BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS119C06

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009348751.1|  PREDICTED: serine/threonine-protein kinase S...    337   3e-112   Pyrus x bretschneideri [bai li]
ref|XP_002530676.1|  Serine/threonine-protein kinase ASK1, putative     336   6e-112   Ricinus communis
gb|KDP38831.1|  hypothetical protein JCGZ_04988                         336   6e-112   Jatropha curcas
ref|XP_002269221.1|  PREDICTED: serine/threonine-protein kinase S...    336   8e-112   Vitis vinifera
ref|XP_008218556.1|  PREDICTED: serine/threonine-protein kinase S...    335   9e-112   Prunus mume [ume]
emb|CAN78793.1|  hypothetical protein VITISV_028464                     335   1e-111   Vitis vinifera
ref|XP_008361703.1|  PREDICTED: serine/threonine-protein kinase S...    335   1e-111   
emb|CBI29763.3|  unnamed protein product                                335   1e-111   Vitis vinifera
ref|XP_011464827.1|  PREDICTED: serine/threonine-protein kinase S...    334   3e-111   Fragaria vesca subsp. vesca
dbj|BAN15745.1|  subfamily 2 of SNF1-related protein kinase             335   3e-111   Dianthus caryophyllus [carnation]
gb|KJB79236.1|  hypothetical protein B456_013G038800                    334   3e-111   Gossypium raimondii
gb|KJB47470.1|  hypothetical protein B456_008G027800                    330   5e-111   Gossypium raimondii
gb|ABG81507.1|  serine/threonine protein kinase                         334   5e-111   Camellia sinensis [black tea]
ref|XP_007222266.1|  hypothetical protein PRUPE_ppa007946mg             333   6e-111   Prunus persica
ref|XP_010242684.1|  PREDICTED: serine/threonine-protein kinase S...    333   7e-111   Nelumbo nucifera [Indian lotus]
ref|NP_001274892.1|  serine/threonine-protein kinase SRK2B-like         333   7e-111   Solanum tuberosum [potatoes]
ref|XP_004230475.1|  PREDICTED: serine/threonine-protein kinase S...    333   7e-111   Solanum lycopersicum
ref|XP_010242685.1|  PREDICTED: serine/threonine-protein kinase S...    332   8e-111   
ref|XP_008339496.1|  PREDICTED: serine/threonine-protein kinase S...    333   8e-111   
ref|XP_011087723.1|  PREDICTED: serine/threonine-protein kinase S...    333   9e-111   Sesamum indicum [beniseed]
gb|KJB47469.1|  hypothetical protein B456_008G027800                    329   1e-110   Gossypium raimondii
ref|XP_011092341.1|  PREDICTED: serine/threonine-protein kinase S...    333   1e-110   Sesamum indicum [beniseed]
gb|KJB47472.1|  hypothetical protein B456_008G027800                    332   2e-110   Gossypium raimondii
ref|XP_008347910.1|  PREDICTED: serine/threonine-protein kinase S...    332   2e-110   
ref|XP_011028282.1|  PREDICTED: serine/threonine-protein kinase S...    330   2e-110   Populus euphratica
gb|KDO50084.1|  hypothetical protein CISIN_1g0187342mg                  325   3e-110   Citrus sinensis [apfelsine]
emb|CDO97575.1|  unnamed protein product                                332   4e-110   Coffea canephora [robusta coffee]
gb|EYU35455.1|  hypothetical protein MIMGU_mgv1a008963mg                332   4e-110   Erythranthe guttata [common monkey flower]
gb|KDO58728.1|  hypothetical protein CISIN_1g029037mg                   325   4e-110   Citrus sinensis [apfelsine]
ref|XP_006847010.1|  hypothetical protein AMTR_s00017p00148890          332   4e-110   
gb|ACJ84339.1|  unknown                                                 325   4e-110   Medicago truncatula
gb|KJB47468.1|  hypothetical protein B456_008G027800                    331   5e-110   Gossypium raimondii
ref|XP_011028283.1|  PREDICTED: serine/threonine-protein kinase S...    332   5e-110   Populus euphratica
ref|XP_009355252.1|  PREDICTED: serine/threonine-protein kinase S...    331   6e-110   Pyrus x bretschneideri [bai li]
ref|XP_007042267.1|  SNF1-related protein kinase 2.10 isoform 2         330   9e-110   
ref|XP_006384983.1|  kinase family protein                              330   1e-109   
gb|ACU17547.1|  unknown                                                 323   2e-109   Glycine max [soybeans]
gb|KDO58729.1|  hypothetical protein CISIN_1g029037mg                   324   2e-109   Citrus sinensis [apfelsine]
gb|ACN33610.1|  unknown                                                 330   2e-109   Zea mays [maize]
ref|NP_001149107.1|  LOC100282729                                       330   2e-109   Zea mays [maize]
ref|XP_008781505.1|  PREDICTED: serine/threonine-protein kinase S...    329   3e-109   Phoenix dactylifera
emb|CAE54588.1|  serin/threonine protein kinase                         329   3e-109   Fagus sylvatica
ref|XP_010101152.1|  Serine/threonine-protein kinase SAPK7              329   3e-109   Morus notabilis
ref|XP_007042266.1|  SNF1-related protein kinase 2.10 isoform 1         332   4e-109   
ref|XP_003531593.1|  PREDICTED: serine/threonine-protein kinase S...    329   4e-109   Glycine max [soybeans]
ref|XP_006384982.1|  hypothetical protein POPTR_0004s22790g             329   5e-109   
gb|AGT16073.1|  serine/threonine-protein kinase                         323   5e-109   Saccharum hybrid cultivar R570
ref|XP_006431824.1|  hypothetical protein CICLE_v10001672mg             328   7e-109   Citrus clementina [clementine]
ref|XP_006471015.1|  PREDICTED: serine/threonine-protein kinase S...    328   7e-109   Citrus sinensis [apfelsine]
emb|CAA06503.1|  protein kinase                                         328   7e-109   Craterostigma plantagineum
gb|KGN54829.1|  hypothetical protein Csa_4G515040                       328   8e-109   
ref|XP_004156012.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    328   1e-108   
ref|XP_002325309.2|  hypothetical protein POPTR_0019s00790g             328   1e-108   Populus trichocarpa [western balsam poplar]
gb|AFK33547.1|  unknown                                                 328   1e-108   Medicago truncatula
ref|XP_008783426.1|  PREDICTED: serine/threonine-protein kinase S...    324   1e-108   
ref|XP_010065455.1|  PREDICTED: serine/threonine-protein kinase S...    328   1e-108   Eucalyptus grandis [rose gum]
ref|XP_008442077.1|  PREDICTED: serine/threonine-protein kinase S...    328   1e-108   Cucumis melo [Oriental melon]
ref|XP_004146378.1|  PREDICTED: serine/threonine-protein kinase S...    328   1e-108   Cucumis sativus [cucumbers]
ref|XP_003592980.1|  Serine/threonine protein kinase                    327   1e-108   Medicago truncatula
ref|XP_009776074.1|  PREDICTED: serine/threonine-protein kinase S...    328   1e-108   Nicotiana sylvestris
ref|XP_011001254.1|  PREDICTED: serine/threonine-protein kinase S...    327   2e-108   Populus euphratica
gb|ACG50011.1|  SnRK2.7                                                 327   2e-108   Zea mays [maize]
ref|XP_007159914.1|  hypothetical protein PHAVU_002G278200g             327   2e-108   Phaseolus vulgaris [French bean]
gb|AID23890.1|  sucrose non-fermenting 1-related protein kinase 2       327   2e-108   Gossypium hirsutum [American cotton]
ref|XP_007148531.1|  hypothetical protein PHAVU_006G216400g             327   2e-108   Phaseolus vulgaris [French bean]
gb|AGT16423.1|  hypothetical protein SHCRBa_145_O09_R_60                327   3e-108   Saccharum hybrid cultivar R570
ref|XP_003540159.1|  PREDICTED: serine/threonine-protein kinase S...    327   3e-108   Glycine max [soybeans]
gb|EPS60016.1|  hypothetical protein M569_14789                         327   3e-108   Genlisea aurea
gb|KHN45467.1|  Serine/threonine-protein kinase SRK2B                   327   3e-108   Glycine soja [wild soybean]
ref|XP_010533957.1|  PREDICTED: serine/threonine-protein kinase S...    327   3e-108   Tarenaya hassleriana [spider flower]
ref|XP_006426422.1|  hypothetical protein CICLE_v10025965mg             327   3e-108   Citrus clementina [clementine]
ref|XP_006466196.1|  PREDICTED: serine/threonine-protein kinase S...    327   3e-108   Citrus sinensis [apfelsine]
ref|XP_010930862.1|  PREDICTED: serine/threonine-protein kinase S...    327   3e-108   Elaeis guineensis
ref|XP_003630417.1|  Serine/threonine protein kinase                    327   3e-108   
gb|AET04893.2|  sucrose non-fermenting-like kinase 2 family protein     327   4e-108   Medicago truncatula
ref|XP_009602813.1|  PREDICTED: serine/threonine-protein kinase S...    326   4e-108   Nicotiana tomentosiformis
ref|XP_006652300.1|  PREDICTED: serine/threonine-protein kinase S...    327   4e-108   Oryza brachyantha
ref|XP_004156033.1|  PREDICTED: serine/threonine-protein kinase S...    325   5e-108   
ref|XP_002267922.1|  PREDICTED: serine/threonine-protein kinase S...    326   5e-108   Vitis vinifera
gb|KHN17430.1|  Serine/threonine-protein kinase SAPK7                   326   5e-108   Glycine soja [wild soybean]
ref|NP_001052827.1|  Os04g0432000                                       326   5e-108   
ref|NP_001242600.1|  uncharacterized protein LOC100804018               326   5e-108   
ref|XP_004975639.1|  PREDICTED: serine/threonine-protein kinase S...    326   5e-108   Setaria italica
ref|XP_004503865.1|  PREDICTED: serine/threonine-protein kinase S...    326   6e-108   Cicer arietinum [garbanzo]
ref|NP_001236743.1|  protein kinase 3                                   326   6e-108   Glycine max [soybeans]
gb|AIO02852.1|  phloem small RNA-binding protein kinase 1               326   7e-108   Cucurbita maxima [Boston marrow]
ref|XP_003579766.1|  PREDICTED: serine/threonine-protein kinase S...    326   8e-108   
gb|KJB71410.1|  hypothetical protein B456_011G121900                    325   8e-108   Gossypium raimondii
ref|XP_009104154.1|  PREDICTED: serine/threonine-protein kinase S...    325   9e-108   Brassica rapa
gb|EMS63561.1|  Serine/threonine-protein kinase SAPK7                   326   1e-107   Triticum urartu
ref|XP_011097123.1|  PREDICTED: serine/threonine-protein kinase S...    325   1e-107   Sesamum indicum [beniseed]
ref|XP_008783425.1|  PREDICTED: serine/threonine-protein kinase S...    325   1e-107   Phoenix dactylifera
ref|XP_008449831.1|  PREDICTED: serine/threonine-protein kinase S...    325   2e-107   Cucumis melo [Oriental melon]
gb|AIZ68211.1|  serine/threonine-protein kinase SAPK7                   325   2e-107   Ornithogalum longebracteatum [sea-onion]
gb|EMT04089.1|  Serine/threonine-protein kinase SAPK7                   325   2e-107   
ref|XP_004144354.1|  PREDICTED: serine/threonine-protein kinase S...    325   2e-107   Cucumis sativus [cucumbers]
gb|EEC73377.1|  hypothetical protein OsI_07615                          325   2e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_006392094.1|  hypothetical protein EUTSA_v10023544mg             325   2e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010030125.1|  PREDICTED: serine/threonine-protein kinase S...    325   2e-107   Eucalyptus grandis [rose gum]
ref|NP_001047099.1|  Os02g0551100                                       325   2e-107   
ref|XP_010547458.1|  PREDICTED: serine/threonine-protein kinase S...    324   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_004952838.1|  PREDICTED: serine/threonine-protein kinase S...    328   3e-107   
ref|XP_002453967.1|  hypothetical protein SORBIDRAFT_04g022410          324   3e-107   Sorghum bicolor [broomcorn]
ref|XP_009621087.1|  PREDICTED: serine/threonine-protein kinase S...    324   4e-107   Nicotiana tomentosiformis
ref|XP_009804586.1|  PREDICTED: serine/threonine-protein kinase S...    324   4e-107   Nicotiana sylvestris
ref|XP_002303162.2|  hypothetical protein POPTR_0003s01110g             324   4e-107   Populus trichocarpa [western balsam poplar]
gb|ACG33803.1|  serine/threonine-protein kinase SAPK6                   324   4e-107   Zea mays [maize]
ref|NP_001136796.1|  uncharacterized LOC100216941                       324   5e-107   Zea mays [maize]
ref|XP_007049928.1|  Kinase superfamily protein isoform 3               323   5e-107   Theobroma cacao [chocolate]
ref|XP_009148434.1|  PREDICTED: serine/threonine-protein kinase S...    323   5e-107   Brassica rapa
gb|AFW62592.1|  putative snRK/SAPK family protein kinase                323   5e-107   
ref|XP_006647363.1|  PREDICTED: serine/threonine-protein kinase S...    324   7e-107   Oryza brachyantha
ref|XP_010675155.1|  PREDICTED: serine/threonine-protein kinase S...    323   8e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004485476.1|  PREDICTED: serine/threonine-protein kinase S...    323   8e-107   Cicer arietinum [garbanzo]
