport protein SEC23                         127   6e-30   Trichosporon asahii var. asahii CBS 8904
ref|XP_004923361.1|  PREDICTED: protein transport protein Sec23A-...    127   6e-30   
ref|NP_568626.1|  sec23/sec24-like transport protein                    127   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002489340.1|  hypothetical protein SORBIDRAFT_0010s021250        127   6e-30   Sorghum bicolor [broomcorn]
ref|XP_003547758.1|  PREDICTED: protein transport protein SEC23-like    127   6e-30   Glycine max [soybeans]
ref|XP_004979229.1|  PREDICTED: protein transport protein SEC23-like    127   6e-30   Setaria italica
gb|ERL83427.1|  hypothetical protein D910_00401                         127   6e-30   Dendroctonus ponderosae
ref|XP_002013896.1|  GL24389                                            127   7e-30   
gb|EYU33007.1|  hypothetical protein MIMGU_mgv1a001608mg                127   7e-30   Erythranthe guttata [common monkey flower]
ref|XP_004923360.1|  PREDICTED: protein transport protein Sec23A-...    127   7e-30   Bombyx mori [silk moth]
gb|KIJ06501.1|  hypothetical protein PAXINDRAFT_91896                   122   7e-30   Paxillus involutus ATCC 200175
ref|XP_007134267.1|  hypothetical protein PHAVU_010G032700g             127   7e-30   
ref|XP_002137352.1|  GA26597, isoform A                                 127   7e-30   
ref|XP_003736491.1|  GA26597, isoform B                                 127   7e-30   
ref|XP_010081860.1|  PREDICTED: protein transport protein Sec23A        124   8e-30   
gb|KDN50157.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...    125   8e-30   
ref|XP_007384113.1|  protein transporter SEC23                          126   8e-30   
gb|EMD35658.1|  copii coat protein                                      126   8e-30   
ref|XP_001953052.1|  GF17577                                            126   8e-30   
ref|XP_001990177.1|  GH18375                                            126   8e-30   
ref|XP_002056184.1|  GJ10360                                            126   8e-30   
gb|KFV01574.1|  Protein transport protein Sec23A                        124   9e-30   
ref|XP_002070766.1|  GK12234                                            126   9e-30   
ref|XP_002311659.1|  hypothetical protein POPTR_0008s16120g             126   1e-29   
gb|AEE62753.1|  unknown                                                 126   1e-29   
gb|EHB18824.1|  Protein transport protein Sec23B                        126   1e-29   
ref|XP_004840935.1|  PREDICTED: protein transport protein Sec23B ...    126   1e-29   
ref|XP_004909922.1|  PREDICTED: protein transport protein Sec23B        126   1e-29   
emb|CDX94717.1|  BnaC07g17260D                                          126   1e-29   
gb|ENN77775.1|  hypothetical protein YQE_05747                          126   1e-29   
gb|EJT48333.1|  protein transport protein SEC23                         126   1e-29   
emb|CDI52493.1|  probable SEC23-component of COPII coat of ER-gol...    126   1e-29   
dbj|BAE33090.1|  unnamed protein product                                122   1e-29   
ref|XP_008538699.1|  PREDICTED: protein transport protein Sec23B        126   1e-29   
ref|XP_010024035.1|  PREDICTED: protein transport protein Sec23A        126   1e-29   
ref|XP_003363993.1|  PREDICTED: protein transport protein Sec23B        126   1e-29   
ref|XP_005380990.1|  PREDICTED: protein transport protein Sec23B        126   1e-29   
ref|XP_010632467.1|  PREDICTED: protein transport protein Sec23B        126   1e-29   
gb|KDQ13407.1|  hypothetical protein BOTBODRAFT_33712                   126   1e-29   
ref|XP_003962841.1|  PREDICTED: protein transport protein Sec23A-...    126   1e-29   
ref|XP_009268230.1|  Protein transport protein SEC23                    127   1e-29   
ref|XP_003203805.1|  PREDICTED: protein transport protein Sec23B        125   1e-29   
ref|XP_006957323.1|  copii coat protein                                 125   1e-29   
ref|NP_001006179.1|  protein transport protein Sec23A                   125   1e-29   
ref|XP_008589236.1|  PREDICTED: protein transport protein Sec23A        123   2e-29   
ref|NP_587900.1|  COPII cargo receptor subunit Sec23a (predicted)       125   2e-29   
emb|CEL57741.1|  Protein transport protein SEC23 OS=Ustilago mayd...    126   2e-29   
gb|EPS96173.1|  hypothetical protein FOMPIDRAFT_1167779                 125   2e-29   
ref|XP_010087764.1|  Protein transport protein Sec23A                   125   2e-29   
gb|EHJ75116.1|  putative protein transport protein sec23                123   2e-29   
emb|CAN67335.1|  hypothetical protein VITISV_024487                     125   2e-29   
ref|XP_009373957.1|  PREDICTED: protein transport protein SEC23-l...    125   2e-29   
ref|XP_009373956.1|  PREDICTED: protein transport protein SEC23-l...    125   2e-29   
ref|XP_004614464.1|  PREDICTED: protein transport protein Sec23B ...    125   2e-29   
ref|XP_010754153.1|  PREDICTED: protein transport protein Sec23A        125   2e-29   
gb|ADN34158.1|  transport protein sec23                                 125   2e-29   
ref|XP_002284161.1|  PREDICTED: protein transport protein SEC23         125   2e-29   
ref|XP_005186963.1|  PREDICTED: protein transport protein Sec23A ...    125   2e-29   
emb|CBY41352.1|  unnamed protein product                                125   2e-29   
ref|XP_010278158.1|  PREDICTED: protein transport protein SEC23-like    125   2e-29   
ref|XP_005989219.1|  PREDICTED: protein transport protein Sec23A        125   2e-29   
ref|XP_007891559.1|  PREDICTED: protein transport protein Sec23A        125   2e-29   
ref|XP_003746313.1|  PREDICTED: protein transport protein Sec23A        125   2e-29   
ref|XP_001998913.1|  GI23366                                            125   2e-29   
gb|EDL95155.1|  SEC23B (S. cerevisiae) (predicted), isoform CRA_b       123   2e-29   
emb|CDH54362.1|  protein transporter sec23                              121   2e-29   
ref|XP_011093425.1|  PREDICTED: protein transport protein SEC23 i...    125   2e-29   
ref|XP_005186964.1|  PREDICTED: protein transport protein Sec23A ...    125   2e-29   
emb|CCM06023.1|  predicted protein                                      125   2e-29   
ref|XP_009549822.1|  hypothetical protein HETIRDRAFT_435796             125   2e-29   
gb|KEP48063.1|  protein transporter Sec23                               126   2e-29   
emb|CCF53565.1|  probable SEC23-component of COPII coat of ER-gol...    125   2e-29   
emb|CDQ97079.1|  unnamed protein product                                120   3e-29   
ref|XP_007404362.1|  hypothetical protein MELLADRAFT_41731              125   3e-29   
ref|XP_009482527.1|  PREDICTED: protein transport protein Sec23B ...    125   3e-29   
ref|XP_007392773.1|  hypothetical protein PHACADRAFT_251062             125   3e-29   
ref|XP_008465182.1|  PREDICTED: protein transport protein SEC23         125   3e-29   
gb|EDL28470.1|  SEC23B (S. cerevisiae), isoform CRA_b                   123   3e-29   
ref|XP_003321108.2|  protein transporter SEC23                          125   3e-29   
gb|KIO19135.1|  hypothetical protein M407DRAFT_246276                   125   3e-29   
gb|EUC66788.1|  protein transporter Sec23                               125   3e-29   
ref|NP_001072659.1|  protein transport protein Sec23A                   125   3e-29   
ref|XP_011387617.1|  putative GTPase-activating protein SEC23           125   3e-29   
dbj|GAC96354.1|  potential SEC23-like GTPase-activating protein         125   3e-29   
ref|XP_002710997.1|  PREDICTED: protein transport protein Sec23B        125   3e-29   
gb|KIP01777.1|  hypothetical protein PHLGIDRAFT_96685                   125   3e-29   
gb|EST07588.1|  vesicle coat complex COPII, subunit SEC23               125   3e-29   
ref|XP_007879432.1|  hypothetical protein PFL1_03722                    124   3e-29   
gb|AAH97063.1|  Sec23 homolog A (S. cerevisiae)                         125   3e-29   
gb|EFX88498.1|  hypothetical protein DAPPUDRAFT_190968                  125   3e-29   
ref|XP_008388605.1|  PREDICTED: protein transport protein SEC23-like    125   3e-29   
emb|CBQ71835.1|  probable SEC23-component of COPII coat of ER-gol...    125   3e-29   
ref|NP_998630.1|  protein transport protein Sec23A                      125   3e-29   
ref|XP_011029889.1|  PREDICTED: protein transport protein sec23-1...    125   3e-29   
gb|KFK31705.1|  hypothetical protein AALP_AA6G148300                    125   3e-29   
ref|XP_010012826.1|  PREDICTED: protein transport protein Sec23A        124   3e-29   
gb|KDD75245.1|  hypothetical protein H632_c788p0                        117   3e-29   
dbj|GAK63456.1|  copii coat protein                                     125   3e-29   
ref|XP_006182895.1|  PREDICTED: protein transport protein Sec23B ...    125   3e-29   
gb|ETS62844.1|  hypothetical protein PaG_02599                          125   3e-29   
ref|XP_002431175.1|  protein transport protein Sec23A, putative         125   3e-29   
ref|XP_005152100.1|  PREDICTED: protein transport protein Sec23A-...    124   4e-29   
ref|XP_011064305.1|  PREDICTED: protein transport protein Sec23A        124   4e-29   
ref|XP_004472430.1|  PREDICTED: protein transport protein Sec23B        124   4e-29   
ref|XP_006921617.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
ref|XP_007869503.1|  copii coat protein                                 124   4e-29   
ref|XP_004433770.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
gb|EMS18549.1|  protein transport protein SEC23                         124   4e-29   
gb|KDQ58302.1|  hypothetical protein JAAARDRAFT_34105                   124   4e-29   
ref|XP_004164421.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    124   4e-29   
ref|XP_008355768.1|  PREDICTED: protein transport protein SEC23-like    124   4e-29   
ref|XP_008831120.1|  PREDICTED: protein transport protein Sec23A        124   4e-29   
ref|XP_004150433.1|  PREDICTED: protein transport protein SEC23-like    124   4e-29   
ref|XP_009979218.1|  PREDICTED: protein transport protein Sec23A-...    121   4e-29   
ref|XP_008923315.1|  PREDICTED: protein transport protein Sec23A        124   4e-29   
ref|XP_001374135.1|  PREDICTED: protein transport protein Sec23B ...    124   4e-29   
emb|CDR44779.1|  RHTO0S10e00320g1_1                                     124   5e-29   
ref|XP_010531432.1|  PREDICTED: protein transport protein SEC23         124   5e-29   
ref|XP_007240542.1|  PREDICTED: protein transport protein Sec23A-...    124   5e-29   
ref|XP_006206234.1|  PREDICTED: protein transport protein Sec23B ...    124   5e-29   
gb|EPX72404.1|  GTPase activating protein Sec23b                        124   5e-29   
ref|XP_004017955.1|  PREDICTED: protein transport protein Sec23A        124   5e-29   
ref|XP_005479880.1|  PREDICTED: protein transport protein Sec23A        124   5e-29   
ref|XP_009026518.1|  hypothetical protein HELRODRAFT_185982             124   5e-29   
ref|XP_004585695.1|  PREDICTED: protein transport protein Sec23B        124   5e-29   
ref|XP_006015425.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_005985813.1|  PREDICTED: LOW QUALITY PROTEIN: Sec23 homolo...    124   6e-29   
ref|XP_009278965.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_002200559.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_005047371.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_007515183.1|  predicted protein                                  124   6e-29   
gb|EYU42283.1|  hypothetical protein MIMGU_mgv1a001723mg                124   6e-29   
ref|XP_009577232.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_009904914.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_005243914.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_009100152.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_011214740.1|  PREDICTED: protein transport protein Sec23A ...    124   6e-29   
ref|XP_009472738.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_421250.1|  PREDICTED: protein transport protein Sec23A iso...    124   6e-29   
ref|XP_011214742.1|  PREDICTED: protein transport protein Sec23A ...    124   6e-29   
ref|XP_009992172.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_009561911.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_003476542.1|  PREDICTED: protein transport protein Sec23B ...    124   6e-29   
ref|XP_009669204.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_009876332.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_005021459.1|  PREDICTED: protein transport protein Sec23A ...    124   6e-29   
gb|KFQ86992.1|  Protein transport protein Sec23A                        122   6e-29   
ref|XP_009937402.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_010142368.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_010305177.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_010287250.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_008503441.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_005072663.1|  PREDICTED: protein transport protein Sec23B        123   6e-29   
ref|XP_005148968.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_010198659.1|  PREDICTED: protein transport protein Sec23A        124   6e-29   
ref|XP_011177751.1|  PREDICTED: protein transport protein Sec23A ...    124   6e-29   
ref|XP_004531028.1|  PREDICTED: protein transport protein Sec23A-...    124   7e-29   
ref|XP_011177750.1|  PREDICTED: protein transport protein Sec23A ...    124   7e-29   
ref|XP_004614465.1|  PREDICTED: protein transport protein Sec23B ...    124   7e-29   
ref|XP_004531027.1|  PREDICTED: protein transport protein Sec23A-...    124   7e-29   
gb|KFO13060.1|  Protein transport protein Sec23A                        124   7e-29   
ref|XP_009954309.1|  PREDICTED: protein transport protein Sec23A        124   7e-29   
gb|KFP31076.1|  Protein transport protein Sec23A                        124   7e-29   
ref|XP_008211672.1|  PREDICTED: protein transport protein Sec23A ...    124   7e-29   
ref|XP_006259608.1|  PREDICTED: protein transport protein Sec23A-...    124   7e-29   
gb|KIM86120.1|  hypothetical protein PILCRDRAFT_816653                  124   7e-29   
ref|XP_003792045.1|  PREDICTED: protein transport protein Sec23A        123   7e-29   
ref|XP_004941831.1|  PREDICTED: protein transport protein Sec23A ...    124   8e-29   
ref|XP_008549258.1|  PREDICTED: protein transport protein Sec23A ...    124   8e-29   
ref|XP_003427585.1|  PREDICTED: protein transport protein Sec23A ...    124   8e-29   
ref|XP_006489507.1|  PREDICTED: protein transport protein SEC23-l...    124   8e-29   
ref|XP_006030511.1|  PREDICTED: protein transport protein Sec23A-...    124   8e-29   
ref|XP_005634786.1|  PREDICTED: protein transport protein Sec23B ...    124   8e-29   
ref|XP_008549259.1|  PREDICTED: protein transport protein Sec23A ...    124   8e-29   
ref|XP_005634787.1|  PREDICTED: protein transport protein Sec23B ...    124   8e-29   
gb|KDO53915.1|  hypothetical protein CISIN_1g004188mg                   124   8e-29   
ref|XP_005095981.1|  PREDICTED: protein transport protein Sec23A-...    124   8e-29   
ref|XP_005012158.1|  PREDICTED: protein transport protein Sec23A-...    124   8e-29   
ref|XP_005095979.1|  PREDICTED: protein transport protein Sec23A-...    124   8e-29   
ref|XP_005320492.1|  PREDICTED: protein transport protein Sec23B ...    123   8e-29   
gb|KIL64158.1|  hypothetical protein M378DRAFT_24750                    124   8e-29   
gb|EJU02357.1|  hypothetical protein DACRYDRAFT_22029                   124   8e-29   
ref|XP_006616914.1|  PREDICTED: protein transport protein Sec23A-...    124   9e-29   
ref|XP_006420097.1|  hypothetical protein CICLE_v10004380mg             124   9e-29   
ref|XP_392515.2|  PREDICTED: protein transport protein Sec23A-lik...    124   9e-29   
gb|EKC40209.1|  transport protein Sec23A                                123   9e-29   
ref|XP_011416353.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
ref|XP_010209001.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    122   1e-28   
ref|XP_006616915.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
ref|XP_006838861.1|  hypothetical protein AMTR_s00002p00266230          123   1e-28   
ref|XP_011416351.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
ref|XP_010354943.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
ref|XP_006567440.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
ref|XP_003758196.1|  PREDICTED: protein transport protein Sec23B        123   1e-28   
ref|NP_001166217.1|  protein transport protein Sec23B isoform 2         123   1e-28   
pdb|2NUP|A  Chain A, Crystal Structure Of The Human Sec23a24A HET...    123   1e-28   
ref|XP_008583587.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
dbj|BAG58980.1|  unnamed protein product                                123   1e-28   
ref|XP_008955398.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
ref|XP_007525648.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
ref|XP_010307555.1|  PREDICTED: protein transport protein Sec23A        122   1e-28   
pdb|3EG9|A  Chain A, Crystal Structure Of The Mammalian Copii-coa...    123   1e-28   
ref|XP_011416350.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
pdb|3EFO|A  Chain A, Crystal Structure Of The Mammalian Copii-coa...    123   1e-28   
gb|AAH36649.1|  Sec23 homolog A (S. cerevisiae)                         123   1e-28   
ref|XP_007984737.1|  PREDICTED: protein transport protein Sec23A ...    123   1e-28   
ref|XP_005267319.1|  PREDICTED: protein transport protein Sec23A ...    123   1e-28   
ref|NP_001248292.1|  protein transport protein Sec23A                   123   1e-28   
ref|XP_007543426.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
gb|EYC37691.1|  hypothetical protein Y032_0772g2231                     117   1e-28   
ref|XP_010337754.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
ref|NP_006355.2|  protein transport protein Sec23A                      123   1e-28   
ref|XP_009815415.1|  PREDICTED: protein transport protein Sec23A        122   1e-28   
emb|CAF89625.1|  unnamed protein product                                123   1e-28   
emb|CDJ94460.1|  Zinc finger and Sec23 Sec24 trunk region domain ...    117   1e-28   
ref|XP_004404205.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
ref|XP_007771283.1|  copii coat protein                                 123   1e-28   
ref|XP_005320491.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
ref|XP_010589816.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
ref|XP_003933212.1|  PREDICTED: protein transport protein Sec23B        123   1e-28   
dbj|BAC25779.1|  unnamed protein product                                123   1e-28   
ref|XP_005568308.1|  PREDICTED: protein transport protein Sec23B ...    123   1e-28   
ref|XP_009004211.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
gb|KIH68912.1|  Sec23/Sec24 zinc finger                                 117   1e-28   
ref|XP_001765516.1|  predicted protein                                  123   1e-28   
ref|XP_004649663.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
ref|XP_005806890.1|  PREDICTED: protein transport protein Sec23A-...    123   1e-28   
gb|KIK68656.1|  hypothetical protein GYMLUDRAFT_36135                   123   1e-28   
ref|XP_008678116.1|  PREDICTED: protein transport protein SEC23-like    123   1e-28   
emb|CDQ66252.1|  unnamed protein product                                123   1e-28   
ref|XP_003471955.1|  PREDICTED: protein transport protein Sec23A        123   1e-28   
ref|XP_001492394.1|  PREDICTED: protein transport protein Sec23A ...    123   1e-28   