gb|AFK42326.1|  unknown                                                 322   1e-106   Lotus japonicus
emb|CAE54075.1|  serine/threonine-protein kinase                        323   1e-106   Fagus sylvatica
gb|KDP25157.1|  hypothetical protein JCGZ_24259                         323   1e-106   Jatropha curcas
ref|XP_010911872.1|  PREDICTED: serine/threonine-protein kinase S...    323   1e-106   Elaeis guineensis
ref|XP_004503013.1|  PREDICTED: serine/threonine-protein kinase S...    323   1e-106   Cicer arietinum [garbanzo]
ref|XP_007049927.1|  Kinase superfamily protein isoform 2               322   1e-106   
emb|CDY34860.1|  BnaA09g47860D                                          322   1e-106   Brassica napus [oilseed rape]
gb|AAA33004.1|  serine/threonine protein kinase                         322   1e-106   Brassica napus [oilseed rape]
gb|ADP24128.1|  serine/threonine protein kinase                         322   1e-106   Brassica napus [oilseed rape]
ref|XP_011009381.1|  PREDICTED: serine/threonine-protein kinase S...    317   1e-106   Populus euphratica
ref|XP_009118223.1|  PREDICTED: serine/threonine-protein kinase S...    322   2e-106   Brassica rapa
ref|XP_006305167.1|  hypothetical protein CARUB_v10009533mg             319   2e-106   
ref|XP_006417402.1|  hypothetical protein EUTSA_v10007985mg             322   2e-106   Eutrema salsugineum [saltwater cress]
gb|AFK42988.1|  unknown                                                 322   2e-106   Lotus japonicus
gb|AFK36100.1|  unknown                                                 320   2e-106   Medicago truncatula
emb|CDY19332.1|  BnaC05g08410D                                          324   2e-106   Brassica napus [oilseed rape]
gb|KFK43389.1|  hypothetical protein AALP_AA1G119700                    322   3e-106   Arabis alpina [alpine rockcress]
gb|AFK47198.1|  unknown                                                 322   4e-106   Medicago truncatula
ref|XP_006300518.1|  hypothetical protein CARUB_v10020517mg             322   4e-106   Capsella rubella
ref|XP_010492159.1|  PREDICTED: serine/threonine-protein kinase S...    321   5e-106   Camelina sativa [gold-of-pleasure]
ref|XP_002892611.1|  hypothetical protein ARALYDRAFT_888390             321   5e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_006305166.1|  hypothetical protein CARUB_v10009533mg             321   5e-106   Capsella rubella
ref|XP_010025673.1|  PREDICTED: serine/threonine-protein kinase S...    321   6e-106   Eucalyptus grandis [rose gum]
ref|XP_009399177.1|  PREDICTED: serine/threonine-protein kinase S...    321   6e-106   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY20973.1|  BnaA08g25520D                                          321   6e-106   Brassica napus [oilseed rape]
ref|NP_172563.1|  serine/threonine-protein kinase SRK2A                 321   6e-106   Arabidopsis thaliana [mouse-ear cress]
gb|ACN35772.1|  unknown                                                 321   6e-106   Zea mays [maize]
ref|NP_001105274.1|  uncharacterized protein LOC542190                  321   6e-106   Zea mays [maize]
ref|XP_010458473.1|  PREDICTED: serine/threonine-protein kinase S...    321   6e-106   
ref|XP_009144406.1|  PREDICTED: serine/threonine-protein kinase S...    320   8e-106   Brassica rapa
gb|ABK25003.1|  unknown                                                 323   9e-106   Picea sitchensis
gb|AAA33003.1|  serine/threonine protein kinase                         320   9e-106   Brassica napus [oilseed rape]
gb|KEH35656.1|  sucrose non-fermenting-like kinase 2 family protein     320   1e-105   Medicago truncatula
ref|XP_011009382.1|  PREDICTED: serine/threonine-protein kinase S...    320   1e-105   Populus euphratica
ref|XP_003575110.1|  PREDICTED: serine/threonine-protein kinase S...    320   1e-105   
ref|XP_009406104.1|  PREDICTED: serine/threonine-protein kinase S...    320   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIZ68209.1|  serine/threonine-protein kinase SAPK7-like protein      320   2e-105   Ornithogalum longebracteatum [sea-onion]
ref|XP_010473290.1|  PREDICTED: serine/threonine-protein kinase S...    320   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010418041.1|  PREDICTED: serine/threonine-protein kinase S...    320   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010912491.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    319   3e-105   
emb|CDP20535.1|  unnamed protein product                                318   4e-105   Coffea canephora [robusta coffee]
ref|XP_010546285.1|  PREDICTED: serine/threonine-protein kinase S...    318   5e-105   
gb|KJB79237.1|  hypothetical protein B456_013G038800                    318   5e-105   Gossypium raimondii
ref|XP_010430082.1|  PREDICTED: serine/threonine-protein kinase S...    319   5e-105   Camelina sativa [gold-of-pleasure]
gb|KDO49173.1|  hypothetical protein CISIN_1g017936mg                   313   5e-105   Citrus sinensis [apfelsine]
ref|XP_010475982.1|  PREDICTED: serine/threonine-protein kinase S...    319   5e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006384384.1|  kinase SPK-3 family protein                        318   6e-105   
ref|XP_009384226.1|  PREDICTED: serine/threonine-protein kinase S...    318   6e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397730.1|  PREDICTED: serine/threonine-protein kinase S...    318   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32410.1|  hypothetical protein B456_005G239800                    314   7e-105   Gossypium raimondii
gb|AAM67112.1|  putative serine/threonine-protein kinase                318   9e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852955.1|  hypothetical protein AMTR_s00033p00242600          318   9e-105   Amborella trichopoda
ref|NP_176290.1|  SNF1-related protein kinase 2.10                      318   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526896.1|  PREDICTED: serine/threonine-protein kinase S...    317   1e-104   Glycine max [soybeans]
gb|KHN09673.1|  Serine/threonine-protein kinase SRK2A                   317   1e-104   Glycine soja [wild soybean]
ref|NP_001238298.1|  protein kinase                                     317   1e-104   Glycine max [soybeans]
gb|KDO49171.1|  hypothetical protein CISIN_1g017936mg                   313   1e-104   Citrus sinensis [apfelsine]
gb|KHN31217.1|  Serine/threonine-protein kinase SRK2A                   317   1e-104   Glycine soja [wild soybean]
gb|KJB12210.1|  hypothetical protein B456_002G006900                    317   1e-104   Gossypium raimondii
ref|XP_008784212.1|  PREDICTED: serine/threonine-protein kinase S...    317   1e-104   Phoenix dactylifera
ref|XP_007049926.1|  Kinase superfamily protein isoform 1               317   1e-104   
gb|KJB32411.1|  hypothetical protein B456_005G239800                    316   1e-104   Gossypium raimondii
gb|KDO49172.1|  hypothetical protein CISIN_1g017936mg                   313   2e-104   Citrus sinensis [apfelsine]
emb|CDY03768.1|  BnaC01g28850D                                          325   2e-104   
ref|XP_001769324.1|  predicted protein                                  316   2e-104   
dbj|BAH56941.1|  AT5G63650                                              316   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547692.1|  PREDICTED: serine/threonine-protein kinase S...    317   3e-104   Tarenaya hassleriana [spider flower]
ref|XP_009150418.1|  PREDICTED: serine/threonine-protein kinase S...    317   3e-104   Brassica rapa
ref|XP_009602316.1|  PREDICTED: serine/threonine-protein kinase S...    317   3e-104   Nicotiana tomentosiformis
gb|AAM65503.1|  serine/threonine-protein kinase                         316   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001777278.1|  predicted protein                                  316   4e-104   
ref|XP_010263754.1|  PREDICTED: serine/threonine-protein kinase S...    317   4e-104   Nelumbo nucifera [Indian lotus]
dbj|BAE99712.1|  serine/threonine-protein kinase                        317   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201170.1|  serine/threonine-protein kinase SRK2H                 316   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866567.1|  serine/threonine-protein kinase                    316   4e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_008792700.1|  PREDICTED: serine/threonine-protein kinase S...    316   5e-104   Phoenix dactylifera
emb|CDX97923.1|  BnaA06g06740D                                          316   6e-104   
gb|KDO79323.1|  hypothetical protein CISIN_1g0178602mg                  311   6e-104   Citrus sinensis [apfelsine]
ref|XP_006394252.1|  hypothetical protein EUTSA_v10004481mg             316   6e-104   Eutrema salsugineum [saltwater cress]
ref|XP_009388929.1|  PREDICTED: serine/threonine-protein kinase S...    316   6e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO49170.1|  hypothetical protein CISIN_1g017936mg                   313   6e-104   Citrus sinensis [apfelsine]
gb|KDO49168.1|  hypothetical protein CISIN_1g017936mg                   315   6e-104   Citrus sinensis [apfelsine]
emb|CEO16426.1|  sucrose non-fermenting 1-related protein kinase ...    315   6e-104   Marchantia polymorpha
gb|KDO79324.1|  hypothetical protein CISIN_1g0178602mg                  310   6e-104   Citrus sinensis [apfelsine]
ref|XP_001778501.1|  predicted protein                                  315   6e-104   
emb|CDY72554.1|  BnaAnng41460D                                          313   7e-104   Brassica napus [oilseed rape]
gb|ABR16094.1|  unknown                                                 315   8e-104   Picea sitchensis
emb|CDX84430.1|  BnaC03g50700D                                          315   8e-104   
ref|XP_010255130.1|  PREDICTED: serine/threonine-protein kinase S...    316   8e-104   Nelumbo nucifera [Indian lotus]
gb|KDO49169.1|  hypothetical protein CISIN_1g017936mg                   313   8e-104   Citrus sinensis [apfelsine]
ref|XP_009404984.1|  PREDICTED: serine/threonine-protein kinase S...    315   9e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG25553.1|  Serine/threonine-protein kinase SRK2E                   315   9e-104   Gossypium arboreum [tree cotton]
gb|KJB32409.1|  hypothetical protein B456_005G239800                    315   9e-104   Gossypium raimondii
emb|CDY34668.1|  BnaC08g42270D                                          315   9e-104   Brassica napus [oilseed rape]
ref|XP_010484120.1|  PREDICTED: serine/threonine-protein kinase S...    315   9e-104   Camelina sativa [gold-of-pleasure]
ref|XP_004290308.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Fragaria vesca subsp. vesca
ref|XP_010941849.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Elaeis guineensis
ref|XP_010444281.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010526938.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Tarenaya hassleriana [spider flower]
emb|CDP02466.1|  unnamed protein product                                315   1e-103   Coffea canephora [robusta coffee]
ref|XP_010909986.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Elaeis guineensis
ref|XP_010460858.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011099217.1|  PREDICTED: serine/threonine-protein kinase S...    315   1e-103   
gb|EYU44364.1|  hypothetical protein MIMGU_mgv1a009037mg                315   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_006412293.1|  hypothetical protein EUTSA_v10025907mg             312   2e-103   
gb|ACU23651.1|  unknown                                                 314   2e-103   Glycine max [soybeans]
ref|XP_006280694.1|  hypothetical protein CARUB_v10026657mg             315   2e-103   Capsella rubella
ref|XP_002886574.1|  hypothetical protein ARALYDRAFT_475237             315   2e-103   
ref|XP_009780712.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-103   Nicotiana sylvestris
ref|XP_009403694.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006423077.1|  hypothetical protein CICLE_v10028703mg             314   2e-103   Citrus clementina [clementine]
ref|XP_006480145.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-103   Citrus sinensis [apfelsine]
gb|KDO49166.1|  hypothetical protein CISIN_1g017936mg                   315   2e-103   Citrus sinensis [apfelsine]
ref|XP_006283988.1|  hypothetical protein CARUB_v10005110mg             315   2e-103   Capsella rubella
ref|XP_004505181.1|  PREDICTED: serine/threonine-protein kinase S...    315   2e-103   Cicer arietinum [garbanzo]
ref|XP_007042345.1|  Kinase superfamily protein isoform 2               315   2e-103   
ref|XP_009774098.1|  PREDICTED: serine/threonine-protein kinase S...    314   3e-103   Nicotiana sylvestris
ref|XP_007042344.1|  Kinase superfamily protein isoform 1               315   3e-103   Theobroma cacao [chocolate]
ref|XP_008236629.1|  PREDICTED: serine/threonine-protein kinase S...    314   3e-103   Prunus mume [ume]
emb|CAN62745.1|  hypothetical protein VITISV_025025                     314   3e-103   Vitis vinifera
ref|XP_002521837.1|  Serine/threonine-protein kinase SAPK10, puta...    314   3e-103   Ricinus communis
ref|XP_006288056.1|  hypothetical protein CARUB_v10001287mg             311   4e-103   
ref|XP_009379612.1|  PREDICTED: serine/threonine-protein kinase S...    314   4e-103   
ref|XP_006583766.1|  PREDICTED: serine/threonine-protein kinase S...    311   5e-103   
pdb|3UJG|A  Chain A, Crystal Structure Of Snrk2.6 In Complex With...    313   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031021.2|  serine/threonine-protein kinase SRK2A              314   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398292.1|  PREDICTED: serine/threonine-protein kinase S...    314   5e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006423078.1|  hypothetical protein CICLE_v10028703mg             313   5e-103   Citrus clementina [clementine]
emb|CAA19877.1|  protein kinase-like protein                            313   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284959.1|  PREDICTED: serine/threonine-protein kinase S...    313   6e-103   Vitis vinifera
ref|XP_010423046.1|  PREDICTED: serine/threonine-protein kinase S...    313   7e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011088303.1|  PREDICTED: serine/threonine-protein kinase S...    313   7e-103   Sesamum indicum [beniseed]
ref|XP_008339244.1|  PREDICTED: serine/threonine-protein kinase S...    313   7e-103   
ref|XP_010452877.1|  PREDICTED: serine/threonine-protein kinase S...    313   7e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010432490.1|  PREDICTED: serine/threonine-protein kinase S...    313   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_003529248.1|  PREDICTED: serine/threonine-protein kinase S...    313   8e-103   Glycine max [soybeans]
ref|XP_010691013.1|  PREDICTED: serine/threonine-protein kinase S...    313   8e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_567945.1|  calcium-independent ABA-activated protein kinase      313   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432492.1|  PREDICTED: serine/threonine-protein kinase S...    313   9e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009420573.1|  PREDICTED: serine/threonine-protein kinase S...    313   9e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH40741.1|  sucrose nonfermenting 1(SNF1)-related kinase            313   9e-103   Medicago truncatula
ref|XP_002869183.1|  hypothetical protein ARALYDRAFT_491280             313   9e-103   Arabidopsis lyrata subsp. lyrata
gb|KEH30920.1|  sucrose nonfermenting 1(SNF1)-related kinase            313   9e-103   Medicago truncatula
ref|XP_009601520.1|  PREDICTED: serine/threonine-protein kinase S...    313   1e-102   Nicotiana tomentosiformis
ref|XP_009777005.1|  PREDICTED: serine/threonine-protein kinase S...    313   1e-102   Nicotiana sylvestris
ref|XP_010691012.1|  PREDICTED: serine/threonine-protein kinase S...    313   1e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524577.1|  PREDICTED: serine/threonine-protein kinase S...    313   1e-102   Glycine max [soybeans]
ref|NP_196476.1|  serine/threonine-protein kinase SRK2G                 312   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KHN23689.1|  Serine/threonine-protein kinase SAPK10                  313   1e-102   Glycine soja [wild soybean]
ref|XP_009601203.1|  PREDICTED: serine/threonine-protein kinase S...    312   1e-102   
ref|XP_002871349.1|  hypothetical protein ARALYDRAFT_908839             312   1e-102   Arabidopsis lyrata subsp. lyrata
ref|XP_006288057.1|  hypothetical protein CARUB_v10001287mg             312   1e-102   Capsella rubella
ref|XP_003555707.1|  PREDICTED: serine/threonine-protein kinase S...    313   1e-102   Glycine max [soybeans]
ref|XP_006583868.1|  PREDICTED: serine/threonine-protein kinase S...    312   1e-102   
ref|XP_007155960.1|  hypothetical protein PHAVU_003G247000g             312   1e-102   Phaseolus vulgaris [French bean]
ref|XP_009601198.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   Nicotiana tomentosiformis
gb|AFW71759.1|  putative snRK/SAPK family protein kinase                313   2e-102   
ref|XP_006399366.1|  hypothetical protein EUTSA_v10013967mg             312   2e-102   Eutrema salsugineum [saltwater cress]
gb|KCW55250.1|  hypothetical protein EUGRSUZ_I01180                     310   2e-102   Eucalyptus grandis [rose gum]
ref|XP_003580888.1|  PREDICTED: serine/threonine-protein kinase S...    313   2e-102   
ref|XP_010530874.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_009131093.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   Brassica rapa
ref|XP_007202101.1|  hypothetical protein PRUPE_ppa007584mg             312   2e-102   Prunus persica
gb|KHN02037.1|  Serine/threonine-protein kinase SRK2I                   312   2e-102   Glycine soja [wild soybean]
ref|XP_010491506.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009138251.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   
ref|XP_008241542.1|  PREDICTED: serine/threonine-protein kinase S...    312   2e-102   
gb|AID60113.1|  calcium-independent ABA-activated protein kinase        311   3e-102   
ref|XP_009786561.1|  PREDICTED: serine/threonine-protein kinase S...    311   3e-102   
emb|CDO97138.1|  unnamed protein product                                311   3e-102   
ref|XP_010028509.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
gb|KEH40740.1|  sucrose nonfermenting 1(SNF1)-related kinase            310   4e-102   
ref|XP_009122476.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
ref|NP_201489.1|  serine/threonine-protein kinase SRK2I                 311   4e-102   
ref|XP_003562284.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
ref|XP_006575017.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
ref|XP_007137814.1|  hypothetical protein PHAVU_009G157800g             311   4e-102   
ref|XP_004498169.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
ref|XP_006393885.1|  hypothetical protein EUTSA_v10004469mg             311   4e-102   
ref|XP_004982436.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
gb|AAM13097.1|  putative protein                                        311   4e-102   
ref|XP_010484571.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
ref|XP_003518861.1|  PREDICTED: serine/threonine-protein kinase S...    311   4e-102   
dbj|BAJ94902.1|  predicted protein                                      311   4e-102   
dbj|BAJ34451.1|  unnamed protein product                                311   4e-102   
gb|AHC00228.1|  SNF1-type serine-threonine protein kinase               311   5e-102   
gb|EMS56487.1|  Serine/threonine-protein kinase SAPK10                  311   5e-102   
ref|XP_009383517.1|  PREDICTED: serine/threonine-protein kinase S...    311   5e-102   
ref|XP_002464236.1|  hypothetical protein SORBIDRAFT_01g014720          311   5e-102   
gb|KDO50085.1|  hypothetical protein CISIN_1g0187342mg                  304   5e-102   
emb|CDX69016.1|  BnaC01g04370D                                          311   6e-102   
ref|NP_001130868.1|  SnRK2.10                                           311   6e-102   
ref|XP_004239628.1|  PREDICTED: serine/threonine-protein kinase S...    311   6e-102   
gb|EYU37717.1|  hypothetical protein MIMGU_mgv1a008717mg                311   7e-102   
ref|XP_008792595.1|  PREDICTED: serine/threonine-protein kinase S...    311   7e-102   
ref|XP_008454909.1|  PREDICTED: serine/threonine-protein kinase S...    311   7e-102   
emb|CAE03037.3|  OSJNBa0084A10.12                                       312   8e-102   
ref|XP_010464758.1|  PREDICTED: serine/threonine-protein kinase S...    311   8e-102   
ref|XP_004153028.1|  PREDICTED: serine/threonine-protein kinase S...    304   8e-102   
ref|XP_004136995.1|  PREDICTED: serine/threonine-protein kinase S...    310   8e-102   
ref|XP_010028289.1|  PREDICTED: serine/threonine-protein kinase S...    310   8e-102   
ref|XP_004230794.1|  PREDICTED: serine/threonine-protein kinase S...    310   8e-102   
gb|KJB48513.1|  hypothetical protein B456_008G073200                    306   9e-102   
ref|XP_007156528.1|  hypothetical protein PHAVU_003G293600g             312   1e-101   
gb|KFK25224.1|  hypothetical protein AALP_AA8G083600                    310   1e-101   
ref|XP_004959953.1|  PREDICTED: serine/threonine-protein kinase S...    311   1e-101   
ref|XP_009591903.1|  PREDICTED: serine/threonine-protein kinase S...    310   1e-101   
ref|XP_009118282.1|  PREDICTED: serine/threonine-protein kinase S...    310   1e-101   
ref|XP_008339769.1|  PREDICTED: serine/threonine-protein kinase S...    310   1e-101   
ref|XP_004288068.1|  PREDICTED: serine/threonine-protein kinase S...    310   1e-101   
gb|KFK28375.1|  hypothetical protein AALP_AA8G507100                    310   1e-101   
gb|AIK22403.1|  sucrose non-fermenting-1-related protein kinase 2.1     310   1e-101   
gb|AII82268.1|  SnRK2.3                                                 310   1e-101   
emb|CDY12785.1|  BnaC07g16480D                                          310   1e-101   
pdb|3ZUT|A  Chain A, The Structure Of Ost1 (D160a) Kinase               310   1e-101   
gb|AGW51610.1|  serine/threonine protein kinase                         310   1e-101   
gb|EMT29739.1|  Serine/threonine-protein kinase SAPK10                  311   1e-101   
ref|XP_009103473.1|  PREDICTED: serine/threonine-protein kinase S...    310   1e-101   
emb|CAA78106.1|  protein kinase                                         310   1e-101   
gb|AFK33688.1|  unknown                                                 310   1e-101   
ref|NP_001275318.1|  serine/threonine-protein kinase SRK2E-like         310   2e-101   
ref|XP_002313835.1|  OPEN STOMATA 1 family protein                      310   2e-101   
ref|XP_010503719.1|  PREDICTED: serine/threonine-protein kinase S...    310   2e-101   
pdb|3UC3|A  Chain A, The Crystal Structure Of Snf1-Related Kinase...    310   2e-101   
ref|XP_002866727.1|  hypothetical protein ARALYDRAFT_920030             310   2e-101   
ref|XP_010999823.1|  PREDICTED: serine/threonine-protein kinase S...    310   2e-101   
ref|XP_006291367.1|  hypothetical protein CARUB_v10017507mg             310   2e-101   
gb|AIH00106.1|  sucrose nonfermenting 1-related protein kinase 2.3      311   2e-101   
gb|KJB40238.1|  hypothetical protein B456_007G053000                    304   2e-101   
ref|XP_010547508.1|  PREDICTED: serine/threonine-protein kinase S...    310   2e-101   
ref|XP_008244468.1|  PREDICTED: serine/threonine-protein kinase S...    308   2e-101   
ref|XP_006425830.1|  hypothetical protein CICLE_v10025916mg             310   2e-101   
ref|XP_010515422.1|  PREDICTED: serine/threonine-protein kinase S...    309   2e-101   
ref|XP_008459221.1|  PREDICTED: serine/threonine-protein kinase S...    309   2e-101   
gb|KJB48515.1|  hypothetical protein B456_008G073200                    306   3e-101   
ref|XP_010444716.1|  PREDICTED: serine/threonine-protein kinase S...    309   3e-101   
ref|XP_001769579.1|  predicted protein                                  308   3e-101   
gb|KJB48514.1|  hypothetical protein B456_008G073200                    307   3e-101   
gb|AHE78413.1|  open stomata 1 isoform 1                                309   3e-101   
ref|XP_009366671.1|  PREDICTED: serine/threonine-protein kinase S...    309   3e-101   
ref|NP_001274891.1|  serine/threonine-protein kinase SAPK7-like         309   3e-101   
gb|ACG32779.1|  serine/threonine-protein kinase SAPK10                  309   3e-101   
ref|NP_001050653.1|  Os03g0610900                                       309   4e-101   
gb|AAO65504.1|  abcisic acid-inducible protein kinanase                 308   4e-101   
ref|XP_008654908.1|  PREDICTED: uncharacterized LOC100191280 isof...    309   4e-101   