>ref|XP_006365462.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=784

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 2/128 (2%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP-H  575
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SETNVP ELYPQFTTIQYTLP  
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISETNVPGELYPQFTTIQYTLPSQ  121

Query  576  NP-NIGPN  596
            NP +  PN
Sbjct  122  NPQSFNPN  129



>ref|XP_004239847.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=784

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 110/128 (86%), Gaps = 6/128 (5%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++Q D EGIDGVRMTWNAWPRTKVE+SKCVIPIA+SIHLIRP  +L T+PY PLRCK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVEASKCVIPIASSIHLIRPHTDLPTLPYVPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP--  572
            TCTAVLNPFARVD+QALIWICPFCFQRN FP  YS +SETNVP ELYPQFTTIQYTLP  
Sbjct  62   TCTAVLNPFARVDFQALIWICPFCFQRNHFPQHYSGISETNVPGELYPQFTTIQYTLPSQ  121

Query  573  ----HNPN  584
                 NPN
Sbjct  122  TPQSFNPN  129



>ref|XP_009799069.1| PREDICTED: protein transport protein SEC23-like [Nicotiana sylvestris]
Length=770

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++ETNVPAELYPQFTTIQYTLP N
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINETNVPAELYPQFTTIQYTLP-N  120

Query  579  PNIGPN  596
            P   PN
Sbjct  121  PTQNPN  126



>ref|XP_009622558.1| PREDICTED: protein transport protein SEC23-like [Nicotiana tomentosiformis]
Length=774

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 3/131 (2%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++Q D EGIDGVRMTWNAWPRTKVESSKCVIPIA SIHLIRP  +L T+ Y PL+CK
Sbjct  2    ATEMAQPDAEGIDGVRMTWNAWPRTKVESSKCVIPIATSIHLIRPHTDLPTLSYPPLKCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC++VLNPFARVD+QALIWICPFCFQRN FPH YS ++ETNVPAELYPQFTTIQYTL   
Sbjct  62   TCSSVLNPFARVDFQALIWICPFCFQRNHFPHHYSGINETNVPAELYPQFTTIQYTL---  118

Query  579  PNIGPNSAAGP  611
            PN GPN    P
Sbjct  119  PNPGPNPTQNP  129



>ref|XP_006358773.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++QTD EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTDPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SETNVPAELYPQFTTIQY +  N
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISETNVPAELYPQFTTIQYAI-QN  120

Query  579  PNIGPNS  599
            P  G NS
Sbjct  121  PG-GHNS  126



>ref|XP_004247906.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=766

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++QT+ EGIDGVRMTWN+WPRTKVE+SKC+IPIA+SI L+RP P+L T+PYAPLRCK
Sbjct  2    ATEMAQTEPEGIDGVRMTWNSWPRTKVEASKCIIPIASSIQLLRPFPDLPTLPYAPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC+++LNPF RVD+QALIWICPFCFQRN FP  YS +SETNVPAELYPQFTTIQY +  N
Sbjct  62   TCSSILNPFCRVDFQALIWICPFCFQRNHFPQHYSGISETNVPAELYPQFTTIQYAI-QN  120

Query  579  PNIGPNS  599
            P  G NS
Sbjct  121  PG-GHNS  126



>emb|CDP15130.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 8/134 (6%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            ++E++Q D EGIDGVRMTWN WPRTKVE SKCVIP+AASI  IR  P+++T+PY PL+CK
Sbjct  2    ATEMAQMDPEGIDGVRMTWNVWPRTKVELSKCVIPLAASISPIRSHPDVLTLPYPPLKCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP--  572
            TCTAVLNPF RVD+Q L+WICPFCF RN FP  Y+A+SETN+PAELYPQFTTIQYTLP  
Sbjct  62   TCTAVLNPFCRVDFQGLVWICPFCFSRNHFPQHYNAISETNMPAELYPQFTTIQYTLPTL  121

Query  573  ------HNPNIGPN  596
                   NPN  PN
Sbjct  122  QPIHHHQNPNQNPN  135



>gb|KDO52832.1| hypothetical protein CISIN_1g0042381mg, partial [Citrus sinensis]
Length=412

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++YTLPH+
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTLPHS  120



>gb|KDP32574.1| hypothetical protein JCGZ_13124 [Jatropha curcas]
Length=778

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+AVLN FARVD+ A IWICPFCFQRN FP  Y+ +SETN+PAELYPQ+TT+Q+TLP NP
Sbjct  62   CSAVLNSFARVDFTAKIWICPFCFQRNHFPPHYAMISETNLPAELYPQYTTVQFTLP-NP  120

Query  582  NIGPNS  599
             + P++
Sbjct  121  GVNPSN  126



>ref|XP_006421049.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
 gb|ESR34289.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
Length=774

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++YTLPH+
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYTLPHS  120



>ref|XP_003601725.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71976.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=702

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH-N  578
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y +PH +
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISETNLPGELYPQYTTVEYHIPHTD  121

Query  579  PN  584
            PN
Sbjct  122  PN  123



>ref|XP_003601724.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71975.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=771

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPR+KVESSKCVIP+AA+I LIR  P++ ++PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRSKVESSKCVIPLAATISLIRSHPDIPSLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH-N  578
            CT++LNP++RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y +PH +
Sbjct  62   CTSILNPYSRVDFTAKIWICPFCYQRNHFPPHYNAISETNLPGELYPQYTTVEYHIPHTD  121

Query  579  PN  584
            PN
Sbjct  122  PN  123



>ref|XP_010270294.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=769

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ +D EGIDGVRMTWNAWPRTKVE+SKCVIP+AA+I  IRP P++ T+PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNAWPRTKVEASKCVIPLAAAISPIRPHPDIPTLPYLPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SETNVPAELYPQ+TT++Y +P NP
Sbjct  62   CACVLNPYCRVDFTAKIWICPFCFQRNHFPPHYSMISETNVPAELYPQYTTVEYVVPENP  121

Query  582  NI  587
             +
Sbjct  122  AV  123



>ref|XP_009378161.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  62   CSAVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPTD  120



>ref|XP_004502262.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502263.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Cicer 
arietinum]
Length=762

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI+ TD EG+DGVRMTWN WPR+KVE+SKCVIP+A ++++IRP P++  +PYAPLRCKT
Sbjct  2    SEIASTDPEGVDGVRMTWNVWPRSKVEASKCVIPLAVTLYVIRPHPDIPRLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH-N  578
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SET++P ELYPQ+TT++Y +PH +
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISETHLPGELYPQYTTVEYAIPHSD  121

Query  579  PN  584
            PN
Sbjct  122  PN  123



>ref|XP_009373604.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDAEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPTD  120



>ref|XP_007034166.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
 gb|EOY05092.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
Length=772

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 5/129 (4%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EG+D VRMTWN WPRTKVE+SKCVIP+AASI  IRP P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGVDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPNPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL----  569
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL    
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTLQANP  121

Query  570  -PHNPNIGP  593
             PHNP+  P
Sbjct  122  DPHNPSGAP  130



>ref|XP_010028115.1| PREDICTED: protein transport protein SEC23-like [Eucalyptus grandis]
 gb|KCW54774.1| hypothetical protein EUGRSUZ_I00719 [Eucalyptus grandis]
Length=777

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 111/135 (82%), Gaps = 5/135 (4%)
 Frame = +3

Query  219  SSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK  398
            SSE+S  D EG+DGVRM+WN WPRTKVE+SKCVIP+AA I  +RP P++ T+PYAPLRCK
Sbjct  2    SSEMSSVDPEGMDGVRMSWNVWPRTKVEASKCVIPLAACIAPLRPHPDIPTLPYAPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL---  569
            TC+AVLNP+ARVD+ A IWICPFC+QRN FP  Y+A+S+TN+P ELY Q+TTIQY+L   
Sbjct  62   TCSAVLNPYARVDFTAKIWICPFCYQRNHFPPHYAAISDTNLPGELYSQYTTIQYSLPSM  121

Query  570  -PHNPNIGPNSAAGP  611
             P+NPN  P++ A P
Sbjct  122  NPNNPN-DPHAHASP  135



>ref|XP_008337484.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=773

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+A LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  62   CSAALNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPTD  120



>ref|XP_007153808.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
 gb|ESW25802.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
Length=767

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 3/131 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELV-TVPYAPLRCK  398
            SE++QTD EG+DGVRMTWN WPRTKVE+SKCVIP+AA+I L+RP P +  T+PYAPLRCK
Sbjct  2    SEMAQTDPEGVDGVRMTWNLWPRTKVEASKCVIPLAATIALLRPHPGIPPTLPYAPLRCK  61

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC+++LNPF+RVD+ A IWICPFC+ RN FP  Y+ +SETN+PAELYPQ+TT QY L  N
Sbjct  62   TCSSILNPFSRVDFAAKIWICPFCYNRNHFPPHYAQISETNLPAELYPQYTTFQYQL--N  119

Query  579  PNIGPNSAAGP  611
             NI PN +  P
Sbjct  120  SNINPNLSHTP  130



>gb|EPS74608.1| hypothetical protein M569_00146, partial [Genlisea aurea]
Length=323

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 2/137 (1%)
 Frame = +3

Query  207  SLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAP  386
            S MA+ E++QT+ EGIDGVRMTW  WPRTKVE+SKCVIPIAASI  IRP  +L  +PY P
Sbjct  1    SSMAAPELAQTEPEGIDGVRMTWFNWPRTKVEASKCVIPIAASIQPIRPHVDLKILPYPP  60

Query  387  LRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            LRCK C+AVLNPF RVD+ A IWICPFCFQRN FP  YS++S+TN+PAELYP FT+I+++
Sbjct  61   LRCKACSAVLNPFCRVDFTACIWICPFCFQRNHFPQHYSSMSQTNLPAELYPNFTSIEFS  120

Query  567  LPHNPN--IGPNSAAGP  611
            + +  +  IGP  +  P
Sbjct  121  ISNYQSSLIGPAVSQSP  137



>ref|XP_003552491.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=766

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  +PYAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SETN+P ELYPQ+TT++Y LP + 
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISETNLPGELYPQYTTVEYILPLSN  121

Query  582  NIGPN  596
            ++ P+
Sbjct  122  SLNPS  126



>ref|XP_011084141.1| PREDICTED: protein transport protein SEC23-like [Sesamum indicum]
Length=782

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 7/135 (5%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PY PLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYPPLR  60

Query  393  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            CKTC+AVLNPF RVD+ ALIWICPFCFQRN FP  YS++S+TNVPAELYP F +I+Y++P
Sbjct  61   CKTCSAVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQTNVPAELYPNFPSIEYSIP  120

Query  573  -------HNPNIGPN  596
                   +NP + P+
Sbjct  121  NYQNPQNYNPAVAPS  135



>ref|XP_007221956.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 ref|XP_007221957.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23155.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23156.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
Length=772

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPAD  120



>ref|XP_008222792.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008222793.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=772

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRAHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+A LNPF+RVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  62   CSAALNPFSRVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPAD  120



>ref|XP_010650390.1| PREDICTED: protein transport protein SEC23-like [Vitis vinifera]
Length=771

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D EGIDGVRMTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LN
Sbjct  7    DQEGIDGVRMTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLN  66

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGPNS  599
            PF RVD+ A IWICPFCFQRN FPH YS +SE+N+P ELYPQ+TT++Y+L  NP   P+ 
Sbjct  67   PFCRVDFAAKIWICPFCFQRNHFPHHYSMISESNLPGELYPQYTTVEYSLS-NPGAVPDV  125

Query  600  AA  605
            AA
Sbjct  126  AA  127



>ref|XP_002516399.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF46016.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI+ TD EGIDGVRM+WN WPRTKVE+SKCVIP+AASI  IR  P++ T+PY+PLRCKT
Sbjct  2    SEIANTDPEGIDGVRMSWNVWPRTKVEASKCVIPLAASISPIRHHPDIPTLPYSPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            C+++LN FARVD+ A IWICPFCFQRN FP  YS +SETN+PAELYPQ+TT+QYTL
Sbjct  62   CSSILNCFARVDFTAKIWICPFCFQRNHFPPHYSMISETNLPAELYPQYTTVQYTL  117



>ref|XP_009349001.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=770

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ T+PYAPLRCKTC+
Sbjct  1    MANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRSHPDIPTLPYAPLRCKTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            AVLNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT+QY LP +
Sbjct  61   AVLNPFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPGELYPQYTTLQYALPTD  117



>ref|XP_007163794.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
 gb|ESW35788.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
Length=768

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGVDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LNPFARVD+ A IWICPFC+QRN FP  Y+A+SETN P ELYPQ+TT++Y LP + 
Sbjct  62   CSSALNPFARVDFTAKIWICPFCYQRNHFPPHYNAISETNFPGELYPQYTTVEYILPLSN  121

Query  582  NIGPN  596
            ++ P+
Sbjct  122  SLNPS  126



>ref|XP_010683601.1| PREDICTED: protein transport protein SEC23-like [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             D EGIDGVRMTWNAWPRTKVE+SKCVIPIAA+I  IR  PE+ T+PYAPLRCKTC A L
Sbjct  15   VDPEGIDGVRMTWNAWPRTKVEASKCVIPIAATISPIRANPEIPTLPYAPLRCKTCVAAL  74

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGPN  596
            NP+ RVD+ A IWICPFCFQRN FP  YS +SE NVPAELYPQ+TT+ Y+L  NP   P+
Sbjct  75   NPYCRVDFTAKIWICPFCFQRNHFPPHYSGISENNVPAELYPQYTTLAYSLSSNPG-DPH  133

Query  597  SAAG  608
            S +G
Sbjct  134  SNSG  137



>ref|XP_004296961.1| PREDICTED: protein transport protein SEC23-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ T+PYAPLRCKT
Sbjct  2    SEMANTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAACIAPIRFHTDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C+AVLNPF+RVD+ A IWICPFC+QRN FP  YS +SETN+P ELYPQ+TT+QY+LP +
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRNHFPPHYSLISETNLPGELYPQYTTVQYSLPAD  120



>ref|XP_006492989.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
Length=774

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P++ T+PYAPLRCKT
Sbjct  2    SEMASTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAASISPIRSHPDIPTLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            CTA LN FARVD+ A IWICPFC+QRN FP  Y+A+SETN+P ELYPQ+TT++Y L
Sbjct  62   CTAALNAFARVDFTAKIWICPFCYQRNHFPPHYAAISETNLPCELYPQYTTVEYIL  117



>gb|KJB37898.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=770

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  +P
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTLQPDP  121

Query  582  NIGPNSA  602
            N  P+SA
Sbjct  122  N-NPSSA  127



>ref|XP_010097955.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB73685.1| Protein transport protein SEC23 [Morus notabilis]
Length=775

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++ TD +GIDGVRMTWNAWPRTKVE+SKCVIP+AA I  IRP PE+ T+ Y PLRCKT
Sbjct  2    TEMASTDIDGIDGVRMTWNAWPRTKVEASKCVIPLAAVISPIRPHPEIATLDYYPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT--LPH  575
            C A+LNPF RVD+ A+IWICPFCFQRN FP QY  +S+TN+P EL+P +TTIQY+  LP 
Sbjct  62   CAAILNPFCRVDFTAMIWICPFCFQRNHFPPQYVGISDTNLPGELFPSYTTIQYSRALPT  121

Query  576  N  578
            N
Sbjct  122  N  122



>gb|KJB37899.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=727

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+T
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LN FARVD  A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  +P
Sbjct  62   CSAALNAFARVDLVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTLQPDP  121

Query  582  NIGPNSA  602
            N  P+SA
Sbjct  122  N-NPSSA  127



>gb|KHF97532.1| Protein transport SEC23 [Gossypium arboreum]
Length=759

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+SKCVIP+AA+I  IRP P++ T+PYAPLRC+ 
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASKCVIPLAATIAPIRPHPDIPTLPYAPLRCRM  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  +P
Sbjct  62   CSAALNAFARVDFVAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYTLQLDP  121

Query  582  NIGPNSA  602
            N  P+SA
Sbjct  122  N-NPSSA  127



>gb|EYU38948.1| hypothetical protein MIMGU_mgv1a001629mg [Erythranthe guttata]
Length=782

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            MA+ E++QTD EGI+GVRMTW  WPR+KVE+SKCVIPIAASI  IRP  +L  +PYAPLR
Sbjct  1    MAAPELAQTDPEGIEGVRMTWLNWPRSKVEASKCVIPIAASIQPIRPHVDLQILPYAPLR  60

Query  393  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            CKTC++VLNPF RVD+ ALIWICPFCFQRN FP  YS++S+TN+PAELYP F +I+Y++
Sbjct  61   CKTCSSVLNPFCRVDFTALIWICPFCFQRNHFPQHYSSISQTNMPAELYPNFPSIEYSI  119



>gb|EPS72601.1| hypothetical protein M569_02145 [Genlisea aurea]
Length=773

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            MA+ E++Q++ EGI+GVRMTW  WPRTKVE+SKCVIPIAASI  IR   +L  +PY PLR
Sbjct  1    MAAPELAQSEQEGIEGVRMTWYNWPRTKVEASKCVIPIAASIQPIRSHVDLQILPYPPLR  60

Query  393  CKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            CKTC+AVLNPF RVD+ AL+WICPFC+QRN FP  YS++S+TN+PAELYP F +I+Y++P
Sbjct  61   CKTCSAVLNPFCRVDFTALVWICPFCYQRNHFPQHYSSISQTNIPAELYPNFPSIEYSIP  120

Query  573  HNPNIGPNS  599
            +  N  P+S
Sbjct  121  NYQNHAPSS  129



>ref|XP_003538532.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=767

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EG+DGVRMTWN WPRTKVESSKCVIP+AA++ LIRP P++  + YAPLRCKT
Sbjct  2    SEMASPDPEGLDGVRMTWNVWPRTKVESSKCVIPLAATVALIRPHPDIPRLQYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LNPF+RVD+ A IWICPFC+QRN FP  Y A+SETN P ELYPQ+TT++Y LP + 
Sbjct  62   CSSALNPFSRVDFTAKIWICPFCYQRNHFPPHYHAISETNFPGELYPQYTTVEYLLPLSN  121

Query  582  NIGPN  596
            ++ P+
Sbjct  122  SLNPS  126



>ref|XP_004172995.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=332

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH--  575
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY  P   
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQYAPPQST  121

Query  576  NPNIGPNSA  602
            +PN   +SA
Sbjct  122  HPNPALDSA  130



>gb|KJB71965.1| hypothetical protein B456_011G150700 [Gossypium raimondii]
Length=771

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAVRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY L   P
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISETNLPGELYPQYTTVQYALQSFP  121

Query  582  NIGPNSAAGP  611
            +  PN++  P
Sbjct  122  D--PNNSNAP  129



>gb|KHG15352.1| Protein transport SEC23 [Gossypium arboreum]
Length=771

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGID +RMTWN WPRTKVE+SKCVIP+AASI  IRP  ++  +PYAPLRCKT
Sbjct  2    SEMANMDPEGIDAIRMTWNVWPRTKVEASKCVIPLAASIAPIRPHTDIPMLPYAPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+AVLN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY L   P
Sbjct  62   CSAVLNAFARVDFMAKIWICPFCYQRNHFPPHYAMISETNLPGELYPQYTTVQYALQSFP  121

Query  582  NIGPNSAAGP  611
            +  PN++  P
Sbjct  122  D--PNNSNAP  129



>ref|XP_008439044.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=775

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 4/134 (3%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH--  575
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY LP   
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQYALPQST  121

Query  576  --NPNIGPNSAAGP  611
              NP +  +  A P
Sbjct  122  HPNPALDSSQQANP  135



>ref|XP_010269071.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=770

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ +D EGIDGVRMTWN WPRTKVE+SKCVIPIAA+I  IR  P++  +PY PLRCKT
Sbjct  2    SEMAASDPEGIDGVRMTWNVWPRTKVEASKCVIPIAAAITPIRSHPDIPPLPYLPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            C  VLNP+ RVD+ A IWICPFCFQRN FP  YS +SE+NVPAELYPQ+TT++YT+  N
Sbjct  62   CAGVLNPYCRVDFNAKIWICPFCFQRNHFPPHYSMISESNVPAELYPQYTTVEYTVSGN  120



>ref|XP_011045698.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=775

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+PY PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLPYPPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP---  572
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SETN+PAELY Q+TTI+YTL    
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISETNLPAELYTQYTTIEYTLGDKN  121

Query  573  HNP  581
            HNP
Sbjct  122  HNP  124



>gb|KHG04907.1| Protein transport SEC23 [Gossypium arboreum]
Length=842

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  IRP  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIRPHSDIPTLPYAPLRCRTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            AVLN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  NP+
Sbjct  61   AVLNVYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTLQMNPD  119



>ref|XP_010532714.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532715.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010532716.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Tarenaya 
hassleriana]
Length=778

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%), Gaps = 5/129 (4%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP   
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISETNLPGELYPQYTTVEYTLP---  118

Query  582  NIGPNSAAG  608
               P SAAG
Sbjct  119  --SPASAAG  125



>ref|XP_006370915.1| transport family protein [Populus trichocarpa]
 gb|ERP48712.1| transport family protein [Populus trichocarpa]
Length=777

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP---  572
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SETN+PAELY Q+TTI+YT+    
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPHYSMISETNLPAELYSQYTTIEYTIGDKN  121

Query  573  HNP  581
            HNP
Sbjct  122  HNP  124



>ref|XP_011046336.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=777

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI   D EGID VRMTWN WPRTKVE+SKCVIP+AASI  IR  PE+ T+PY PLRCKT
Sbjct  2    SEIPNADPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRSNPEIPTLPYLPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP---  572
            CT+++N F+RVD+ A IWICPFCFQRN FP  YS +SETN+PAELY Q+TTI+YT+    
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCFQRNHFPPNYSMISETNLPAELYSQYTTIEYTIGDKN  121

Query  573  HNP  581
            HNP
Sbjct  122  HNP  124



>gb|KHG16267.1| Protein transport Sec23A [Gossypium arboreum]
Length=772

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PYAPLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYAPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QY+L  NP
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISETNLPCELYPQYTTVQYSLQANP  121

Query  582  N  584
            +
Sbjct  122  D  122



>gb|KJB28028.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=549

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+TN+P ELYPQ+TT+QY+L  NP
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISDTNLPCELYPQYTTVQYSLQANP  121

Query  582  N  584
            +
Sbjct  122  D  122



>emb|CDY12738.1| BnaC04g29030D [Brassica napus]
Length=736

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   E+ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSEIPSLPYAPLKCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++Y LP   
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISETNLPGELYPQYTTVEYALPSTA  121

Query  582  N-IGPNSAAGP  611
                P + A P
Sbjct  122  GQFDPRTGAAP  132



>ref|XP_010466720.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=770

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WPR+K E+SKCVIP+AASI  IR  P++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKAEASKCVIPLAASISPIRRHPDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISETNLPGELYPQYTTLEYTLP  118



>ref|XP_010532717.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Tarenaya 
hassleriana]
Length=613

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D +GIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLDGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISETNLPGELYPQYTTVEYTLP  118



>gb|KJB30033.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=494

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  NP+
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTLQTNPD  119



>ref|XP_002300208.1| transport family protein [Populus trichocarpa]
 gb|EEE85013.1| transport family protein [Populus trichocarpa]
Length=775

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SEI  TD EGID VRMTWN WPRTKVE+SKCVIP+AASI  IRP  E+ T+ Y PLRCKT
Sbjct  2    SEIPNTDPEGIDSVRMTWNNWPRTKVEASKCVIPLAASISPIRPHSEIPTLTYPPLRCKT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP---  572
            CT+++N F+RVD+ A IWICPFC+QRN FP  YS +SETN+PAELY Q+TTI+YTL    
Sbjct  62   CTSIMNCFSRVDFTAKIWICPFCYQRNHFPPHYSMISETNLPAELYSQYTTIEYTLGDKN  121

Query  573  HNP  581
            HNP
Sbjct  122  HNP  124



>ref|XP_002892293.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68552.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+TC+
Sbjct  1    MASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVDYAPLRCRTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            A LNPFARVD  A IWICP CFQRN FPH Y A+S+TNVP ELYPQ+TT++YTLP+
Sbjct  61   AALNPFARVDTHAKIWICPICFQRNHFPHHYHAISDTNVPCELYPQYTTVEYTLPN  116



>gb|KGN57237.1| hypothetical protein Csa_3G172420 [Cucumis sativus]
Length=775

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH--  575
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY  P   
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQYAPPQST  121

Query  576  NPNIGPNSA  602
            +PN   +SA
Sbjct  122  HPNPALDSA  130



>ref|XP_004147649.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=776

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM+WN WPRTKVE+SKCV+P+AASI  IR  PE+ T+PYAPLRCK+
Sbjct  2    SEMANADPEGIDGVRMSWNVWPRTKVEASKCVVPLAASIAPIRHHPEIPTLPYAPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH--  575
            C+AVLNPF+RVD+ A IWICPFC+QR  FP  Y+ +SET++P ELYPQ+TT+QY  P   
Sbjct  62   CSAVLNPFSRVDFTAKIWICPFCYQRCHFPPHYAMISETHLPGELYPQYTTVQYAPPQST  121

Query  576  NPNIGPNSA  602
            +PN   +SA
Sbjct  122  HPNPALDSA  130



>ref|XP_010512680.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010512688.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=769

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AASI  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAASISPIRRHSDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVISETNLPGELYPQYTTVEYTLP  118



>gb|KFK39665.1| hypothetical protein AALP_AA3G273400 [Arabis alpina]
Length=773

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WPR+K+E+SKCVIP+AA I  IR   ++ T+PYAPL+C+T
Sbjct  2    AETANTDQEGIDGVRMTWNVWPRSKIEASKCVIPLAACISPIRRHSDIPTLPYAPLKCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            CTA LNP+A+VD+   IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CTAALNPYAQVDFNVKIWICPFCFQRNQFPPHYHVISETNLPGELYPQYTTVEYTLP  118