ref|XP_010680446.1|  PREDICTED: serine/threonine-protein kinase S...    309   4e-101   
ref|XP_006664152.1|  PREDICTED: serine/threonine-protein kinase S...    309   4e-101   
ref|NP_001060312.1|  Os07g0622000                                       308   4e-101   
ref|XP_004170766.1|  PREDICTED: serine/threonine-protein kinase S...    308   4e-101   
pdb|3ZUU|A  Chain A, The Structure Of Ost1 (D160a, S175d) Kinase ...    308   5e-101   
ref|XP_006384459.1|  OPEN STOMATA 1 family protein                      308   5e-101   
ref|XP_009403693.1|  PREDICTED: serine/threonine-protein kinase S...    308   5e-101   
ref|XP_011100039.1|  PREDICTED: serine/threonine-protein kinase S...    308   6e-101   
ref|NP_190619.1|  serine/threonine-protein kinase SRK2D                 308   6e-101   
ref|XP_002522330.1|  Serine/threonine-protein kinase SAPK10, puta...    308   6e-101   
ref|XP_009136548.1|  PREDICTED: serine/threonine-protein kinase S...    308   6e-101   
emb|CDY23007.1|  BnaC07g31800D                                          308   6e-101   
emb|CEO16427.1|  sucrose non-fermenting 1-related protein kinase ...    308   6e-101   
gb|ACZ13319.1|  serine threonine kinase SAPK-5                          302   6e-101   
ref|XP_006404027.1|  hypothetical protein EUTSA_v10010481mg             308   6e-101   
ref|XP_006838505.1|  hypothetical protein AMTR_s00002p00176490          307   7e-101   
ref|XP_009366796.1|  PREDICTED: serine/threonine-protein kinase S...    308   7e-101   
ref|XP_002307247.1|  kinase mRNA family protein                         308   8e-101   
ref|XP_006583867.1|  PREDICTED: serine/threonine-protein kinase S...    308   9e-101   
ref|XP_010558405.1|  PREDICTED: serine/threonine-protein kinase S...    308   9e-101   
gb|KJB48516.1|  hypothetical protein B456_008G073200                    308   9e-101   
gb|KJB25443.1|  hypothetical protein B456_004G191500                    307   9e-101   
gb|EMS48966.1|  Serine/threonine-protein kinase SAPK5                   308   1e-100   
ref|XP_006338224.1|  PREDICTED: serine/threonine-protein kinase S...    307   1e-100   
sp|A2YNT8.2|SAPK2_ORYSI  RecName: Full=Serine/threonine-protein k...    307   1e-100   
emb|CBI23285.3|  unnamed protein product                                307   1e-100   
pdb|3UC4|A  Chain A, The Crystal Structure Of Snf1-Related Kinase...    308   1e-100   
tpg|DAA56625.1|  TPA: putative snRK/SAPK family protein kinase          304   1e-100   
ref|XP_009626815.1|  PREDICTED: serine/threonine-protein kinase S...    303   1e-100   
tpg|DAA56628.1|  TPA: putative snRK/SAPK family protein kinase          302   1e-100   
gb|KJB29269.1|  hypothetical protein B456_005G094500                    302   1e-100   
ref|XP_010558413.1|  PREDICTED: serine/threonine-protein kinase S...    305   1e-100   
gb|EPS73443.1|  stress kinase                                           307   1e-100   
gb|AGW51607.1|  serine/threonine protein kinase                         308   1e-100   
ref|NP_001067155.1|  Os12g0586100                                       308   1e-100   
gb|EAY83693.1|  hypothetical protein OsI_38916                          308   1e-100   
ref|XP_004232055.1|  PREDICTED: serine/threonine-protein kinase S...    307   1e-100   
gb|ABA40436.1|  serine/threonine protein kinase SAPK8-like protein      307   1e-100   
gb|AFX72761.1|  sucrose nonfermenting 1-related protein kinase 2        306   1e-100   
ref|XP_010547867.1|  PREDICTED: serine/threonine-protein kinase S...    306   1e-100   
ref|XP_006653076.1|  PREDICTED: serine/threonine-protein kinase S...    308   1e-100   
ref|XP_003550077.2|  PREDICTED: serine/threonine-protein kinase S...    312   1e-100   
ref|XP_007153165.1|  hypothetical protein PHAVU_003G012300g             307   1e-100   
ref|XP_004958353.1|  PREDICTED: serine/threonine-protein kinase S...    306   1e-100   
gb|AFW84449.1|  putative snRK/SAPK family protein kinase                302   1e-100   
gb|KDO81023.1|  hypothetical protein CISIN_1g019628mg                   306   1e-100   
ref|XP_004970723.1|  PREDICTED: serine/threonine-protein kinase S...    307   2e-100   
dbj|BAJ93234.1|  predicted protein                                      308   2e-100   
ref|XP_002461041.1|  hypothetical protein SORBIDRAFT_02g039640          306   2e-100   
gb|KDP38242.1|  hypothetical protein JCGZ_04885                         307   2e-100   
ref|XP_004959952.1|  PREDICTED: serine/threonine-protein kinase S...    308   2e-100   
gb|AEF00939.1|  serine/threonine-protein kinase                         307   2e-100   
ref|XP_011001186.1|  PREDICTED: serine/threonine-protein kinase S...    307   2e-100   
ref|XP_006472572.1|  PREDICTED: serine/threonine-protein kinase S...    306   2e-100   
ref|XP_010274511.1|  PREDICTED: serine/threonine-protein kinase S...    306   2e-100   
gb|KJB40237.1|  hypothetical protein B456_007G053000                    303   3e-100   
ref|NP_001044930.1|  Os01g0869900                                       306   3e-100   
gb|ACG50006.1|  SnRK2.2                                                 306   3e-100   
ref|NP_001149243.1|  serine/threonine-protein kinase SAPK2              306   3e-100   
ref|XP_002877748.1|  hypothetical protein ARALYDRAFT_485399             306   3e-100   
ref|XP_010065453.1|  PREDICTED: serine/threonine-protein kinase S...    306   3e-100   
ref|XP_004145407.1|  PREDICTED: serine/threonine-protein kinase S...    306   3e-100   
gb|KFK34298.1|  hypothetical protein AALP_AA5G126900                    306   3e-100   
ref|XP_004143455.1|  PREDICTED: serine/threonine-protein kinase S...    306   3e-100   
gb|KDP31883.1|  hypothetical protein JCGZ_12344                         306   3e-100   
ref|XP_004300317.1|  PREDICTED: serine/threonine-protein kinase S...    305   4e-100   
ref|XP_002264172.2|  PREDICTED: serine/threonine-protein kinase S...    307   4e-100   
ref|XP_006657973.1|  PREDICTED: serine/threonine-protein kinase S...    305   4e-100   
gb|AGT16367.1|  serine/threonine-protein kinase                         305   4e-100   
ref|XP_008440574.1|  PREDICTED: serine/threonine-protein kinase S...    305   4e-100   
gb|KDO57025.1|  hypothetical protein CISIN_1g019433mg                   303   4e-100   
ref|XP_007209164.1|  hypothetical protein PRUPE_ppa006108mg             308   5e-100   
ref|XP_006580257.1|  PREDICTED: serine/threonine-protein kinase S...    306   5e-100   
gb|EYU39397.1|  hypothetical protein MIMGU_mgv1a008809mg                306   5e-100   
gb|ACG50009.1|  SnRK2.5                                                 306   5e-100   
ref|XP_009346160.1|  PREDICTED: serine/threonine-protein kinase S...    305   5e-100   
gb|ACJ84448.1|  unknown                                                 306   5e-100   
gb|AFW67522.1|  putative snRK/SAPK family protein kinase                303   5e-100   
ref|XP_003578293.1|  PREDICTED: serine/threonine-protein kinase S...    306   5e-100   
ref|XP_007159714.1|  hypothetical protein PHAVU_002G261200g             305   5e-100   
ref|XP_007047159.1|  Sucrose nonfermenting 1(SNF1)-related protei...    306   5e-100   
gb|EAZ21035.1|  hypothetical protein OsJ_36682                          305   5e-100   
gb|KHN06560.1|  Serine/threonine-protein kinase SAPK2                   305   6e-100   
gb|ACJ84405.1|  unknown                                                 305   6e-100   
gb|KDP30449.1|  hypothetical protein JCGZ_17137                         305   6e-100   
ref|XP_006433942.1|  hypothetical protein CICLE_v10001754mg             305   6e-100   
ref|XP_008681001.1|  PREDICTED: uncharacterized protein LOC100191...    303   6e-100   
emb|CDX69936.1|  BnaA10g22850D                                          306   6e-100   
ref|XP_003632469.1|  PREDICTED: serine/threonine-protein kinase S...    305   7e-100   
tpg|DAA51571.1|  TPA: putative snRK/SAPK family protein kinase          305   7e-100   
ref|NP_001132381.1|  LOC100193827                                       306   7e-100   
ref|XP_004509170.1|  PREDICTED: serine/threonine-protein kinase S...    306   7e-100   
ref|XP_010312635.1|  PREDICTED: serine/threonine-protein kinase S...    305   7e-100   
ref|XP_003629567.1|  Serine/threonine protein kinase SAPK3              306   7e-100   
gb|AGG09694.1|  serine/threonine protein kinase 3                       305   8e-100   
ref|XP_006385576.1|  hypothetical protein POPTR_0003s08240g             305   8e-100   
gb|KJB40240.1|  hypothetical protein B456_007G053000                    305   8e-100   
ref|XP_011009269.1|  PREDICTED: serine/threonine-protein kinase S...    305   8e-100   
ref|XP_002443454.1|  hypothetical protein SORBIDRAFT_08g019700          305   9e-100   
ref|XP_003564710.2|  PREDICTED: serine/threonine-protein kinase S...    306   9e-100   
gb|KJB58998.1|  hypothetical protein B456_009G234800                    305   9e-100   
ref|XP_002466400.1|  hypothetical protein SORBIDRAFT_01g007120          305   9e-100   
gb|ACF79259.1|  unknown                                                 305   9e-100   
ref|XP_004981655.1|  PREDICTED: serine/threonine-protein kinase S...    305   9e-100   
emb|CEO16429.1|  sucrose non-fermenting 1-related protein kinase ...    305   1e-99    
ref|NP_001149657.1|  serine/threonine-protein kinase SAPK8              305   1e-99    
gb|EMS49128.1|  Serine/threonine-protein kinase SAPK8                   304   1e-99    
gb|KJB43634.1|  hypothetical protein B456_007G210100                    305   1e-99    
ref|XP_006645084.1|  PREDICTED: serine/threonine-protein kinase S...    305   1e-99    
ref|XP_002447377.1|  hypothetical protein SORBIDRAFT_06g033990          306   1e-99    
ref|NP_001130882.1|  uncharacterized protein LOC100191986               305   1e-99    
ref|XP_006440157.1|  hypothetical protein CICLE_v10020980mg             304   1e-99    
gb|AIK22404.1|  sucrose non-fermenting-1-related protein kinase 2.4     304   1e-99    
ref|XP_009626814.1|  PREDICTED: serine/threonine-protein kinase S...    305   1e-99    
gb|ADE77282.1|  unknown                                                 305   1e-99    
ref|XP_010919796.1|  PREDICTED: serine/threonine-protein kinase S...    304   1e-99    
gb|KDO57024.1|  hypothetical protein CISIN_1g019433mg                   304   1e-99    
ref|XP_002517501.1|  Serine/threonine-protein kinase SAPK3, putative    304   1e-99    
ref|XP_008373645.1|  PREDICTED: serine/threonine-protein kinase S...    304   1e-99    
ref|XP_002262731.2|  PREDICTED: serine/threonine-protein kinase S...    304   1e-99    
ref|XP_002987826.1|  hypothetical protein SELMODRAFT_158991             304   1e-99    
gb|AGT16857.1|  serine kinase                                           305   1e-99    
ref|XP_002992280.1|  hypothetical protein SELMODRAFT_162233             304   1e-99    
dbj|BAJ98961.1|  predicted protein                                      305   1e-99    
tpg|DAA56626.1|  TPA: putative snRK/SAPK family protein kinase          305   1e-99    
ref|XP_008673283.1|  PREDICTED: uncharacterized protein LOC100384...    305   2e-99    
emb|CDX81116.1|  BnaC03g03700D                                          305   2e-99    
ref|XP_008657021.1|  PREDICTED: serine/threonine-protein kinase S...    304   2e-99    
ref|XP_008457815.1|  PREDICTED: serine/threonine-protein kinase S...    305   2e-99    
ref|XP_007018725.1|  Kinase superfamily protein isoform 1               303   2e-99    
ref|XP_004148038.1|  PREDICTED: serine/threonine-protein kinase S...    305   2e-99    
ref|XP_002262726.1|  PREDICTED: serine/threonine-protein kinase S...    303   2e-99    
gb|KDP41411.1|  hypothetical protein JCGZ_15818                         303   3e-99    
ref|XP_002465184.1|  hypothetical protein SORBIDRAFT_01g033570          303   3e-99    
gb|EAY91961.1|  hypothetical protein OsI_13649                          303   3e-99    
emb|CAH68097.1|  B0518A01.2                                             304   3e-99    
gb|ACG50010.1|  SnRK2.6                                                 304   3e-99    
ref|NP_001054356.1|  Os04g0691100                                       304   3e-99    
ref|XP_002964718.1|  hypothetical protein SELMODRAFT_167058             303   3e-99    
ref|XP_008352499.1|  PREDICTED: serine/threonine-protein kinase S...    304   3e-99    
ref|XP_006477070.1|  PREDICTED: serine/threonine-protein kinase S...    303   4e-99    