>gb|KJB28027.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=772

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++ TD EGID VRMTWN WPRTKVE+S CVIP+A SI  IR  P++ T+PY+PLRCK+
Sbjct  2    SEMANTDPEGIDAVRMTWNVWPRTKVEASACVIPLAVSIAPIRSHPDIPTLPYSPLRCKS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C++ LN FARVD+ A IWICPFC+QRN FP  Y+ +S+TN+P ELYPQ+TT+QY+L  NP
Sbjct  62   CSSALNAFARVDFTAKIWICPFCYQRNHFPPHYAMISDTNLPCELYPQYTTVQYSLQANP  121

Query  582  N  584
            +
Sbjct  122  D  122



>ref|XP_010485034.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTLPN  119



>ref|NP_974544.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83386.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=620

 Score =   180 bits (456),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  383
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  384  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  564  TL  569
            TL
Sbjct  122  TL  123



>ref|XP_010527425.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
Length=624

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+TN+P ELYPQ+TT++Y LP
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISDTNLPGELYPQYTTVEYALP  118



>gb|KFK42891.1| hypothetical protein AALP_AA1G052100 [Arabis alpina]
Length=777

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPF+RVD+ A +WICP C+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFSRVDFSAKLWICPICYQRNHFPPHYHVISETNLPCELYPQYTTVEYTLPN  119



>ref|XP_010527422.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527423.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527424.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
Length=776

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR  P++ ++PYAPLRC+T
Sbjct  2    AEMANPDLEGIDGVRMTWNVWPRTKVEASKCVIPLAACISPIRRHPDIPSLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN FARVD+ A IWICPFC+QRN FP  Y  +S+TN+P ELYPQ+TT++Y LP
Sbjct  62   CSAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISDTNLPGELYPQYTTVEYALP  118



>ref|NP_563741.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAN72246.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
 gb|AEE27848.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=783

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTLPN  119



>gb|AAL08282.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
Length=783

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTLPN  119



>gb|KJB30034.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=644

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  NP+
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTLQTNPD  119



>gb|AAF79733.1|AC005106_14 T25N20.17 [Arabidopsis thaliana]
Length=811

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC+ 
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIPSVEYAPLRCRI  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETNVP ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFLAKIWICPICFQRNHFPPHYHVMSETNVPCELYPQYTTVEYTLPN  119



>ref|XP_010522277.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522278.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522279.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522280.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522281.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522282.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=780

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCV+PIAA I  IR   E+ TVPYAPLRC+T
Sbjct  2    SEMATMDPEGIDGVRMTWNFWPRTKVEASKCVVPIAACISPIRYHREIPTVPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN F RVD+   IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YT+P
Sbjct  62   CSAALNAFCRVDFTVKIWICPFCFQRNHFPPHYHMISETNLPCELYPQYTTVEYTIP  118



>ref|XP_006418018.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
 gb|ESQ36371.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
Length=780

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPR KVE+SKCVIP+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    SEMASMDPEGIDGVRMTWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ TT++YT+P
Sbjct  62   CSAALNPFARVDFTAKIWICPICFQRNHFPPHYHGISETNLPCELYPQCTTVEYTMP  118



>gb|KJB30032.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=769

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++ +D EG+DGVRMTWN WPRTK+E+SKCVIP+AASI  I P  ++ T+PYAPLRC+TC+
Sbjct  1    MANSDPEGVDGVRMTWNVWPRTKLEASKCVIPLAASIAPIPPHSDIPTLPYAPLRCRTCS  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            A LN ++RVD+ A IWICPFC+QRN FP  Y+ +SETN+P ELYPQ+TT+QYTL  NP+
Sbjct  61   AALNAYSRVDFLAKIWICPFCYQRNQFPPHYAMISETNLPCELYPQYTTVQYTLQTNPD  119



>ref|NP_193152.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAL67087.1| putative transport protein [Arabidopsis thaliana]
 gb|AAM67461.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE83387.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=772

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  383
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  384  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  564  TL  569
            TL
Sbjct  122  TL  123



>gb|AAM10394.1| AT4g14160/dl3120w [Arabidopsis thaliana]
Length=772

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  383
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  384  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  564  TL  569
            TL
Sbjct  122  TL  123



>emb|CAB10195.1| transport protein [Arabidopsis thaliana]
 emb|CAB78458.1| transport protein [Arabidopsis thaliana]
Length=769

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYAPL CKT
Sbjct  5    AKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYAPLDCKT  64

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            C A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++YTL
Sbjct  65   CKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEYTL  120



>ref|NP_849541.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83385.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=773

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  SSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYA  383
            + +   +++ + D EGIDGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P ++ +PYA
Sbjct  2    AEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPYA  61

Query  384  PLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PL CKTC A+LN FARVD+ A+ W+CPFC+ RN FP  Y ++SE N+P ELYPQ+TT++Y
Sbjct  62   PLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVEY  121

Query  564  TL  569
            TL
Sbjct  122  TL  123



>emb|CDX90271.1| BnaA08g17130D [Brassica napus]
Length=738

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++Y +P
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISETNLPGELYPQYTTVEYAIP  118



>ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61844.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
Length=769

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WPR+KVE+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPRSKVEASKCVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTLP  118



>ref|XP_006414783.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
 gb|ESQ56236.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
Length=780

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 6/129 (5%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMATMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C A LN FARVD+ A IWICPFC+QRN FP  Y  +SE N+P ELYPQ+TT++YTLP   
Sbjct  62   CEAALNAFARVDFTAKIWICPFCYQRNHFPPHYHMISENNLPGELYPQYTTVEYTLP---  118

Query  582  NIGPNSAAG  608
               P + AG
Sbjct  119  ---PTAGAG  124



>emb|CDY12077.1| BnaC03g59930D [Brassica napus]
Length=737

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E++  D EG+DGVRMTWN WPRTKVE+SKCV+P+AASI  IR   ++ ++PYAPL+C+T
Sbjct  2    AEMANMDPEGMDGVRMTWNVWPRTKVEASKCVVPLAASISPIRRHSDIPSLPYAPLKCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C AVLN FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ+TT++Y +P
Sbjct  62   CVAVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYTTVEYAIP  118



>emb|CDX86574.1| BnaC08g01290D [Brassica napus]
Length=767

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 5/130 (4%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++Y++P   
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISETNLPCELYPQYTTVEYSMP---  118

Query  582  NIGPNSAAGP  611
              GP+   GP
Sbjct  119  --GPSQPTGP  126



>ref|XP_009111051.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
 emb|CDY15544.1| BnaA08g28280D [Brassica napus]
Length=767

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 5/130 (4%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E+   D EGID VRMTWN WPR KVE+SKCV+P+AA I  IR   ++ +VPYAPLRC+T
Sbjct  2    AEMESLDPEGIDSVRMTWNVWPRNKVEASKCVVPVAACISPIRYHRDIQSVPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            C+A LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++Y++P   
Sbjct  62   CSAALNPFARVDFSAKIWICPICFQRNHFPPHYHVISETNLPCELYPQYTTVEYSMP---  118

Query  582  NIGPNSAAGP  611
              GP+   GP
Sbjct  119  --GPSQPTGP  126



>ref|XP_010457640.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010457641.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=780

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM WN WPRTKVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNFWPRTKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTLPN  119



>gb|KFK22996.1| hypothetical protein AALP_AAs50735U000600 [Arabis alpina]
Length=775

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E+  TD EGIDGVRMTWN WPRTKVE+SKCVIP+A SI  IR   ++ ++PYAPL C+T
Sbjct  2    AEMVNTDPEGIDGVRMTWNVWPRTKVEASKCVIPLAVSISPIRRHSDIPSLPYAPLLCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C A LN FARVD+Q+ IWICPFC+QR++FP  Y  +SE+N+P ELYPQ+TT++YTLP
Sbjct  62   CNAALNSFARVDFQSKIWICPFCYQRSNFPPHYHMISESNLPGELYPQYTTVEYTLP  118



>emb|CDY01197.1| BnaA04g06220D [Brassica napus]
Length=762

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN-  584
            +VLN FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ++T++Y LP     
Sbjct  61   SVLNAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYSTVEYALPSTAGQ  120

Query  585  IGPNSAAGP  611
              P + A P
Sbjct  121  FDPRTGAAP  129



>ref|XP_010475248.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRM WN WPR KVE+SKCVIP+AA I  IR   ++ +V YAPLRC++
Sbjct  2    SEMATMDPEGIDGVRMPWNVWPRNKVEASKCVIPVAACISPIRYHRDIQSVGYAPLRCRS  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            CTA LNPFARVD+ A IWICP CFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP+
Sbjct  62   CTAALNPFARVDFSAKIWICPICFQRNHFPPHYHVMSETNLPCELYPQYTTVEYTLPN  119



>ref|XP_006283156.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
 gb|EOA16054.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
Length=781

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL+C+T
Sbjct  2    ADMAYVDPEGMDGVRMTWNFWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLQCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+AVLN FARVD+ A IWICPFC+QRN+FP  Y ++SETN+P ELY  +TT++YT+P
Sbjct  62   CSAVLNCFARVDFIAKIWICPFCYQRNTFPTHYHSISETNLPGELYQHYTTVEYTIP  118



>ref|XP_009139544.1| PREDICTED: protein transport protein SEC23-like [Brassica rapa]
Length=772

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            +++ D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++ ++PYAPL+C+TC 
Sbjct  1    MAEMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHSDIPSLPYAPLKCRTCV  60

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN-  584
            +VL  FARVD+ A IWICPFCFQRN FP  Y  +S+TN+P ELYPQ++T++Y LP     
Sbjct  61   SVLTAFARVDFAAKIWICPFCFQRNPFPPHYHMISDTNLPGELYPQYSTVEYALPSTAGQ  120

Query  585  IGPNSAAGP  611
              P + A P
Sbjct  121  FDPRTGAAP  129



>ref|XP_002870333.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46592.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  425
            EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   ++  +PYAPL+C+TC AVLN F
Sbjct  6    EGMDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHSDIPDLPYAPLKCRTCVAVLNAF  65

Query  426  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ARVD+ A IWICPFC QRN FP  Y ++SE N+P ELYPQ+TT++YTLP
Sbjct  66   ARVDFNAKIWICPFCHQRNHFPVHYHSISEINLPGELYPQYTTVEYTLP  114



>ref|NP_189008.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 dbj|BAB02785.1| protein transport protein Sec23 [Arabidopsis thaliana]
 gb|AAO22730.1| putative transport protein [Arabidopsis thaliana]
 gb|AAO50656.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE76796.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=765

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTLP  118



>ref|NP_001189956.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 gb|AEE76797.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=791

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WP +K E+SKCVIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFC+QRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTLP  118



>ref|XP_006297004.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29902.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=782

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSETNLPGELYPQYTTVEYTLP  118



>ref|XP_006297005.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29903.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=812

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            +E + TD EGIDGVRMTWN WP +KVESSK VIP+AA I  IR   ++ T+PYAPLRC+T
Sbjct  2    AETAITDLEGIDGVRMTWNVWPHSKVESSKLVIPLAACISPIRRHSDIPTLPYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            C+A LN +A+VD+ A +WICPFCFQRN FP  Y  +SETN+P ELYPQ+TT++YTLP
Sbjct  62   CSAALNAYAQVDFTAKLWICPFCFQRNHFPPHYHVMSETNLPGELYPQYTTVEYTLP  118



>emb|CBI39378.3| unnamed protein product [Vitis vinifera]
Length=707

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  267  MTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQA  446
            MTWN WPRTKVE+SKCVIPIAAS+  IR  P++ T+PYAPLRCKTC ++LNPF RVD+ A
Sbjct  1    MTWNVWPRTKVEASKCVIPIAASVSPIRSHPDIPTLPYAPLRCKTCISLLNPFCRVDFAA  60

Query  447  LIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
             IWICPFCFQRN FPH YS +SE+N+P ELYPQ+TT++Y+L
Sbjct  61   KIWICPFCFQRNHFPHHYSMISESNLPGELYPQYTTVEYSL  101



>ref|XP_008785319.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785320.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785321.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=785

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAV  413
             D +G DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AV
Sbjct  16   VDPDGPDGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAV  75

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            LNPFARVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  76   LNPFARVDFAAKIWICPLCFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_010934373.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=540

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  255  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFAR  431
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            VD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSETNVPGELYPQCTTVEY  122



>ref|XP_009419583.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  231  SQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CT  407
            S TD +G DGVRMTWN+WPR+KVE+SKC++P+AAS+  IR  P LV +PYAPLRCK  C 
Sbjct  13   SSTDPDGPDGVRMTWNSWPRSKVEASKCIVPVAASVTPIRASPSLVVLPYAPLRCKPPCA  72

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            AVLNPFARVD+ A IWICP CF RN FP  Y+ +SETNVP ELYP+ TT++Y
Sbjct  73   AVLNPFARVDFAAKIWICPLCFSRNHFPPHYAGISETNVPGELYPECTTVEY  124



>ref|XP_010934372.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=782

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +3

Query  255  DGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFAR  431
            DGVRMTWNAWPR+KVE+SKCVIP+AASI  IR  P L+ +PYAPLRCK  C AVLNPFAR
Sbjct  19   DGVRMTWNAWPRSKVEASKCVIPVAASIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFAR  78

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            VD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  79   VDFAAKIWICPLCFSRNQFPPHYAAMSETNVPGELYPQCTTVEY  122



>ref|XP_009420223.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D +G DGVRMTWN+WPR+KVE+SKCV+P+AAS+  IR  P LV +PY+PLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNSWPRSKVEASKCVVPVAASVAPIRSSPSLVVLPYSPLRCKPPCAAVL  76

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            NPFARVD+ A IWICPFCF RN FP  Y+ +SE NVP ELYPQ TT++Y
Sbjct  77   NPFARVDFAAKIWICPFCFSRNHFPPHYAGISEANVPGELYPQCTTVEY  125



>ref|XP_006303716.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
 gb|EOA36614.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
Length=780

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            SE++  D EGIDGVRMTWN WPRTKVE+SKCVIP+AA I  IR   ++    YAPLRC+T
Sbjct  2    SEVASIDPEGIDGVRMTWNVWPRTKVEASKCVIPVAACISPIRYHRDIQFNNYAPLRCRT  61

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            CTA LNP+ RVD+ A IWICP CFQRN FP  Y  +SETN+  ELY Q +T++YTLP
Sbjct  62   CTAALNPYVRVDFSAKIWICPICFQRNHFPPHYHVMSETNLACELYQQCSTVEYTLP  118



>ref|XP_010908065.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Elaeis 
guineensis]
Length=754

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            NPF+RVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_010908064.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=790

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D +G DGVRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVL
Sbjct  17   DPDGPDGVRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVL  76

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            NPF+RVD+ A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  77   NPFSRVDFAAKIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_006827919.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
 gb|ERM95335.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
Length=762

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E ++GVRM+WN WPRTKV++SKCV+P+A  +  IR  PEL  +PY PLRCK+C+ VLN
Sbjct  6    EMEAVEGVRMSWNVWPRTKVDASKCVVPLATVVSPIRSLPELPVLPYPPLRCKSCSCVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            P  RVDY A IW+CPFCFQR  FP  Y  +SETNVPAEL+PQ++ I+Y+LP N
Sbjct  66   PHCRVDYAARIWVCPFCFQRTHFPIHYEGISETNVPAELFPQYSVIEYSLPSN  118



>ref|XP_010440522.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=779

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +3

Query  222  SEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT  401
            ++++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ 
Sbjct  2    ADMASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-  60

Query  402  CTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN-  578
            C+AVLN FA VDY+A IW CPFC   N+FP  Y ++++ N+P ELYPQ TT++Y +P + 
Sbjct  61   CSAVLNAFASVDYRARIWKCPFCLHTNTFPTHYHSITQDNLPGELYPQCTTVEYAVPSSV  120

Query  579  PNIG  590
            P +G
Sbjct  121  PGVG  124



>ref|XP_008791501.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=791

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFARVD  437
            VRMTWNAWPR+KVE+SKCVIP+AA I  IR  P L+ +PYAPLRCK  C AVLNPFARVD
Sbjct  24   VRMTWNAWPRSKVEASKCVIPVAACIAPIRASPSLLVLPYAPLRCKPPCAAVLNPFARVD  83

Query  438  YQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            + A IWICP CF RN FP  Y+A+SETNVP ELYPQ TT++Y
Sbjct  84   FAARIWICPICFSRNHFPPHYAAISETNVPGELYPQCTTVEY  125



>ref|XP_009414536.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414537.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=785

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAV  413
            +D +G DGVRM+WN WPR+K+E+SKCVIP+AASI  IR  P ++ +PY PLRCK  C+AV
Sbjct  13   SDPDGPDGVRMSWNNWPRSKIEASKCVIPVAASITPIRASPSVLVLPYQPLRCKPPCSAV  72

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            L+PFARVD+ A IWICP CF RN FP  Y+ +SE NVP ELYPQ TT++Y  P
Sbjct  73   LSPFARVDFAAKIWICPLCFSRNHFPPHYAGISEANVPGELYPQCTTVEYAPP  125



>ref|XP_010435181.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=776

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR   +++ + YAPLRC+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHHDILNLDYAPLRCR-CS  59

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN-PN  584
            AVLN FA VDY A IW C FC   N FP  Y +++  N+P ELYPQ TT++YT+P + P 
Sbjct  60   AVLNAFATVDYDARIWKCHFCLHTNHFPTHYRSITRDNLPGELYPQCTTVEYTVPSSVPG  119

Query  585  IG  590
            +G
Sbjct  120  VG  121



>ref|XP_009417946.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVLNPFARVD  437
            VRMTWN WPR+K+E+SKCV+P+AASI  IR  P L+ +PY PLRCK  C+AVLNPFARVD
Sbjct  22   VRMTWNNWPRSKLEASKCVVPVAASIAPIRASPSLLVLPYNPLRCKPPCSAVLNPFARVD  81

Query  438  YQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            + A IWICPFCF RN FP  Y+A+SE  VP ELYPQ TT++Y  P
Sbjct  82   FAAKIWICPFCFSRNHFPPHYAAISEAVVPGELYPQCTTVEYAPP  126



>gb|KJB72955.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=681

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>ref|XP_010450096.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=784

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 10/130 (8%)
 Frame = +3

Query  228  ISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCT  407
            ++  D EG+DGVRMTWN WPRTKVE+SKCVIP+AASI  IR  P+++ + YAPL C+ C+
Sbjct  1    MASMDPEGMDGVRMTWNVWPRTKVEASKCVIPLAASISPIRRHPDILNLDYAPLHCR-CS  59

Query  408  AVLNPFARVDYQAL--------IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            AVLN FA VD+ A         IW CPFC   N FP  Y ++S+ N+P ELYPQ TT++Y
Sbjct  60   AVLNAFATVDFSASHSASASAKIWKCPFCLHPNHFPTHYHSISQDNLPGELYPQCTTVEY  119

Query  564  TLPHN-PNIG  590
            T+P + P +G
Sbjct  120  TVPSSVPGVG  129



>ref|XP_003059046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57501.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  425
            E +DGVR++WN WP +K E++KCV+P+ A +   +P P++  VPY P+RCK C A LNP+
Sbjct  10   EAVDGVRLSWNVWPNSKAEAAKCVVPLGAVVTPRKPLPDMPVVPYDPVRCKGCAACLNPY  69

Query  426  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            ARVD+   +WICPFC+ RN FP  Y+++SETN+PAEL+P +TTI+Y L
Sbjct  70   ARVDFNGKLWICPFCYARNHFPPHYASISETNLPAELFPTYTTIEYAL  117



>gb|KJB72954.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=692

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>gb|KJB72956.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=735

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>ref|XP_010939455.1| PREDICTED: protein transport protein SEC23 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y     P+ GP
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEYE--STPDTGP  121



>gb|KJB72952.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
 gb|KJB72953.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=761

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVIPGTKQEASNCVVPVSAVYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>ref|XP_008797249.1| PREDICTED: protein transport protein sec23 isoform X2 [Phoenix 
dactylifera]
Length=709

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y     P+ GP
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEYE--STPDAGP  121



>ref|XP_010939452.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939453.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939454.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
Length=763

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAMYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y     P+ GP
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEYE--STPDTGP  121



>ref|XP_007011443.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20253.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
Length=761

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>ref|XP_010255698.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
 ref|XP_010255700.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=764

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P    +PY+PLRC+TC +VLN
Sbjct  6    DLEAQDGIRMPWNVFPGTKQEAANCVVPVSAIYTPLKPFPNXPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VDY A IWICPFCFQRN FP  Y+++SE N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDYMAKIWICPFCFQRNHFPPHYASISEDNLPAELFPQYTTIEYEAP  116



>gb|KJB78641.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78642.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=510

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P  
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSPRE  118



>ref|XP_002508348.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69606.1| predicted protein [Micromonas sp. RCC299]
Length=808

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  425
            E +DGVR++WN WP +++E+ KCV+P  A +   +  PE+  VPY P+RCK C A LNP+
Sbjct  46   EAVDGVRLSWNVWPNSRMEAQKCVVPFGALVTPRKVLPEMPVVPYDPVRCKGCAACLNPY  105

Query  426  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            ARVD+ A +WICPFC+ RN FP  Y+++SETN+PAEL+P +TTI+Y L
Sbjct  106  ARVDFNAKLWICPFCYTRNHFPQHYASISETNLPAELFPTYTTIEYQL  153



>ref|XP_002526529.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF35920.1| protein transport protein sec23, putative [Ricinus communis]
Length=761

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P +K E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGSKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y ++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYGSISDDNLPAELFPQYTTIEYETP  116



>ref|XP_008797246.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797247.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797248.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRMTWN +P TK ++  CVIP AA    ++P P    +PYAPLRC+ C ++LN
Sbjct  6    DLESQDGVRMTWNIFPGTKQDAVGCVIPTAAIYTPLKPIPNTPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY A IWICPFCFQRN FP  YS++SE N+PAEL+PQ+TTI+Y     P+ GP
Sbjct  66   PFSIVDYIAKIWICPFCFQRNHFPPHYSSISEDNLPAELFPQYTTIEYE--STPDAGP  121



>gb|KDP24898.1| hypothetical protein JCGZ_24276 [Jatropha curcas]
Length=1052

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEASNCVVPVSAMYTPIKPFPNMPILPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_009387153.1| PREDICTED: protein transport protein SEC23 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRMTWN  P TK E+  CVIP+AA    ++P P++  +PY+PLRC+ C ++LN
Sbjct  6    DLETQDGVRMTWNMLPGTKQEALGCVIPVAAIYTPLKPIPDMPVLPYSPLRCRICRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+CPFCFQRN FP  Y ++SE N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYLSISEDNLPAELFPQYTTIEY  113



>gb|EAZ07329.1| hypothetical protein OsI_29578 [Oryza sativa Indica Group]
Length=367

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>ref|XP_007011442.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20252.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
Length=998

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + EG DGVRM WN  P TK E+S CV+P++A    I+P P +  +PYAPLRC+ C +VLN
Sbjct  6    ELEGQDGVRMAWNVVPGTKQEASNCVVPVSAIYTPIKPFPNMPVLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDENLPAELFPQYTTIEYQSP  116



>gb|KJB78640.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=687

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSP  116



>ref|XP_003577593.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=787

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +3

Query  249  GIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLN  419
            G D VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PYAPLRCK  C+A+LN
Sbjct  16   GPDAVRLTWNAWPRSKVEASRCVVPLAAAISPVRCPESLASPPLPYAPLRCKPPCSALLN  75

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            PFARVDY A IWICP CF RN FP  Y+ +SE+NVPAEL+PQ +T++Y +
Sbjct  76   PFARVDYAAKIWICPLCFSRNHFPPHYAGISESNVPAELFPQCSTVEYLV  125



>gb|KJB78639.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=716

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P  
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSPRE  118



>gb|KJB78638.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=745

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSP  116



>gb|KJB78636.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=726

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P  
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSPRE  118



>ref|XP_001762459.1| predicted protein [Physcomitrella patens]
 gb|EDQ72582.1| predicted protein [Physcomitrella patens]
Length=774

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 87/128 (68%), Gaps = 6/128 (5%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAAS---IHLIRPQPELVTV-PYAPLRCKTCT  407
            D E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    V V  YAPLRC+ C 
Sbjct  6    DAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVAVLNYAPLRCRACR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNI  587
             VLNPF  VDYQA IWICPFC QRNSFPH YS++S+ NVP E++PQ TT++Y  P  P +
Sbjct  66   GVLNPFCAVDYQAKIWICPFCHQRNSFPHHYSSISDQNVPGEIWPQCTTVEYAPP--PML  123

Query  588  GPNSAAGP  611
            G      P
Sbjct  124  GSEKTFSP  131



>gb|KJB78634.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78635.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78637.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=757

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ +PYAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLPYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSP  116



>gb|EEE67142.1| hypothetical protein OsJ_24197 [Oryza sativa Japonica Group]
Length=768

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEY  113



>ref|XP_001774792.1| predicted protein [Physcomitrella patens]
 gb|EDQ60463.1| predicted protein [Physcomitrella patens]
Length=772

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAAS---IHLIRPQPELVT-VPYAPLRCKTCT  407
            + E ++G+RM+WN WP TK+++SKC IP+AA    +H   P    VT + YAPLRC+ C 
Sbjct  6    EAEAMNGIRMSWNVWPSTKLDASKCHIPLAALYTPLHGAGPHSNPVTKLNYAPLRCRACR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            +VLNPF  VDYQA IWICPFC QRNSFPH Y+++SE NVP EL+PQ TT++Y  P  P 
Sbjct  66   SVLNPFCSVDYQAKIWICPFCHQRNSFPHHYASISEQNVPGELWPQCTTVEYVPPPMPG  124



>ref|XP_002444510.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
 gb|EES14005.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
Length=763

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RMTWN  P TK +++ CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSAIYTPLKPNPSIPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IW+CPFCFQRN FP  Y+++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYNSISENNLPAELFPQYTTVEY  113



>emb|CAN81541.1| hypothetical protein VITISV_008772 [Vitis vinifera]
Length=372

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y  P +
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEYESPSD  118



>ref|XP_008375693.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=521

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_008344490.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=305

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_010097714.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB70669.1| Protein transport protein SEC23 [Morus notabilis]
Length=756

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E++ CV+P++A    I+P P +  VPY PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVLPGTKQEATSCVVPVSAIYTPIKPLPNIPVVPYGPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+ +S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFVAKIWICPFCFQRNHFPPGYATISDDNLPAELFPQYTTIEY  113



>ref|XP_004973675.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
Length=709

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE N+PAEL+PQFTT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISENNLPAELFPQFTTVEY  113



>gb|EMS65767.1| Protein transport protein SEC23 [Triticum urartu]
Length=589

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E +DG+RM WN  P TK ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  6    ELEALDGIRMPWNVIPGTKEDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+RVDY A IW+C FCFQRN FP  YS++SE N+P EL+PQ+TTI+Y
Sbjct  66   PFSRVDYSAKIWLCTFCFQRNQFPQHYSSISENNLPPELFPQYTTIEY  113



>ref|XP_010278786.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Nelumbo 
nucifera]
Length=742

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y  P +    P
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEYEAPTDKTAVP  123



>ref|XP_004973674.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
Length=763

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK ++  CV+P++A    ++P P +  +PYAPLRC+ C ++LN
Sbjct  6    DLEAQDGIRMAWNVIPGTKQDAINCVVPVSAIFTPLKPNPTIPVLPYAPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IW+CPFCFQRN FP  Y  +SE N+PAEL+PQFTT++Y
Sbjct  66   PFSVVDFVAKIWVCPFCFQRNHFPQHYYTISENNLPAELFPQFTTVEY  113



>ref|XP_010278785.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Nelumbo 
nucifera]
Length=746

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y  P +    P
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEYEAPTDKTAVP  123



>ref|XP_010278787.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Nelumbo 
nucifera]
Length=734

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y  P +    P
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEYEAPTDKTAVP  123



>ref|XP_010278782.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278783.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278784.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
Length=766

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y  P +    P
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEYEAPTDKTAVP  123



>ref|XP_010278781.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Nelumbo 
nucifera]
Length=780

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN +P TK E++ CV+P++A    ++P P +  +PY+PLRC+TC +VLN
Sbjct  6    DLEAHDGIRMPWNVFPGTKQEAASCVVPVSAIYTPLKPFPNMPVLPYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY   IWICPFCFQRN FP  Y+++S+ N+P +L+PQ+TTI+Y  P +    P
Sbjct  66   PFSTVDYMGQIWICPFCFQRNHFPPHYASISQDNLPPDLFPQYTTIEYEAPTDKTAVP  123



>ref|NP_001062030.1| Os08g0474700 [Oryza sativa Japonica Group]
 dbj|BAD09341.1| putative SEC23 [Oryza sativa Japonica Group]
 dbj|BAF23944.1| Os08g0474700 [Oryza sativa Japonica Group]
Length=763

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK +++ CV+P++A    +RP P +  +PY PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLRPNPAIPVLPYGPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>gb|KHG07260.1| Protein transport SEC23 [Gossypium arboreum]
Length=761

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK E+  CV+P++A    I+P P ++ + YAPLRC+ C++VLN
Sbjct  6    ELEAQDGVRMTWNVVPGTKEEAGNCVVPVSAIYTPIKPFPNMLVLTYAPLRCRNCSSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PF  +D+ A IWICPFCF R+ FP  Y++VSE N+PAEL+PQ+TTI+Y  P  
Sbjct  66   PFCVMDFAAKIWICPFCFHRSHFPAHYASVSEENLPAELFPQYTTIEYKSPRE  118



>ref|XP_009361354.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_007220245.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
 gb|EMJ21444.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
Length=761

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_011024746.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Populus 
euphratica]
Length=766

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VL
Sbjct  5    VELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            NPF  VD+ A +WICPFCFQRN FP  Y+A+S+ N+PAEL+ Q+TTI+Y  P 
Sbjct  65   NPFCTVDFSAKLWICPFCFQRNQFPPHYTAISDDNLPAELFSQYTTIEYEEPQ  117