>ref|XP_009348751.1| PREDICTED: serine/threonine-protein kinase SRK2A [Pyrus x bretschneideri]
Length=351

 Score =   337 bits (863),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002530676.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
 gb|EEF31707.1| Serine/threonine-protein kinase ASK1, putative [Ricinus communis]
Length=357

 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDP38831.1| hypothetical protein JCGZ_04988 [Jatropha curcas]
Length=354

 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002269221.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
Length=356

 Score =   336 bits (861),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008218556.1| PREDICTED: serine/threonine-protein kinase SRK2A [Prunus mume]
Length=350

 Score =   335 bits (860),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CAN78793.1| hypothetical protein VITISV_028464 [Vitis vinifera]
Length=357

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008361703.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
 gb|AII82273.1| SnRK2.9 [Malus domestica]
 gb|AIK22398.1| sucrose non-fermenting-1-related protein kinase 2.11 [Malus prunifolia]
Length=352

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CBI29763.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011464827.1| PREDICTED: serine/threonine-protein kinase SRK2A [Fragaria vesca 
subsp. vesca]
 gb|AIH00111.1| sucrose nonfermenting 1-related protein kinase 2.8 [Fragaria 
x ananassa]
Length=352

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>dbj|BAN15745.1| subfamily 2 of SNF1-related protein kinase [Dianthus caryophyllus]
Length=361

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB79236.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=354

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB47470.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=248

 Score =   330 bits (846),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ABG81507.1| serine/threonine protein kinase [Camellia sinensis]
Length=358

 Score =   334 bits (856),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_007222266.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
 gb|EMJ23465.1| hypothetical protein PRUPE_ppa007946mg [Prunus persica]
Length=350

 Score =   333 bits (855),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010242684.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_001274892.1| serine/threonine-protein kinase SRK2B-like [Solanum tuberosum]
 ref|XP_006349355.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006349356.1| PREDICTED: serine/threonine-protein kinase SRK2B-like isoform 
X2 [Solanum tuberosum]
 gb|AFR68941.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Solanum tuberosum]
Length=360

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004230475.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
 ref|XP_010314655.1| PREDICTED: serine/threonine-protein kinase SRK2B [Solanum lycopersicum]
Length=361

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010242685.1| PREDICTED: serine/threonine-protein kinase SAPK7 isoform X2 [Nelumbo 
nucifera]
Length=307

 Score =   332 bits (850),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008339496.1| PREDICTED: serine/threonine-protein kinase SRK2A [Malus domestica]
Length=352

 Score =   333 bits (854),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MXKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011087723.1| PREDICTED: serine/threonine-protein kinase SRK2A [Sesamum indicum]
Length=352

 Score =   333 bits (854),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKY+ERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYMERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB47469.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=242

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011092341.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Sesamum 
indicum]
Length=355

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB47472.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=334

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008347910.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Malus 
domestica]
 gb|AGC31662.1| SnRK2.4 [Malus domestica]
 gb|AIK22399.1| sucrose non-fermenting-1-related protein kinase 2.5 [Malus prunifolia]
Length=352

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHL IVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFREVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011028282.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X1 [Populus 
euphratica]
Length=315

 Score =   330 bits (847),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI+MEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDO50084.1| hypothetical protein CISIN_1g0187342mg, partial [Citrus sinensis]
Length=179

 Score =   325 bits (834),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1    MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CDO97575.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|EYU35455.1| hypothetical protein MIMGU_mgv1a008963mg [Erythranthe guttata]
Length=357

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCHS+QIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDO58728.1| hypothetical protein CISIN_1g029037mg [Citrus sinensis]
Length=181

 Score =   325 bits (833),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDE RY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_006847010.1| hypothetical protein AMTR_s00017p00148890 [Amborella trichopoda]
 gb|ERN08591.1| hypothetical protein AMTR_s00017p00148890 [Amborella trichopoda]
Length=354

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMRNK+T+ELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRNKQTRELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ACJ84339.1| unknown [Medicago truncatula]
Length=182

 Score =   325 bits (833),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2    MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  62   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  121

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  122  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  167



>gb|KJB47468.1| hypothetical protein B456_008G027800 [Gossypium raimondii]
Length=356

 Score =   331 bits (849),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011028283.1| PREDICTED: serine/threonine-protein kinase SRK2A isoform X2 [Populus 
euphratica]
Length=363

 Score =   332 bits (850),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI+MEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009355252.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Pyrus 
x bretschneideri]
Length=352

 Score =   331 bits (848),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKDIGSGNFGVARLMRNKETKELVAMK+I+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEIVKDIGSGNFGVARLMRNKETKELVAMKFIDRGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHL IVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHSLQIC
Sbjct  61   IRFREVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_007042267.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
 gb|EOX98098.1| SNF1-related protein kinase 2.10 isoform 2 [Theobroma cacao]
Length=353

 Score =   330 bits (847),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFIEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006384983.1| kinase family protein [Populus trichocarpa]
 gb|ERP62780.1| kinase family protein [Populus trichocarpa]
Length=353

 Score =   330 bits (846),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAI+MEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVVTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ACU17547.1| unknown [Glycine max]
Length=168

 Score =   323 bits (827),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLL+GS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLNGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDO58729.1| hypothetical protein CISIN_1g029037mg [Citrus sinensis]
Length=200

 Score =   324 bits (830),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDE RY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>gb|ACN33610.1| unknown [Zea mays]
 tpg|DAA37760.1| TPA: putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|NP_001149107.1| LOC100282729 [Zea mays]
 gb|ACG34231.1| serine/threonine-protein kinase SAPK7 [Zea mays]
Length=356

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_008781505.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Phoenix dactylifera]
Length=356

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CAE54588.1| serin/threonine protein kinase [Fagus sylvatica]
Length=353

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKE+KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKESKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC AGRFSEDEARY FQQLISGV YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICAAGRFSEDEARYFFQQLISGVPYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010101152.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
 gb|EXB87370.1| Serine/threonine-protein kinase SAPK7 [Morus notabilis]
Length=355

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG +IDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHRIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_007042266.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
 gb|EOX98097.1| SNF1-related protein kinase 2.10 isoform 1 [Theobroma cacao]
Length=424

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  72   MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  131

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  132  IRFIEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  191

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  192  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  237