>ref|XP_011024747.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Populus 
euphratica]
Length=765

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C +VL
Sbjct  5    VELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRNCRSVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            NPF  VD+ A +WICPFCFQRN FP  Y+A+S+ N+PAEL+ Q+TTI+Y  P 
Sbjct  65   NPFCTVDFSAKLWICPFCFQRNQFPPHYTAISDDNLPAELFSQYTTIEYEEPQ  117



>ref|XP_004964627.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
 ref|XP_004964628.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
 ref|XP_004964629.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Setaria 
italica]
 ref|XP_004964630.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Setaria 
italica]
 ref|XP_004964631.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Setaria 
italica]
 ref|XP_004964632.1| PREDICTED: protein transport protein SEC23-like isoform X6 [Setaria 
italica]
Length=762

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGIRMPWNVIPGTKQEALNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+CPFCFQRN FP  YS +SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSLISENNLPAELFPQYTTVEY  113



>ref|XP_008460075.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=761

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_008232223.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008232224.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=761

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYAPLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPAMPVLPYAPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_004153079.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
 gb|KGN46272.1| hypothetical protein Csa_6G078680 [Cucumis sativus]
Length=761

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_004160683.1| PREDICTED: protein transport protein SEC23-like [Cucumis sativus]
Length=761

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_004145019.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SEC23-like 
[Cucumis sativus]
Length=769

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK E+S C++P++A    I+  P +  +PY+PLRC+TC ++LN
Sbjct  6    DLEAQDGVRMPWNVVPGTKQEASNCIVPVSALYTPIKAFPNMPVLPYSPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFAAKIWICPFCFQRNHFPPHYASISDDNLPAELFPQYTTIEY  113



>ref|XP_001702936.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO96789.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=762

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  425
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASIYTPNKRLPTMPVLPYEPIPCKQCNAILNPY  66

Query  426  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ARVD+ + +WICPFC  RN FP  Y  +S+TN+PAELYP + TI+YTLP
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISDTNMPAELYPNYCTIEYTLP  115



>ref|XP_010052697.1| PREDICTED: protein transport protein SEC23 [Eucalyptus grandis]
 gb|KCW76763.1| hypothetical protein EUGRSUZ_D01124 [Eucalyptus grandis]
Length=762

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P T+ E++ CV+P++A    +RP P +  +PY+PLRC+ C +VLN
Sbjct  6    DLEAQDGVRMPWNVVPGTRQEAAGCVVPVSAVYTPLRPFPSMPVLPYSPLRCRNCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PF+ VD+ A IWICP CFQRN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P +
Sbjct  66   PFSIVDFAAKIWICPLCFQRNHFPPHYASISDDNLPAELFPQYTTIEYASPDD  118



>ref|XP_002460346.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
 gb|EER96867.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
Length=762

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK E+  CVIP++A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEVQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKSIPDIPVLPYSPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+CPFCFQRN FP  YS++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNQFPQHYSSISENNLPAELFPQYTTVEY  113



>ref|XP_002265101.1| PREDICTED: protein transport protein SEC23 [Vitis vinifera]
Length=761

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y  P +
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEYESPSD  118



>ref|XP_003578242.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=762

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E +DG+RM WN  P T+ +++ CV+P++A    ++  P +  VPY+PLRC+ C ++LN
Sbjct  6    DLEALDGIRMPWNVIPGTREDAASCVVPVSAIYTPLKSIPNVPVVPYSPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF+ VDY A IW+CPFCFQRN FP  YS++SE N+P EL+PQ TTI+Y     P  GP
Sbjct  66   PFSMVDYDAKIWLCPFCFQRNHFPQHYSSISENNLPPELFPQHTTIEYI--STPETGP  121



>gb|EAY80788.1| hypothetical protein OsI_35968 [Oryza sativa Indica Group]
Length=793

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  431
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            VD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEY  124



>emb|CBI38071.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRM WN  P TK ES++ +IP+AA    ++P P +  +PY PLRC+TC +VLN
Sbjct  6    ELEAQDGVRMPWNVIPGTKQESAQSIIPVAAIYTPLKPFPSMPVLPYTPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            PFA VD+ A +WICPFCFQRN FP  YS++S+ N+PAEL+P +TT++Y  P +
Sbjct  66   PFAIVDFSAKLWICPFCFQRNHFPAHYSSISDLNLPAELFPNYTTLEYESPSD  118



>ref|XP_011010741.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=765

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC++C ++L
Sbjct  5    VELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRSCRSIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            NPF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++  P 
Sbjct  65   NPFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEFEDPQ  117



>gb|AAX96396.1| At1g05520/T25N20_16 [Oryza sativa Japonica Group]
 gb|ABA93126.1| Sec23/Sec24 trunk domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE52049.1| hypothetical protein OsJ_33782 [Oryza sativa Japonica Group]
Length=793

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  431
            VR+TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  21   VRLTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  80

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            VD+ A IWICP CF RN FP  Y+A+SE+NVPAEL+PQ +T++Y
Sbjct  81   VDFAAKIWICPLCFSRNHFPPHYAAISESNVPAELFPQCSTVEY  124



>ref|XP_004307298.1| PREDICTED: protein transport protein SEC23 [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  VIP++A    I+P P +  +PY+PLRC+TC AVLN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESTNSVIPVSAIYTPIKPFPTMPLLPYSPLRCRTCRAVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++++ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASITDDNLPAELFPQYTTIEY  113



>ref|XP_005843379.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
 gb|EFN51277.1| hypothetical protein CHLNCDRAFT_141205 [Chlorella variabilis]
Length=466

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  210  LMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPL  389
            +M  +E +  + E IDGVRMTWN WP +++E++KCVIP        R   +L  V Y P+
Sbjct  1    MMLQAEFA--ELEEIDGVRMTWNVWPHSRLEAAKCVIPFCTLYSPARQTSQLQVVEYDPV  58

Query  390  RCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
             CKTC +VLNP+A VD+ A IW CPFC  RN FP  Y+ +SE +VPAEL+PQ+ TI+Y+L
Sbjct  59   TCKTCGSVLNPYASVDFAAKIWTCPFCHTRNHFPPHYAGISEASVPAELFPQYCTIEYSL  118

Query  570  P  572
            P
Sbjct  119  P  119



>gb|EMT27989.1| Protein transport protein sec-23 [Aegilops tauschii]
Length=932

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E +DG+RM WN  P T+ ++  CV+P++A    ++  P++  VPYAPLRC+ C ++LN
Sbjct  162  ELEALDGIRMPWNVIPGTREDAVSCVVPVSAIYTPLKSIPDMPVVPYAPLRCRMCRSILN  221

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+RVDY A IW+C FCFQRN FP  YS++SE N+P EL+PQ+TTI+Y
Sbjct  222  PFSRVDYNAKIWLCTFCFQRNQFPQHYSSISENNLPPELFPQYTTIEY  269



>ref|XP_002946892.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
 gb|EFJ52118.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
Length=764

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLNPF  425
            E IDGVR+TWN WP +K+E++KCVIP A+     +  P +  +PY P+ CK C+A+LNP+
Sbjct  7    EDIDGVRLTWNIWPNSKLEATKCVIPFASVYTPNKRLPTMPVLPYEPIPCKQCSAILNPY  66

Query  426  ARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ARVD+ + +WICPFC  RN FP  Y  +S+T++PAELYP + TI+YTLP
Sbjct  67   ARVDFYSKVWICPFCHSRNHFPAHYQGISDTSMPAELYPNYCTIEYTLP  115



>ref|XP_006375610.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
 gb|ERP53407.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
Length=765

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++L
Sbjct  5    VELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            NPF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++  P 
Sbjct  65   NPFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEFEDPQ  117



>ref|XP_002320574.1| transport family protein [Populus trichocarpa]
 gb|EEE98889.1| transport family protein [Populus trichocarpa]
Length=773

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E  DGVRM WN  P TK ESS CV+P++A    I+P P +  +PY+PLRC+ C ++L
Sbjct  5    VELEAQDGVRMPWNVLPGTKQESSNCVVPVSAIYTPIKPFPNMPVLPYSPLRCRACRSIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH  575
            NPF  VD+ A IWICPFCFQRN FP  Y+++S+ N+PAEL+ Q+TTI++  P 
Sbjct  65   NPFCTVDFSAKIWICPFCFQRNQFPPHYASISDDNLPAELFSQYTTIEFEDPQ  117



>ref|XP_006659495.1| PREDICTED: protein transport protein SEC23-like [Oryza brachyantha]
Length=763

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DG+RM WN  P TK +++ CV+P++A    ++P P +  +PY PLRC+ C ++LN
Sbjct  6    ELEAQDGIRMPWNVIPGTKQDAANCVVPVSAIYTPLKPNPVIPVLPYGPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF  VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT+++
Sbjct  66   PFCVVDYVAKIWVCPFCFQRNHFPQHYSSISESNLPAELFPQYTTVEF  113



>ref|XP_009376310.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>ref|XP_008344985.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=761

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES+  V+P++A    I+P P +  +PYA LRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQESTNSVVPVSAIYTPIKPFPSMPVLPYAALRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IWICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y
Sbjct  66   PFSTVDYAAKIWICPFCFTRNHFPPHYASISDENLPAELFPQYTTIEY  113



>gb|EEC82002.1| hypothetical protein OsI_25948 [Oryza sativa Indica Group]
Length=768

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P T+ ++  CV+PI+A    ++  P++  +PY+PLRC+ C ++LN
Sbjct  6    DLEAQDGIRMPWNVIPGTREDALSCVVPISAIYTPLKQVPDIPVLPYSPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+CPFCFQRN FP  YS++SE+N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCPFCFQRNHFPQLYSSISESNLPAELFPQYTTVEY  113



>gb|KDO85352.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=470

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>ref|XP_008668489.1| PREDICTED: uncharacterized protein LOC100384491 isoform X1 [Zea 
mays]
Length=895

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +3

Query  171  FVCI----YLYYIARSSLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASI  338
            F+C+     L  + +++++  SE    D E  DG+RM WN  P TK E+  CVIP++A  
Sbjct  114  FLCLTCGSLLQLLYKAAVLKMSEF--LDLELQDGIRMPWNVIPGTKQETVNCVIPVSAIY  171

Query  339  HLIRPQPELVTVPYAPLRCKTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSET  518
              ++P  ++  +PY+PLRC+ C ++LNPF+ VDY A IW+C FCFQRN FP  YS++SE 
Sbjct  172  TPLKPISDIPVLPYSPLRCRMCRSILNPFSIVDYVAKIWVCSFCFQRNQFPQHYSSISEN  231

Query  519  NVPAELYPQFTTIQY  563
            N+PAEL+PQ+TT++Y
Sbjct  232  NLPAELFPQYTTVEY  246



>tpg|DAA40251.1| TPA: hypothetical protein ZEAMMB73_365624 [Zea mays]
Length=724

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RM WN  P TK E+  CVIP++A    ++P  ++  +PY+PLRC+ C ++LN
Sbjct  6    DLELQDGIRMPWNVIPGTKQETVNCVIPVSAIYTPLKPISDIPVLPYSPLRCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VDY A IW+C FCFQRN FP  YS++SE N+PAEL+PQ+TT++Y
Sbjct  66   PFSIVDYVAKIWVCSFCFQRNQFPQHYSSISENNLPAELFPQYTTVEY  113



>ref|XP_003626854.1| Protein transport protein SEC23 [Medicago truncatula]
 gb|AET01330.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=763

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC ++LN
Sbjct  7    DLETQDGVRMPWNVIPGTKQESVNVVVPVAAIYTPIKHFPTMPILPYSPLRCRTCRSILN  66

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF  VD+ A IWICPFCFQRN FP+ Y+++SE N+PAEL+PQ+TT++Y
Sbjct  67   PFCIVDFAAKIWICPFCFQRNHFPNHYASISEDNMPAELFPQYTTVEY  114



>gb|KDO85351.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=561

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>ref|XP_002461253.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
 gb|EER97774.1| hypothetical protein SORBIDRAFT_02g043632 [Sorghum bicolor]
Length=219

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DG+RMTWN  P TK +++ CV+P++     ++P   +  +PYAPL C+ C ++LN
Sbjct  6    DLETQDGIRMTWNVIPGTKQDATNCVVPVSVIYTPLKPNLSIPVLPYAPLSCRMCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ A IW+C FCFQRN FP  Y+++ E N+PAEL+PQ+TT++Y
Sbjct  66   PFSVVDFVAKIWVCSFCFQRNHFPQHYNSILENNLPAELFPQYTTVEY  113



>dbj|BAJ93511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=614

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C A+LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRAILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+  D+ + +W+CPFCFQRN FP QYS VS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFNSKMWLCPFCFQRNHFPQQYSTVSQSNLPTELYPECCTVEY  113



>ref|XP_004510207.1| PREDICTED: protein transport protein SEC23-like [Cicer arietinum]
Length=762

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             D E  DGVRM WN  P TK ES   V+P+AA    I+  P +  +PY+PLRC+TC +VL
Sbjct  5    VDLESQDGVRMPWNVIPGTKQESLNVVVPVAAIYTPIKHFPSMPLLPYSPLRCRTCRSVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP  581
            NPF  VD+ A IWICP CFQRN FP  Y+++S+ N+PAEL+PQ+TT++Y  P +P
Sbjct  65   NPFCIVDFAAKIWICPICFQRNHFPPHYASISDENLPAELFPQYTTVEYDSPGDP  119



>ref|XP_006445524.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
 gb|ESR58764.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
Length=683

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>gb|KDO85350.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=701

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>ref|XP_006464334.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
 gb|KDO85348.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=769

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>gb|EMS46122.1| Protein transport protein SEC23 [Triticum urartu]
Length=720

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAMYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+  D+ + +W+CPFCFQRN FP QYSAVS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQSNLPTELYPECCTVEY  113



>gb|KDO85349.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=762

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQP----ELVTVPYAPLRCKTCT  407
            D E  DGVRM WN  P TK E+S CV+P++A    I+  P     +  +PYAPLRC+TC 
Sbjct  6    DLEAQDGVRMPWNVIPGTKQEASNCVVPVSAIYTPIKAFPVNNNSMPILPYAPLRCRTCR  65

Query  408  AVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            ++LNPF+ VD+ A IWICPFCFQRN FP  Y+++++ N+PAEL+PQ+TTI+Y  P
Sbjct  66   SILNPFSIVDFAAKIWICPFCFQRNHFPPHYASITDDNLPAELFPQYTTIEYEPP  120



>gb|EMT03462.1| Protein transport protein SEC23 [Aegilops tauschii]
Length=829

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DGVRMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEARDGVRMTWNVIPGTKQDAASCVVPVSAIYTPLNPNPAIPVLPYAPLRCRICRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+  D+ + +W+CPFCFQRN FP QYSAVS++N+P ELYP+  T++Y
Sbjct  66   PFSVADFGSKMWLCPFCFQRNHFPQQYSAVSQSNLPTELYPECCTVEY  113



>dbj|BAJ85358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  431
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            VD+ A IWICP CF RN FP  Y+ +SE NVPAEL+ Q +T++Y +
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISENNVPAELFTQCSTVEYLV  125



>dbj|BAK01218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +3

Query  261  VRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVT--VPYAPLRCKT-CTAVLNPFAR  431
            VR TWNAWPR+KVE+S+CV+P+AA+I  +R    L +  +PY PLRCK  C+A+LNPFAR
Sbjct  20   VRFTWNAWPRSKVEASRCVVPLAAAISPVRSPESLASPPLPYPPLRCKPPCSALLNPFAR  79

Query  432  VDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            VD+ A IWICP CF RN FP  Y+ +SE NVPAEL+ Q +T++Y +
Sbjct  80   VDFAAKIWICPLCFSRNHFPPHYAGISENNVPAELFTQCSTVEYLV  125



>ref|XP_002102257.1| GD19805 [Drosophila simulans]
 gb|EDX11760.1| GD19805 [Drosophila simulans]
Length=156

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



>ref|XP_010691934.1| PREDICTED: protein transport protein SEC23 [Beta vulgaris subsp. 
vulgaris]
Length=769

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ESS  VIP++     I+  P L  +PY+PLRC++C ++LN
Sbjct  6    DLETQDGVRMPWNVIPGTKQESSNSVIPVSLLYTPIKSFPNLPILPYSPLRCRSCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ +D+   +WICPFCF RN FP  Y+++S+ N+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSVIDFAGKVWICPFCFNRNHFPQHYASISDDNLPAELFPQYTTIEYEPP  116



>ref|XP_002982254.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
 gb|EFJ16499.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
Length=756

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  413
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            LNPF  VD+   IW+CPF F RN FP  YS +SE+ +P ELY QFTTI+Y  P +  + P
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSESYLPGELYQQFTTIEYAPPGDRGLPP  124



>ref|XP_002966180.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
 gb|EFJ32207.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
Length=756

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRP--QPELVTVPYAPLRCKTCTAV  413
            + E  DG+RM+WN WP ++VE ++CV+P AA I  ++P  QPE V + Y PLRC+TC A+
Sbjct  6    EIEAADGIRMSWNVWPSSRVEMARCVVPPAAVISPLQPLAQPEAV-LQYPPLRCRTCRAI  64

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            LNPF  VD+   IW+CPF F RN FP  YS +SE+ +P ELY QFTTI+Y  P +  + P
Sbjct  65   LNPFCSVDFAGKIWVCPFDFSRNQFPPHYSELSESYLPGELYQQFTTIEYAPPGDRGLPP  124



>ref|XP_006854134.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
 gb|ERN15601.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
Length=762

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DG+RM WN WP TK E+S CVIP +A    + P P L  +PY PLRC+TC ++LN
Sbjct  6    ELEAQDGIRMPWNVWPGTKPEASACVIPTSAIYTPLNPNPNLPLLPYQPLRCRTCRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY-TLPHNPNIG  590
            PFA VD+QA IW CPFC+QRN FP  Y+++++TN+PAEL+PQ+TT++Y TL  +P +G
Sbjct  66   PFAIVDFQAKIWACPFCYQRNHFPPHYASITDTNLPAELFPQYTTVEYETL--DPGVG  121



>ref|XP_002986965.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
 gb|EFJ12047.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
Length=763

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVLN
Sbjct  5    EIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVLN  63

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN-----PN  584
            P+  VDY A IW CPFC QRN FP  Y+ VSE+N+PAELYP ++T++Y +P       P+
Sbjct  64   PYCNVDYTARIWGCPFCLQRNYFPGNYAGVSESNLPAELYPTYSTVEYVIPQKGFGGFPS  123

Query  585  IGPN-SAAGP  611
            +G   S +GP
Sbjct  124  VGSGFSLSGP  133



>ref|XP_002977937.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
 gb|EFJ21275.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
Length=763

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  +G+R  WNAWP +++++++ V+P     +++ P P+L  +PY P+RCK C AVLN
Sbjct  5    EIEATEGLRWVWNAWPTSRIDAARMVVPFGIMANVLMPLPDLPVLPYQPVRCK-CQAVLN  63

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIG-PN  596
            P+  VDY A IW CPFC QRN FP  Y+ VSE+N+PAELYP ++T++Y +P     G P+
Sbjct  64   PYCNVDYTARIWGCPFCLQRNYFPGNYAGVSESNLPAELYPTYSTVEYVIPQKGFGGFPS  123

Query  597  SAAG  608
            + +G
Sbjct  124  AGSG  127



>ref|XP_010235206.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Brachypodium 
distachyon]
Length=722

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
             F+ VD+ + IW CPFCFQRN FP  YS VS +N+P ELYPQ TT++Y
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVSASNLPTELYPQCTTVEY  113



>ref|XP_003574621.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Brachypodium 
distachyon]
Length=763

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  DG+RMTWN  P TK +++ CV+P++A    + P P +  +PYAPLRC+ C ++LN
Sbjct  6    ELEAQDGIRMTWNVIPGTKQDAASCVVPVSALYTPLYPNPAIPVLPYAPLRCRICRSILN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
             F+ VD+ + IW CPFCFQRN FP  YS VS +N+P ELYPQ TT++Y
Sbjct  66   SFSVVDFDSKIWQCPFCFQRNHFPQHYSTVSASNLPTELYPQCTTVEY  113



>ref|XP_008224182.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=782

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R  WN+WP +K ES+  VIP++     +  Q EL  +PY P+ C+ C AVLN
Sbjct  5    ELEAIEGLRWCWNSWPASKTESTDLVIPLSIMCTPLMQQAELPVLPYDPVTCRQCGAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP--NIGP  593
            P+ARV+Y + IW C FC  +NSFPH YS + ETN+PAEL+P ++ ++Y    NP  N GP
Sbjct  65   PYARVEYTSRIWFCSFCLHKNSFPHSYSNIGETNLPAELFPTYSAVEYAKTANPVANSGP  124

Query  594  N  596
            N
Sbjct  125  N  125



>emb|CCO26910.1| Protein transport protein SEC23 [Rhizoctonia solani AG-1 IB]
Length=151

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DGVR++WN WP +++E+++ V+PIAA    ++ + +L  V Y P+ CK  C A+L
Sbjct  5    DVEERDGVRLSWNVWPSSRIEATRTVVPIAALYTPLKQREDLPPVLYEPVTCKPPCRAIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  65   NPYCQIDVRGKLWICPFCLQRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  115



>ref|XP_009629158.1| PREDICTED: protein transport protein SEC23 [Nicotiana tomentosiformis]
Length=764

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPQNYQSISETNMPAELFPQYTTIEYESP  117



>ref|XP_003521007.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=767

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ++   V+PI+A    I+  P +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFPSMPVLNYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            PF  VD+ A IWICPFCFQRN FP  YS++S+ ++PAEL+PQ+TT++Y    +  +GP
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISDDSLPAELFPQYTTVEYN--SDAAVGP  121



>gb|KDP40275.1| hypothetical protein JCGZ_02273 [Jatropha curcas]
Length=787

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R +WNAWP TK E +  VIP+      +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKNEVTSLVIPLGIMCTPLMQSLELPILPYEPLTCTRCGAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            P+ARVDYQ+ IW CPFC+Q+N+FP  YS + ETN+PAEL+P ++T++Y L
Sbjct  65   PYARVDYQSRIWSCPFCYQKNTFPISYSGIGETNLPAELFPTYSTVEYKL  114



>ref|XP_004229519.1| PREDICTED: protein transport protein SEC23 [Solanum lycopersicum]
Length=764

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  D VRM WN  P +K E+++CVIP++A    ++P P+  T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPDTPTLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPPSYQSISETNMPAELFPQYTTIEYETP  117



>gb|EPX71940.1| GTPase activating protein Sec23a [Schizosaccharomyces octosporus 
yFS286]
Length=760

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            + E  DG+R TWNA+P T++ESS+ ++PI+A    + P+P+L  V Y P+ CK  C A+L
Sbjct  5    EIEERDGIRFTWNAFPSTRIESSRTIVPISALYKPLNPRPDLPPVLYEPVTCKAPCKAIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            NPF  +D +A  WICPFC QRN  P QY  VS T++P EL P+F+TI+YTLP  P + P
Sbjct  65   NPFCHLDTRAKFWICPFCLQRNMLPPQYKDVSSTSLPLELLPEFSTIEYTLPRPPQLPP  123



>gb|EPY49891.1| GTPase activating protein Sec23a [Schizosaccharomyces cryophilus 
OY26]
Length=762

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            + E  DG+R TWNA+P T++ESS+ ++PI+A    + P+P+L  V Y P+ CK  C A+L
Sbjct  5    EIEERDGIRFTWNAFPSTRIESSRTIVPISALYKPLNPRPDLPPVLYEPVTCKAPCKAIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            NPF  +D +A  WICPFC QRN  P QY  VS T++P EL P+F+TI+YTLP  P + P
Sbjct  65   NPFCHLDTRAKFWICPFCLQRNMLPPQYKDVSSTSLPLELLPEFSTIEYTLPRPPQLPP  123



>ref|XP_009800228.1| PREDICTED: protein transport protein SEC23 [Nicotiana sylvestris]
Length=764

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY  563
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPQNYQSISETNMPAELFPQYTTIEY  114



>ref|XP_780042.1| PREDICTED: protein transport protein Sec23A isoform 1 [Strongylocentrotus 
purpuratus]
Length=764

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            MA+ E  + + E  DGVR +WN WP +++E+++ V+P++A    ++ +P+L  + Y P+ 
Sbjct  1    MANYEFIRQNEER-DGVRFSWNVWPSSRLEATRMVVPLSALYTPLKERPDLPPIQYDPVL  59

Query  393  CK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C   TC AVLNPF +VDY+A +W C FCFQRN FP+QY  +SE + PAEL PQFTTI+YT
Sbjct  60   CSRSTCRAVLNPFCQVDYRAKLWNCNFCFQRNQFPNQYRGISEQHQPAELIPQFTTIEYT  119

Query  567  LPHNP  581
            L   P
Sbjct  120  LTRAP  124



>ref|XP_001774442.1| predicted protein [Physcomitrella patens]
 gb|EDQ60805.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIR-------PQPELVTVPYAPLRCK  398
            + E   GVRM WNAWP T++E++KC +P AA +  +          P +  +PY PLRCK
Sbjct  7    EVEAATGVRMPWNAWPNTQIEAAKCAVPFAAVVTPLHHGGGADSTAPPVNVLPYPPLRCK  66

Query  399  TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN  578
            TC AVLNPF RVD+ A IWICPFC+QR  FP  Y+++S  N P ELYPQ  +++Y +   
Sbjct  67   TCRAVLNPFCRVDFDAKIWICPFCYQRCHFPSHYASISLNNQPGELYPQCASVEYKMAGE  126

Query  579  PNIGP  593
              + P
Sbjct  127  AGLPP  131



>ref|XP_008482918.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec23B 
[Diaphorina citri]
Length=604

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRC--KTCTAVLN  419
            E  DG+R TWN WP +K+E+S+ V+P+      ++ +P+L  + Y PL C    C A+LN
Sbjct  12   EERDGIRCTWNVWPSSKLEASRLVMPVGCLYQPLKEKPDLPPLQYEPLLCMRNQCRAILN  71

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            P  +VDY++ +W+C FCFQRN+FP QY+A++E + PAEL+PQFTTI+YT+P
Sbjct  72   PLCQVDYKSKLWVCNFCFQRNAFPPQYAAITEQHQPAELHPQFTTIEYTIP  122



>ref|XP_007225252.1| hypothetical protein PRUPE_ppa001670mg [Prunus persica]
 gb|EMJ26451.1| hypothetical protein PRUPE_ppa001670mg [Prunus persica]
Length=782

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R  WN+WP +K ES+  VIP++     +  Q EL  +PY P+ C+ C AVLN
Sbjct  5    ELEAIEGLRWCWNSWPASKTESTDLVIPLSIMCTPLMQQAELPVLPYDPVTCRQCGAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNP--NIGP  593
            P+ARV+Y + IW C FC  +NSFPH YS + E N+PAEL+P ++ ++Y    NP  N GP
Sbjct  65   PYARVEYTSRIWFCSFCLHKNSFPHSYSNIGEANLPAELFPTYSAVEYAKTANPVTNSGP  124

Query  594  N  596
            N
Sbjct  125  N  125



>ref|XP_009101771.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
Length=740

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 84/124 (68%), Gaps = 1/124 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R TWN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWTWNSWPTTKSDCESLVVPLSIMYTPLMRFSELPTIPYDPLICSRCAAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGPNS  599
            P+ARVDY++ IW CPFCF +N FP  Y+ ++ETN+PAEL+P ++ ++Y+ P +  + P S
Sbjct  65   PYARVDYRSRIWACPFCFHKNPFPRSYAGITETNLPAELFPTYSAVEYSPPTD-GVAPWS  123

Query  600  AAGP  611
            A GP
Sbjct  124  APGP  127



>ref|XP_011030584.1| PREDICTED: protein transport protein sec23-1 [Populus euphratica]
Length=794

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R +WNAWP TK + S  +IP++     +    EL  +PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNAWPTTKKQVSTLIIPLSIMCTPLMQSTELPILPYDPLICTRCAAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPH-NPNIGPN  596
            P+ARVDYQ+ IW+CPFC+ RN FP  Y  + ETN+PAEL+P ++T++Y +   +P    N
Sbjct  65   PYARVDYQSRIWVCPFCYNRNPFPSSYLGIGETNLPAELFPTYSTVEYKIDKVDPKFRSN  124

Query  597  SAAG  608
            S  G
Sbjct  125  SHLG  128



>ref|XP_010149983.1| PREDICTED: protein transport protein Sec23A-like, partial [Eurypyga 
helias]
Length=227

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAV  413
            + E  DGVR +WN WP +++E+++ V+P+AA    ++ +P+L  + Y P+ C   TC AV
Sbjct  10   ENEDRDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAV  69

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNI  587
            LNP  +VDY+A +W C FC+QRN FP  Y+ +SE N PAEL PQF++I+Y +   P +
Sbjct  70   LNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISEMNQPAELLPQFSSIEYVVQRGPQM  127



>ref|XP_006354587.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E  D VRM WN  P +K E+++CVIP++A    ++P P   T+PYAPLRC+ C +VLN
Sbjct  6    ELETQDAVRMPWNVLPGSKSEAAQCVIPVSAIYTPLKPFPNTPTLPYAPLRCRNCRSVLN  65

Query  420  PFARVDYQAL-IWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLP  572
            PF+ VD+ +  IWIC FC QRN FP  Y ++SETN+PAEL+PQ+TTI+Y  P
Sbjct  66   PFSIVDFSSTKIWICCFCLQRNHFPPSYQSISETNMPAELFPQYTTIEYESP  117



>dbj|BAM19569.1| protein transport protein sec23, partial [Papilio xuthus]
Length=190

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            MA+ E      E  DG+R TWN WP + +E++  V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MATYEEFIQQNEDRDGIRFTWNVWPSSXIETTXLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C   TC A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRNTCRAILNPMCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPNFSTIEYT  120