>ref|XP_003531593.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X1 [Glycine max]
 ref|XP_006585497.1| PREDICTED: serine/threonine-protein kinase SRK2A-like isoform 
X2 [Glycine max]
 gb|KHN11243.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=352

 Score =   329 bits (843),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006384982.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
 gb|ERP62779.1| hypothetical protein POPTR_0004s22790g [Populus trichocarpa]
Length=375

 Score =   329 bits (844),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELVKDIGSGNFGVARLMRHKQTKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAI+MEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVVTPTHLAIIMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AGT16073.1| serine/threonine-protein kinase [Saccharum hybrid cultivar R570]
Length=213

 Score =   323 bits (829),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA GGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAGGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_006431824.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
 gb|ESR45064.1| hypothetical protein CICLE_v10001672mg [Citrus clementina]
Length=351

 Score =   328 bits (841),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1    MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006471015.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=351

 Score =   328 bits (841),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRNK TKELVAMKYIERG KID NVAREIINH+ LRHPNI
Sbjct  1    MEKYELMKDIGSGNFGVARLMRNKNTKELVAMKYIERGHKIDANVAREIINHKQLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CAA06503.1| protein kinase [Craterostigma plantagineum]
Length=355

 Score =   328 bits (841),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLI GV YCH+LQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVHYCHALQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLK CDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKSCDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KGN54829.1| hypothetical protein Csa_4G515040 [Cucumis sativus]
Length=357

 Score =   328 bits (841),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004156012.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
SRK2H-like [Cucumis sativus]
Length=355

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002325309.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
 gb|EEE99690.2| hypothetical protein POPTR_0019s00790g [Populus trichocarpa]
Length=353

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AFK33547.1| unknown [Medicago truncatula]
Length=351

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKDIGSGNFGVARLMR+K+TK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDIGSGNFGVARLMRHKDTKQLVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008783426.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X2 [Phoenix dactylifera]
Length=252

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+V+DIGSGNFGVA+LMRNKETKELVAMKYIERG +IDENV REIINHRSLRHPNI
Sbjct  1    MEKYEVVRDIGSGNFGVAKLMRNKETKELVAMKYIERGRRIDENVLREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010065455.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Eucalyptus 
grandis]
 gb|KCW62959.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
 gb|KCW62960.1| hypothetical protein EUGRSUZ_G00557 [Eucalyptus grandis]
Length=362

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREI+NH+SL HPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGHKIDENVAREIMNHKSLIHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSILHSRPKSTVGTPAYI  166



>ref|XP_008442077.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442078.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
 ref|XP_008442079.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=357

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004146378.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
sativus]
Length=355

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_003592980.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AAV41842.1| stress kinase [Medicago truncatula]
 gb|AAV41843.1| stress kinase [Medicago truncatula]
 gb|AES63231.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=351

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKDIGSGNFGVARLMR+K+TK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDIGSGNFGVARLMRHKDTKQLVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009776074.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana sylvestris]
 gb|AAL89456.1| osmotic stress-activated protein kinase [Nicotiana tabacum]
Length=356

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVLVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011001254.1| PREDICTED: serine/threonine-protein kinase SRK2A [Populus euphratica]
 ref|XP_011015060.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=353

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ACG50011.1| SnRK2.7 [Zea mays]
Length=356

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEK+EL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKHELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_007159914.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
 gb|ESW31908.1| hypothetical protein PHAVU_002G278200g [Phaseolus vulgaris]
Length=356

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AID23890.1| sucrose non-fermenting 1-related protein kinase 2 [Gossypium 
hirsutum]
Length=354

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_007148531.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
 gb|ESW20525.1| hypothetical protein PHAVU_006G216400g [Phaseolus vulgaris]
Length=351

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRN++TKELVAMKYIERG+KIDENVAREIINHRSLRH NI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNRDTKELVAMKYIERGYKIDENVAREIINHRSLRHQNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AGT16423.1| hypothetical protein SHCRBa_145_O09_R_60 [Saccharum hybrid cultivar 
R570]
Length=359

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_003540159.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=359

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|EPS60016.1| hypothetical protein M569_14789 [Genlisea aurea]
Length=360

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE++LTPTHLAIVMEYAAGGELF+RICNAGRFSEDE+RY FQQLI GVS+CH++QIC
Sbjct  61   IRFKELVLTPTHLAIVMEYAAGGELFERICNAGRFSEDESRYFFQQLICGVSFCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSHAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KHN45467.1| Serine/threonine-protein kinase SRK2B [Glycine soja]
Length=359

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010533957.1| PREDICTED: serine/threonine-protein kinase SRK2A [Tarenaya hassleriana]
Length=357

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLMR K TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMRIKNTKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006426422.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
 gb|ESR39662.1| hypothetical protein CICLE_v10025965mg [Citrus clementina]
Length=353

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDE RY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_006466196.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Citrus 
sinensis]
Length=354

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAVKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDE RY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEGRYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_010930862.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Elaeis guineensis]
Length=356

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTP+HLAIVME+AAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPSHLAIVMEFAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_003630417.1| Serine/threonine protein kinase [Medicago truncatula]
Length=354

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AET04893.2| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2    MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  62   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  121

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  122  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  167



>ref|XP_009602813.1| PREDICTED: serine/threonine-protein kinase SRK2A [Nicotiana tomentosiformis]
Length=355

 Score =   326 bits (836),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIGSGNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MDKYELVKDIGSGNFGVARLMRHKETKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVLVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006652300.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Oryza 
brachyantha]
Length=358

 Score =   327 bits (837),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_004156033.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
sativus]
Length=337

 Score =   325 bits (834),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSTAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002267922.1| PREDICTED: serine/threonine-protein kinase SRK2A [Vitis vinifera]
 emb|CBI21667.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+GSGNFGVARLMR KETKELVAMK+IERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEMVKDLGSGNFGVARLMRVKETKELVAMKFIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KHN17430.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   326 bits (835),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_001052827.1| Os04g0432000 [Oryza sativa Japonica Group]
 sp|Q7XQP4.2|SAPK7_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK7; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
7 [Oryza sativa Japonica Group]
 dbj|BAD18003.1| serine/threonine protein kinase SAPK7 [Oryza sativa Japonica 
Group]
 dbj|BAF14741.1| Os04g0432000 [Oryza sativa Japonica Group]
 emb|CAH66441.1| B0308C03.1 [Oryza sativa Indica Group]
 gb|EEE61026.1| hypothetical protein OsJ_14855 [Oryza sativa Japonica Group]
 gb|AEF00936.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=359

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|NP_001242600.1| uncharacterized protein LOC100804018 [Glycine max]
 gb|ACU19874.1| unknown [Glycine max]
Length=351

 Score =   326 bits (835),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004975639.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Setaria 
italica]
Length=358

 Score =   326 bits (836),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_004503865.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=354

 Score =   326 bits (835),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+GSGNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGSGNFGVARLLRNKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_001236743.1| protein kinase 3 [Glycine max]
 gb|AAB68961.1| protein kinase 3 [Glycine max]
 gb|KHN16911.1| Serine/threonine-protein kinase SAPK7 [Glycine soja]
Length=351

 Score =   326 bits (835),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AIO02852.1| phloem small RNA-binding protein kinase 1 [Cucurbita maxima]
Length=359

 Score =   326 bits (835),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEIVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSTAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_003579766.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Brachypodium 
distachyon]
Length=357

 Score =   326 bits (835),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>gb|KJB71410.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
 gb|KJB71411.1| hypothetical protein B456_011G121900 [Gossypium raimondii]
Length=353

 Score =   325 bits (834),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009104154.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
 emb|CDY46190.1| BnaA01g23120D [Brassica napus]
Length=352

 Score =   325 bits (834),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMR K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|EMS63561.1| Serine/threonine-protein kinase SAPK7 [Triticum urartu]
Length=383

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_011097123.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Sesamum indicum]
Length=354

 Score =   325 bits (833),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVK++G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKNLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC AGRFSE+EARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICTAGRFSENEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_008783425.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X1 [Phoenix dactylifera]
Length=364

 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+V+DIGSGNFGVA+LMRNKETKELVAMKYIERG +IDENV REIINHRSLRHPNI
Sbjct  1    MEKYEVVRDIGSGNFGVAKLMRNKETKELVAMKYIERGRRIDENVLREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008449831.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Cucumis 
melo]
Length=355

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSTAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AIZ68211.1| serine/threonine-protein kinase SAPK7 [Ornithogalum saundersiae]
Length=363

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFGVARLMRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LT THLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH +QIC
Sbjct  61   IRFKEVVLTLTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|EMT04089.1| Serine/threonine-protein kinase SAPK7 [Aegilops tauschii]
Length=357

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIG+GNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGAGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV++TPTHLAIVMEYAAGGE+FDRICNAGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVVTPTHLAIVMEYAAGGEVFDRICNAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_004144354.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cucumis 
sativus]
Length=355

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSTAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|EEC73377.1| hypothetical protein OsI_07615 [Oryza sativa Indica Group]
Length=365

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRN+ETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGSGNFGVARLMRNRETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDE+RY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDESRYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_006392094.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
 gb|ESQ29380.1| hypothetical protein EUTSA_v10023544mg [Eutrema salsugineum]
Length=361

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010030125.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
 gb|KCW57091.1| hypothetical protein EUGRSUZ_I02742 [Eucalyptus grandis]
Length=373

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE++KDIGSGNFGVARLMRNKETKELVAMKYIERG KIDENVAREIINHRSL HPNI
Sbjct  1    MDKYEVIKDIGSGNFGVARLMRNKETKELVAMKYIERGRKIDENVAREIINHRSLCHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVS+CH++QIC
Sbjct  61   IRFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSFCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|NP_001047099.1| Os02g0551100 [Oryza sativa Japonica Group]
 sp|Q6ZI44.1|SAPK6_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK6; AltName: 
Full=Osmotic stress/abscisic acid-activated protein kinase 
6 [Oryza sativa Japonica Group]
 dbj|BAD15474.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAD18002.1| serine/threonine protein kinase SAPK6 [Oryza sativa Japonica 
Group]
 dbj|BAD33270.1| putative osmotic stress-activated protein kinase [Oryza sativa 
Japonica Group]
 gb|ABB89146.1| serine-threonine protein kinase [Oryza sativa Japonica Group]
 dbj|BAF09013.1| Os02g0551100 [Oryza sativa Japonica Group]
 dbj|BAG90400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57169.1| hypothetical protein OsJ_07099 [Oryza sativa Japonica Group]
 gb|AEF00935.1| serine/threonine-protein kinase [Oryza sativa Japonica Group]
Length=365

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRN+ETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGSGNFGVARLMRNRETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDE+RY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDESRYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_010547458.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Tarenaya 
hassleriana]
Length=356

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLMR K TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMRIKNTKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE++LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKELVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004952838.1| PREDICTED: serine/threonine-protein kinase SAPK6-like isoform 
X2 [Setaria italica]
Length=454

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIGSGNFGVARLMRNKETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  91   MERYELLKDIGSGNFGVARLMRNKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  150

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  151  IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  210

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  211  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  256



>ref|XP_002453967.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
 gb|EES06943.1| hypothetical protein SORBIDRAFT_04g022410 [Sorghum bicolor]
Length=364

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_009621087.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVK+IGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MENYELVKEIGSGNFGVARLMRHKQTKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009804586.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
 ref|XP_009804587.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Nicotiana 
sylvestris]
Length=354

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVK+IGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MENYELVKEIGSGNFGVARLMRHKQTKELVAMKYIERGHKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVCYCHNMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002303162.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
 gb|EEE78141.2| hypothetical protein POPTR_0003s01110g [Populus trichocarpa]
Length=357