Query  567  LPHNPNIGP  593
            +    ++ P
Sbjct  121  ITRAQSMPP  129



>gb|KIJ06392.1| hypothetical protein PAXINDRAFT_103385, partial [Paxillus involutus 
ATCC 200175]
Length=137

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DGVR++WN WP +++E+++ V+PI+A    +R + +L  V Y P+ CK  C A+L
Sbjct  6    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYTPLRQREDLPPVLYEPVTCKPPCRAIL  65

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            NP+ ++D +  +WICPFC  RN+FP  Y  +S TN+PAEL P++TTI+YTL
Sbjct  66   NPYCQIDIRGKLWICPFCLSRNAFPPHYKDISNTNLPAELLPKYTTIEYTL  116



>ref|XP_010495646.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=489

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCESLVVPLSIMYTPLMHFSELPTIPYDPLICSRCGAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++Y  P   +
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEYAPPQRKS  119



>emb|CCA74741.1| probable SEC23-component of COPII coat of ER-golgi vesicles [Piriformospora 
indica DSM 11827]
Length=766

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DG+R++WNAWP +++E+++ V+PIAA    ++ + +L  V Y P+ CK  C AVL
Sbjct  5    DVEERDGLRLSWNAWPSSRIEATRTVVPIAALYTPLKQREDLPPVLYEPVTCKPPCRAVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            NP+ ++D +A +WICPFC  RNSFP  Y  +S+ N+PAELYP++TTI+YTL
Sbjct  65   NPYCQIDVRAKLWICPFCLTRNSFPAHYKDISQANLPAELYPKYTTIEYTL  115



>ref|XP_011091114.1| PREDICTED: protein transport protein SEC23 [Sesamum indicum]
Length=788

 Score =   130 bits (326),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
            ++ EGI+G+R +W++WP +K E +  V+P++     + P  EL  +PY PL C  C AVL
Sbjct  4    SELEGIEGLRWSWHSWPISKPEVASLVVPLSIMCTPLTPFSELPILPYEPLNCSQCAAVL  63

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIG  590
            NP++RVDY + IW+C FC+++N FP  Y+ ++E N+PAEL+P ++T++Y L   P  G
Sbjct  64   NPYSRVDYVSKIWVCSFCYRKNPFPRSYAHINENNIPAELFPTYSTVEYHLGTGPASG  121



>ref|XP_008042194.1| copii coat protein [Trametes versicolor FP-101664 SS1]
 gb|EIW54810.1| copii coat protein [Trametes versicolor FP-101664 SS1]
Length=763

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DGVR++WN WP +++E+++ V+PI+A    ++P+ +L  + Y P+ CK  C AVL
Sbjct  5    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYAPLKPREDLPEILYEPVTCKPPCRAVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+P+EL P+FTTI+YTL     + P
Sbjct  65   NPYCQIDIRGKLWICPFCLQRNAFPPHYKDISNTNLPSELLPKFTTIEYTLSRGAAVPP  123



>ref|XP_007660591.1| PREDICTED: protein transport protein Sec23A-like, partial [Ornithorhynchus 
anatinus]
Length=126

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  207  SLMASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAP  386
             +MA+        E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P
Sbjct  3    KIMATYLEFIQQNEERDGVRFSWNVWPSSRLEATRLVVPLACLLTPLKERPDLPPVQYEP  62

Query  387  LRCK--TCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQ  560
            + C   TC AVLNP  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+
Sbjct  63   VLCSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIE  122

Query  561  YTL  569
            Y +
Sbjct  123  YIV  125



>gb|KIM24219.1| hypothetical protein M408DRAFT_331867 [Serendipita vermifera 
MAFF 305830]
Length=771

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DG+R++WNAWP T++E+++ V+PI+A    ++ + +L  V Y P+ CK  C AVL
Sbjct  5    DVEERDGLRLSWNAWPATRIEATRTVVPISALYSPLKQREDLPPVLYDPVTCKPPCRAVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            NP+ ++D +  +WICPFC  RNSFP  Y  +S TN+PAELYP++TTI+YTL
Sbjct  65   NPYCQIDVRGKLWICPFCLTRNSFPAHYKDISSTNMPAELYPKYTTIEYTL  115



>gb|ABQ12917.1| Sec23 (S. cerevisiae) homolog B [Bos taurus]
Length=140

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAV  413
              E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P+ C   TC A+
Sbjct  10   QNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAI  69

Query  414  LNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            LNP  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+Y +
Sbjct  70   LNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYVI  121



>ref|XP_002173747.1| GTPase activating protein Sec23a [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB07454.1| GTPase activating protein Sec23a [Schizosaccharomyces japonicus 
yFS275]
Length=762

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            + E  DG+R TWN +P T++ESS+ V+PIAA    +  +P+L  V Y P+ CK  C A+L
Sbjct  5    EIEERDGIRFTWNVFPSTRIESSRAVVPIAAMYKPLNERPDLPPVLYDPVACKAPCRAIL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            NP+  +D +A  WICPFC QRN  P QY  +S T++P EL PQ+TTI+YTLP  P + P
Sbjct  65   NPYCHIDIRAKFWICPFCLQRNMLPPQYKDISNTSLPLELMPQYTTIEYTLPRPPQLYP  123



>emb|CAB81549.1| putative Sec23 protein [Drosophila melanogaster]
Length=769

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRC--KTCTAVLN  419
            E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ C    C A+LN
Sbjct  12   EDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVLCTRSNCRAILN  71

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            P  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT+   P + P
Sbjct  72   PLCQVDYRAKLWVCNFCFQRNQFPPQYAAISEQHQPAELIPGFSTIEYTITRAPTMPP  129



>ref|XP_008477629.1| PREDICTED: protein transport protein Sec23A-like, partial [Diaphorina 
citri]
Length=711

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DG+R TWN WP +K+E+S+ V+P+      ++ +P+L  + Y PL 
Sbjct  1    MTTYEEFFYQNEERDGIRCTWNVWPSSKLEASRLVMPVGCLYQPLKEKPDLPPLQYEPLL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY++ +W+C FCFQRN+FP QY+A++E + PAEL+PQFTTI+YT
Sbjct  61   CMRNQCRAILNPLCQVDYKSKLWVCNFCFQRNAFPPQYAAITEQHQPAELHPQFTTIEYT  120

Query  567  LP  572
            +P
Sbjct  121  IP  122


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +3

Query  330  ASIHLIRPQPELVTVPYAPLRC--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYS  503
            A  HLI     L  + Y PL C    C A+LNP  +VDY++ +W+C FCFQRN+FP QY+
Sbjct  150  AITHLINQVGNLPPLQYEPLLCMRNQCRAILNPLCQVDYKSKLWVCNFCFQRNAFPPQYA  209

Query  504  AVSETNVPAELYPQFTTIQYTLP  572
            A++E + PAEL+PQFTTI+YT+P
Sbjct  210  AITEQHQPAELHPQFTTIEYTIP  232



>ref|XP_011279270.1| PREDICTED: protein transport protein Sec23B-like [Felis catus]
Length=164

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +3

Query  246  EGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCK--TCTAVLN  419
            E  DGVR +WN WP +++E+++ V+P+A  +  ++ +P+L  V Y P+ C   TC A+LN
Sbjct  12   EERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAILN  71

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            P  +VDY+A +W C FCFQRN FP  Y+ +SE N PAEL PQF+TI+Y +
Sbjct  72   PLCQVDYRAKLWACNFCFQRNQFPPAYTGISEVNQPAELMPQFSTIEYVI  121



>emb|CDY22339.1| BnaA06g36610D [Brassica napus]
Length=740

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 1/124 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R TWN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWTWNSWPTTKPDCESLVVPLSIMYTPLMRFSELPTIPYDPLICSRCAAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGPNS  599
            P+ARVDY++ IW CPFCF +N FP  Y+ ++ETN+PAEL+P ++ ++Y+ P +  + P S
Sbjct  65   PYARVDYRSRIWACPFCFHKNPFPRSYAGITETNLPAELFPTYSAVEYSPPTD-GVAPWS  123

Query  600  AAGP  611
            + GP
Sbjct  124  SPGP  127



>ref|XP_010481838.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=788

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R +WN+WP TK +    V+P++     +    EL T+PY PL C  C AVLN
Sbjct  5    ELEAIEGLRWSWNSWPTTKSDCEFLVVPLSIMYTPLMQFSELPTIPYDPLICSRCGAVLN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPN  584
            P+ARVDYQ+ IW CPFCF +N FP  YS ++ETN+PAEL+P ++ ++YT P   +
Sbjct  65   PYARVDYQSRIWSCPFCFHKNHFPRSYSGITETNLPAELFPTYSAVEYTPPQRKS  119



>ref|XP_009396065.1| PREDICTED: protein transport protein sec23-1 [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R  WNAWP ++ +++  V+P++     + P P+L  +PY PL C +C A LN
Sbjct  5    ELEAIEGLRWPWNAWPPSRSDAAALVVPLSVMCSPLMPLPDLPVLPYEPLLCASCRAALN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHN--PNIGP  593
            P+ARVDY++ +W CPFC  +N FP  Y+ + E N+PAEL+P ++T++Y L  N  PN GP
Sbjct  65   PYARVDYRSALWTCPFCSHKNPFPRTYAGIGENNLPAELFPTYSTVEYALARNPRPNPGP  124

Query  594  NSAAG  608
                G
Sbjct  125  RGGFG  129



>gb|KHN32738.1| Protein transport protein SEC23 [Glycine soja]
Length=765

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            D E  DGVRM WN  P TK ++   V+PI+A    I+    +  + Y+PLRC+TC +VLN
Sbjct  6    DLESQDGVRMPWNVIPGTKQDAQNAVVPISAVYTPIKHFTSMPLLNYSPLRCRTCRSVLN  65

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGPNS  599
            PF  VD+ A IWICPFCFQRN FP  YS++S+ ++PAEL+PQ+TT++Y   ++  +GP +
Sbjct  66   PFCIVDFAAKIWICPFCFQRNHFPPHYSSISDDSLPAELFPQYTTVEY---NSDAVGPTN  122



>ref|XP_010274198.1| PREDICTED: protein transport protein Sec23A [Nelumbo nucifera]
Length=792

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = +3

Query  237  TDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVL  416
             + E I+G+R +WN+WP +K E+S  VIP++     +    EL  +PY PL C  C AVL
Sbjct  4    VELEAIEGLRWSWNSWPASKSEASSLVIPLSVMCTPLMEFTELPLLPYDPLVCSRCGAVL  63

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQY-----TLPHNP  581
            NP+ARVDYQ+ +W+CPFC+Q+N FP  Y+ + E N+PAEL+P ++T++Y      L    
Sbjct  64   NPYARVDYQSRLWVCPFCYQKNPFPRSYAGIGENNLPAELFPTYSTVEYHHGRKGLGLGS  123

Query  582  NIGPNSAAG  608
            NI  N+  G
Sbjct  124  NINSNAIWG  132



>gb|AAN71374.1| RE35250p [Drosophila melanogaster]
Length=773

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRTPTMPP  129



>ref|XP_002517022.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF45185.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKTCTAVLN  419
            + E I+G+R +WN+WP  K E+S   IP++     +    EL  +PY PL C  C A+LN
Sbjct  5    ELESIEGLRWSWNSWPTRKNEASSLTIPLSIMCTPLMQSSELPILPYEPLTCTRCFAILN  64

Query  420  PFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTL  569
            P+ARVDYQ+ IW+CPFC+Q+N+FP  YS + ETN+PAEL+P ++T++Y  
Sbjct  65   PYARVDYQSRIWVCPFCYQKNTFPISYSGIGETNLPAELFPTYSTVEYKF  114



>ref|XP_007370480.1| hypothetical protein DICSQDRAFT_183604 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF56800.1| hypothetical protein DICSQDRAFT_183604 [Dichomitus squalens LYAD-421 
SS1]
Length=763

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +3

Query  240  DTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLRCKT-CTAVL  416
            D E  DGVR++WN WP +++E+++ V+PI+A    I+ + +L  + Y P+ CK  C AVL
Sbjct  5    DVEERDGVRLSWNVWPSSRIEATRTVVPISALYTPIKVREDLPEILYEPITCKPPCRAVL  64

Query  417  NPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYTLPHNPNIGP  593
            NP+ ++D +  +WICPFC QRN+FP  Y  +S TN+P+EL P+FTTI+YTL     + P
Sbjct  65   NPYCQIDIRGKLWICPFCLQRNAFPPHYKDISNTNLPSELLPKFTTIEYTLSRGATVPP  123



>ref|NP_730978.1| Sec23 ortholog, isoform A [Drosophila melanogaster]
 ref|NP_730979.1| Sec23 ortholog, isoform B [Drosophila melanogaster]
 ref|NP_001262294.1| Sec23 ortholog, isoform G [Drosophila melanogaster]
 ref|NP_001287184.1| Sec23 ortholog, isoform H [Drosophila melanogaster]
 gb|AAF51978.2| Sec23 ortholog, isoform A [Drosophila melanogaster]
 gb|AAF51979.2| Sec23 ortholog, isoform B [Drosophila melanogaster]
 gb|AGB95677.1| Sec23 ortholog, isoform G [Drosophila melanogaster]
 gb|AHN57183.1| Sec23 ortholog, isoform H [Drosophila melanogaster]
Length=773

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



>ref|NP_001246933.1| Sec23 ortholog, isoform F [Drosophila melanogaster]
 ref|NP_001246934.1| Sec23 ortholog, isoform D [Drosophila melanogaster]
 gb|AFH06252.1| Sec23 ortholog, isoform F [Drosophila melanogaster]
 gb|AFH06253.1| Sec23 ortholog, isoform D [Drosophila melanogaster]
Length=780

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



>ref|XP_002098055.1| GE10151 [Drosophila yakuba]
 gb|EDW97767.1| GE10151 [Drosophila yakuba]
Length=773

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



>ref|XP_001978970.1| GG12978 [Drosophila erecta]
 gb|EDV47928.1| GG12978 [Drosophila erecta]
Length=773

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



>ref|NP_001246932.1| Sec23 ortholog, isoform E [Drosophila melanogaster]
 gb|AFH06251.1| Sec23 ortholog, isoform E [Drosophila melanogaster]
Length=781

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  213  MASSEISQTDTEGIDGVRMTWNAWPRTKVESSKCVIPIAASIHLIRPQPELVTVPYAPLR  392
            M + E      E  DGVR+TWN WP +++E+S+ V+P+A     ++ +P+L  + Y P+ 
Sbjct  1    MTTYEEFIQQNEDRDGVRLTWNVWPSSRIEASRLVVPLACLYQPLKERPDLPPIQYEPVL  60

Query  393  C--KTCTAVLNPFARVDYQALIWICPFCFQRNSFPHQYSAVSETNVPAELYPQFTTIQYT  566
            C    C A+LNP  +VDY+A +W+C FCFQRN FP QY+A+SE + PAEL P F+TI+YT
Sbjct  61   CTRSNCRAILNPLCQVDYRAKLWVCNFCFQRNPFPPQYAAISEQHQPAELIPGFSTIEYT  120

Query  567  LPHNPNIGP  593
            +   P + P
Sbjct  121  ITRAPTMPP  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230