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVKDIGSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MENYELVKDIGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCHS+QIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP+LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPQLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ACG33803.1| serine/threonine-protein kinase SAPK6 [Zea mays]
Length=364

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|NP_001136796.1| uncharacterized LOC100216941 [Zea mays]
 gb|ACF82654.1| unknown [Zea mays]
 gb|AFW62593.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=364

 Score =   324 bits (830),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_007049928.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOX94085.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
Length=352

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009148434.1| PREDICTED: serine/threonine-protein kinase SRK2A [Brassica rapa]
Length=359

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AFW62592.1| putative snRK/SAPK family protein kinase [Zea mays]
Length=356

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_006647363.1| PREDICTED: serine/threonine-protein kinase SAPK6-like [Oryza 
brachyantha]
Length=371

 Score =   324 bits (830),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMR+KETKELVAMKYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELLKDIGSGNFGVARLMRDKETKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVLLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_010675155.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   323 bits (828),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VK +G+GNFGVARLMR+KETKELVA+KYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKQLGAGNFGVARLMRHKETKELVAVKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTP+HL IVMEYAAGGELFDRIC AGRFSEDEARY FQQLISGVS+CHS+QIC
Sbjct  61   IRFKEVVLTPSHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVSFCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004485476.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=351

 Score =   323 bits (828),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE VKDIGSGNFGVARLMR+K+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEHVKDIGSGNFGVARLMRHKDTKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHCMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AFK42326.1| unknown [Lotus japonicus]
Length=344

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYEL+KDIGSGNFGVARLMR+KETKELVAMKY ERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELLKDIGSGNFGVARLMRHKETKELVAMKYTERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE++LTPTHLAIVMEYAAGGELF+RIC AGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKELVLTPTHLAIVMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CAE54075.1| serine/threonine-protein kinase [Fagus sylvatica]
Length=359

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC AG+FSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICTAGKFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDP25157.1| hypothetical protein JCGZ_24259 [Jatropha curcas]
Length=355

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDLGAGNFGVARLLRHKETKQLVAMKYIERGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC AGRFSEDEARY FQQLISGV YCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVDYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010911872.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Elaeis 
guineensis]
Length=358

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKDIGSGNFGVA+LMRNKETKELVAMK IERG +IDENV REIINHRSLRHPNI
Sbjct  1    MEKYEVVKDIGSGNFGVAKLMRNKETKELVAMKCIERGRRIDENVLREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004503013.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Cicer 
arietinum]
Length=357

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+GSGNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGSGNFGVARLMRNKVTKELVAMKYIERGHKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_007049927.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94084.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=352

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE ILTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV+YCHS+QIC
Sbjct  61   IRFKEAILTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CDY34860.1| BnaA09g47860D [Brassica napus]
Length=357

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AAA33004.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401B protein kinase
Length=354

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ADP24128.1| serine/threonine protein kinase [Brassica napus]
Length=354

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011009381.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Populus 
euphratica]
Length=192

 Score =   317 bits (811),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVKD+GSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MENYELVKDLGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR +EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLI GVSYCHS+QIC
Sbjct  61   IRVREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP+LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPQLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009118223.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=357

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006305167.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
 gb|EOA38065.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
Length=266

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006417402.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
 gb|ESQ35755.1| hypothetical protein EUTSA_v10007985mg [Eutrema salsugineum]
Length=366

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AFK42988.1| unknown [Lotus japonicus]
Length=351

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYEL+KDIGSGNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELLKDIGSGNFGVARLMRHKETKELVAMKYIERGLKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE++LTPTHLAIVMEYAAGGELF+RIC AGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKELVLTPTHLAIVMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDL+LENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTP YI
Sbjct  121  HRDLRLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPVYI  166



>gb|AFK36100.1| unknown [Medicago truncatula]
Length=313

 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+GSGNFGVA+LMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGSGNFGVAKLMRNKVTKELVAMKYIERGSKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CDY19332.1| BnaC05g08410D [Brassica napus]
Length=415

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICGAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KFK43389.1| hypothetical protein AALP_AA1G119700 [Arabis alpina]
Length=360

 Score =   322 bits (824),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AFK47198.1| unknown [Medicago truncatula]
Length=355

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKD+G+GNFGVARL+RNKETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  2    MDKYELVKDLGAGNFGVARLLRNKETKELVAMKYIERGQKIDENVAREIINHRSLRHPNI  61

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKE +LTPTHLAIVMEYAAGGELF+RICNAGR SEDEARY FQQLISGV YCH++QIC
Sbjct  62   IRFKEAVLTPTHLAIVMEYAAGGELFERICNAGRSSEDEARYFFQQLISGVHYCHAMQIC  121

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  122  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  167



>ref|XP_006300518.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
 gb|EOA33416.1| hypothetical protein CARUB_v10020517mg [Capsella rubella]
Length=364

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGNKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010492159.1| PREDICTED: serine/threonine-protein kinase SRK2A [Camelina sativa]
Length=360

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002892611.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68870.1| hypothetical protein ARALYDRAFT_888390 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006305166.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
 gb|EOA38064.1| hypothetical protein CARUB_v10009533mg [Capsella rubella]
Length=362

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010025673.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Eucalyptus 
grandis]
Length=360

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VK +G+GNFGVARLMR+KET+ELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKHLGAGNFGVARLMRHKETQELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELFDRIC+AGRFSEDEARY FQQLISGV+YCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFDRICSAGRFSEDEARYFFQQLISGVNYCHHMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009399177.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   321 bits (822),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+V++IGSGNFGVA+LMR+KETKELVAMKYIERG++IDENVAREI+NHRSLRHPNI
Sbjct  1    MEKYEVVRNIGSGNFGVAKLMRHKETKELVAMKYIERGYRIDENVAREIVNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH  QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICDAGRFSEDEARYFFQQLICGVSYCHFRQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>emb|CDY20973.1| BnaA08g25520D [Brassica napus]
Length=354

 Score =   321 bits (822),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_172563.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 sp|P43291.1|SRK2A_ARATH RecName: Full=Serine/threonine-protein kinase SRK2A; AltName: 
Full=Arabidopsis protein SK1; AltName: Full=OST1-kinase-like 
7; AltName: Full=SNF1-related kinase 2.4; Short=SnRK2.4 [Arabidopsis 
thaliana]
 gb|AAA02840.1| serine/threonine kinase [Arabidopsis thaliana]
 gb|AAB65483.1| Ser/Thr kinase; 69816-71936 [Arabidopsis thaliana]
 gb|AAM13129.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAM60822.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AAP68289.1| At1g10940 [Arabidopsis thaliana]
 gb|AEE28666.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=363

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ACN35772.1| unknown [Zea mays]
 gb|ACR38484.1| unknown [Zea mays]
 gb|AFW71757.1| putative snRK/SAPK family protein kinase isoform 1 [Zea mays]
 gb|AFW71758.1| putative snRK/SAPK family protein kinase isoform 2 [Zea mays]
Length=364

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRH NI
Sbjct  1    MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|NP_001105274.1| uncharacterized protein LOC542190 [Zea mays]
 gb|AAU43772.1| putative salt-inducible protein kinase [Zea mays]
Length=364

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYEL+KDIGSGNFGVARLMRNK+TKELVAMKYI RG KIDENVAREIINHRSLRH NI
Sbjct  1    MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHLMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_010458473.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=361

 Score =   321 bits (822),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009144406.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Brassica 
rapa]
Length=354

 Score =   320 bits (821),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|ABK25003.1| unknown [Picea sitchensis]
Length=427

 Score =   323 bits (827),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+++E+VKDIGSGNFGVARLMRNK+TKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDRFEVVKDIGSGNFGVARLMRNKKTKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEAR+ FQQLISGVSYCH+++IC
Sbjct  61   IRFKEVLLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARFFFQQLISGVSYCHAMKIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>gb|AAA33003.1| serine/threonine protein kinase [Brassica napus]
 prf||2113401A protein kinase
Length=359

 Score =   320 bits (821),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREI NHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIYNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICGAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KEH35656.1| sucrose non-fermenting-like kinase 2 family protein [Medicago 
truncatula]
Length=355

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+GSGNFGVA+LMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGSGNFGVAKLMRNKVTKELVAMKYIERGSKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011009382.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Populus 
euphratica]
Length=357

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVKD+GSGNFGVARLMR+K+T+ELVAMKYIERG KIDENVAREIINH+SLRHPNI
Sbjct  1    MENYELVKDLGSGNFGVARLMRHKQTRELVAMKYIERGRKIDENVAREIINHKSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRF+EV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLI GVSYCHS+QIC
Sbjct  61   IRFREVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLICGVSYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP+LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPQLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_003575110.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Brachypodium 
distachyon]
Length=362

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRN+ETKEL+A+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNRETKELLAVKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVLLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYI  166



>ref|XP_009406104.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406105.1| PREDICTED: serine/threonine-protein kinase SAPK7 [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+GSGNFGVARL+RNKETKELVA+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEMVKDLGSGNFGVARLLRNKETKELVAIKYIPRGQKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELFDRIC AGRFSEDEARY FQQLI GVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLICGVSYCHYMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|AIZ68209.1| serine/threonine-protein kinase SAPK7-like protein [Ornithogalum 
saundersiae]
Length=358

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+V+D+GSGNFGVARLMR+KETKELVA+KYI RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVRDLGSGNFGVARLMRHKETKELVAVKYIPRGNKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHL IVMEYAAGGELFDRIC+AGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLGIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010473290.1| PREDICTED: serine/threonine-protein kinase SRK2B [Camelina sativa]
Length=362

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010418041.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010912491.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
SAPK7-like [Elaeis guineensis]
Length=356

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIG GNF VARLMRNKET ELVAMKYI RG KIDE VAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGVGNFAVARLMRNKETGELVAMKYIPRGQKIDEKVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>emb|CDP20535.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   318 bits (816),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE++KD+G+GNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVMKDLGAGNFGVARLMRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHL IVMEYAAGGELFDRIC AGRFSEDEARY FQQLISGV YCH++QIC
Sbjct  61   IRFKEVILTPTHLGIVMEYAAGGELFDRICTAGRFSEDEARYFFQQLISGVCYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLD S APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDSSPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_010546285.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
 ref|XP_010546286.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Tarenaya 
hassleriana]
Length=345

 Score =   318 bits (815),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARLMR+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLMRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC+AGRFSE EARY FQQLI GV YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEPEARYFFQQLICGVDYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB79237.1| hypothetical protein B456_013G038800 [Gossypium raimondii]
Length=348

 Score =   318 bits (815),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 158/166 (95%), Gaps = 6/166 (4%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYI+RG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIDRGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDE      QLISGVSYCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDE------QLISGVSYCHSMQIC  114

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  115  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  160



>ref|XP_010430082.1| PREDICTED: serine/threonine-protein kinase SRK2B-like [Camelina 
sativa]
Length=362

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +K+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKDLVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDO49173.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=205

 Score =   313 bits (802),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010475982.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Camelina 
sativa]
Length=363

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+G FGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGKFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICTAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_006384384.1| kinase SPK-3 family protein [Populus trichocarpa]
 gb|ERP62181.1| kinase SPK-3 family protein [Populus trichocarpa]
Length=360

 Score =   318 bits (816),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 6/172 (3%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKE------VILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYC  465
            IRFKE      V+LTPTHL IVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGV++C
Sbjct  61   IRFKEASTRNMVVLTPTHLVIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVNFC  120

Query  466  HSLQICHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            H++QICHRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HNMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  172



>ref|XP_009384226.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   318 bits (816),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME+YE+V+DIGSGNFGVA+LMR+KETKELVAMKYIERG +IDENVAREI+NHRSL HPNI
Sbjct  1    MERYEVVRDIGSGNFGVAKLMRHKETKELVAMKYIERGPRIDENVAREIVNHRSLLHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH  QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICDAGRFSEDEARYFFQQLISGVSYCHFRQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009397730.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFG+ARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVKDIGSGNFGIARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSTAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KJB32410.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=240

 Score =   314 bits (804),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|AAM67112.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
Length=361

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSMPKSTVGTPAYI  166



>ref|XP_006852955.1| hypothetical protein AMTR_s00033p00242600 [Amborella trichopoda]
 gb|ERN14422.1| hypothetical protein AMTR_s00033p00242600 [Amborella trichopoda]
Length=364

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|NP_176290.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 ref|NP_849834.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 sp|Q9C958.1|SRK2B_ARATH RecName: Full=Serine/threonine-protein kinase SRK2B; AltName: 
Full=OST1-kinase-like 6; AltName: Full=SNF1-related kinase 
2.10; Short=SnRK2.10 [Arabidopsis thaliana]
 gb|AAG51649.1|AC018908_15 putative serine/threonine-protein kinase; 36981-34483 [Arabidopsis 
thaliana]
 gb|AAL61947.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AAO00906.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AEE33750.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
 gb|AEE33751.1| SNF1-related protein kinase 2.10 [Arabidopsis thaliana]
Length=361

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI MEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHS PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSMPKSTVGTPAYI  166



>ref|XP_003526896.1| PREDICTED: serine/threonine-protein kinase SRK2A-like [Glycine 
max]
Length=346

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYETVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR+KEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KHN09673.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=350

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYETVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR+KEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_001238298.1| protein kinase [Glycine max]
 gb|AAB68962.1| protein kinase [Glycine max]
Length=349

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR+KEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KDO49171.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=237

 Score =   313 bits (802),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KHN31217.1| Serine/threonine-protein kinase SRK2A [Glycine soja]
Length=349

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR+KEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRYKEVVLTPTHLAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KJB12210.1| hypothetical protein B456_002G006900 [Gossypium raimondii]
Length=360

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K T ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKHTDELVAVKYIERGEKIDENVQREIINHRSLRHPNII  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  183



>ref|XP_008784212.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Phoenix 
dactylifera]
Length=356

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELV+DIGSGNF VARLMRNKET ELVAMKYI RG KI ENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVRDIGSGNFAVARLMRNKETGELVAMKYIPRGQKICENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARYFFQQLISGVSYCHFMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_007049926.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94083.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=357

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 162/171 (95%), Gaps = 5/171 (3%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGHKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKE-----VILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCH  468
            IRFKE     V+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV+YCH
Sbjct  61   IRFKEASIISVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVNYCH  120

Query  469  SLQICHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            S+QICHRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  SMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  171



>gb|KJB32411.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=328

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KDO49172.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=240

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CDY03768.1| BnaC01g28850D [Brassica napus]
Length=589

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIGSGNFGVARLMR K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGSGNFGVARLMRVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_001769324.1| predicted protein [Physcomitrella patens]
 gb|EDQ65878.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            E+YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  5    ERYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  64

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH +QICH
Sbjct  65   RFKEVMLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHVMQICH  124

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  125  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  169



>dbj|BAH56941.1| AT5G63650 [Arabidopsis thaliana]
Length=346

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010547692.1| PREDICTED: serine/threonine-protein kinase SRK2G [Tarenaya hassleriana]
Length=356

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE++KD+G+GNFGVARLMR+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVMKDLGAGNFGVARLMRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRICNAGRFSE EARY FQQLI GV YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICNAGRFSEAEARYFFQQLICGVDYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHS PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSIPKSTVGTPAYI  166



>ref|XP_009150418.1| PREDICTED: serine/threonine-protein kinase SRK2H [Brassica rapa]
 emb|CDY41527.1| BnaA06g22800D [Brassica napus]
Length=357

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009602316.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
tomentosiformis]
Length=362

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+ YE+VK++GSGNFGVARLMRNKETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MQNYEVVKELGSGNFGVARLMRNKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC AGRFSE EARY FQQLI GV YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICQAGRFSEAEARYFFQQLICGVHYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>gb|AAM65503.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=358

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_001777278.1| predicted protein [Physcomitrella patens]
 gb|EDQ57933.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  10   DRYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  69

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+QICH
Sbjct  70   RFKEVMLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  129

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  130  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  174



>ref|XP_010263754.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Nelumbo 
nucifera]
Length=362

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTRELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>dbj|BAE99712.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=360

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|NP_201170.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
 sp|Q9FFP9.1|SRK2H_ARATH RecName: Full=Serine/threonine-protein kinase SRK2H; AltName: 
Full=OST1-kinase-like 9; AltName: Full=SNF1-related kinase 
2.5; Short=SnRK2.5 [Arabidopsis thaliana]
 dbj|BAB10458.1| serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AED97781.1| serine/threonine-protein kinase SRK2H [Arabidopsis thaliana]
Length=360

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002866567.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42826.1| serine/threonine-protein kinase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_008792700.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Phoenix dactylifera]
Length=361

 Score =   316 bits (810),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFG+ARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVRDIGSGNFGIARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSVAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CDX97923.1| BnaA06g06740D [Brassica napus]
Length=362

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 161/174 (93%), Gaps = 8/174 (5%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K++KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKDSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDE--------ARYSFQQLISGVS  459
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDE        ARY FQQLISGVS
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEVSFKNRNHARYFFQQLISGVS  120

Query  460  YCHSLQICHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            YCH++QICHRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  YCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  174



>gb|KDO79323.1| hypothetical protein CISIN_1g0178602mg [Citrus sinensis]
Length=219

 Score =   311 bits (796),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++Y+ V+DIGSGNFGVARLMR+K TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  23   DRYDFVRDIGSGNFGVARLMRDKVTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  82

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  83   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  142

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  143  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  187



>ref|XP_006394252.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
 gb|ESQ31538.1| hypothetical protein EUTSA_v10004481mg [Eutrema salsugineum]
Length=356

 Score =   316 bits (809),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETKELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKELVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_009388929.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Musa 
acuminata subsp. malaccensis]
Length=365

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFG+ARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVRDIGSGNFGIARLMRDKQTRELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSTAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KDO49170.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=288

 Score =   313 bits (803),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KDO49168.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=330

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CEO16426.1| sucrose non-fermenting 1-related protein kinase 2 family member 
[Marchantia polymorpha]
Length=349

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  EMEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPN  300
            +M++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPN
Sbjct  8    DMDRYELVRDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPN  67

Query  301  IIRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQI  480
            I+RFKEV++TPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+QI
Sbjct  68   IVRFKEVMVTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQI  127

Query  481  CHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            CHRDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  128  CHRDLKLENTLLDGSPAPRLKICDFGYSKSSILHSQPKSTVGTPAYI  174



>gb|KDO79324.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
 gb|KDO79325.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
 gb|KDO79326.1| hypothetical protein CISIN_1g0178602mg, partial [Citrus sinensis]
Length=200

 Score =   310 bits (794),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++Y+ V+DIGSGNFGVARLMR+K TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  23   DRYDFVRDIGSGNFGVARLMRDKVTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  82

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  83   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  142

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  143  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  187



>ref|XP_001778501.1| predicted protein [Physcomitrella patens]
 gb|EDQ56674.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  13   DRYELVKDIGSGNFGVARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  72

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEV+LTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+QICH
Sbjct  73   RFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  132

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  133  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  177



>emb|CDY72554.1| BnaAnng41460D, partial [Brassica napus]
Length=289

 Score =   313 bits (802),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  183



>gb|ABR16094.1| unknown [Picea sitchensis]
 gb|ACN40963.1| unknown [Picea sitchensis]
Length=356

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSL+HPNI+
Sbjct  17   DRYELVKDIGSGNFGVARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLKHPNIV  76

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RF+EVILTPTHLAIVMEYAAGGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+QICH
Sbjct  77   RFREVILTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQICH  136

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKS+LLHS+PKSTVGTPAYI
Sbjct  137  RDLKLENTLLDGSPAPRLKICDFGYSKSALLHSQPKSTVGTPAYI  181



>emb|CDX84430.1| BnaC03g50700D [Brassica napus]
Length=352

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKDLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010255130.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Nelumbo nucifera]
Length=361

 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTRELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KDO49169.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=280

 Score =   313 bits (801),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_009404984.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYE+V+DIGSGNFGVA+LMR+++TKELVAMK+IERG +IDENVAREIINHRSLRHPNI
Sbjct  1    MEKYEVVRDIGSGNFGVAKLMRHRDTKELVAMKHIERGQRIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELF+RIC+AGRFSEDEARY FQQLI GVSYCH  QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFERICDAGRFSEDEARYFFQQLICGVSYCHLRQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>gb|KHG25553.1| Serine/threonine-protein kinase SRK2E [Gossypium arboreum]
Length=363

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KJB32409.1| hypothetical protein B456_005G239800 [Gossypium raimondii]
Length=363

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CDY34668.1| BnaC08g42270D [Brassica napus]
Length=361

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 160/173 (92%), Gaps = 7/173 (4%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            MEKYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MEKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDE-------ARYSFQQLISGVSY  462
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDE       ARY FQQLISGVSY
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEIRKKRKHARYFFQQLISGVSY  120

Query  463  CHSLQICHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            CH++QICHRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  CHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  173



>ref|XP_010484120.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=357

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_004290308.1| PREDICTED: serine/threonine-protein kinase SRK2E [Fragaria vesca 
subsp. vesca]
 gb|AIH00109.1| sucrose nonfermenting 1-related protein kinase 2.6 [Fragaria 
x ananassa]
Length=363

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010941849.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Elaeis 
guineensis]
Length=362

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFG+ARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVRDIGSGNFGIARLMRDKKTRELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSVAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010444281.1| PREDICTED: serine/threonine-protein kinase SRK2H-like [Camelina 
sativa]
Length=356

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_010526938.1| PREDICTED: serine/threonine-protein kinase SRK2E-like isoform 
X1 [Tarenaya hassleriana]
Length=366

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDKQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CDP02466.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++Y+LV+DIGSGNFG+ARLMR+K+TKELVA+KYIERG KIDENV REIINHRSL+HPNI+
Sbjct  5    DRYDLVRDIGSGNFGIARLMRDKQTKELVAVKYIERGDKIDENVKREIINHRSLKHPNIV  64

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  65   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  124

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  125  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  169



>ref|XP_010909986.1| PREDICTED: serine/threonine-protein kinase SAPK10 [Elaeis guineensis]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFG+ARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVKDIGSGNFGIARLMRDKQTRELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ F+QLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFRQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSTAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010460858.1| PREDICTED: serine/threonine-protein kinase SRK2H [Camelina sativa]
Length=357

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_011099217.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Sesamum 
indicum]
Length=355

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++Y+ V+DIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYDFVRDIGSGNFGVARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRF+EDEAR+ FQQLISGVSYCHS+QICH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFNEDEARFFFQQLISGVSYCHSMQICH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  185



>gb|EYU44364.1| hypothetical protein MIMGU_mgv1a009037mg [Erythranthe guttata]
Length=355

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++Y+ V+DIGSGNFGVARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYDFVRDIGSGNFGVARLMRDKQTKELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQL+SGVSYCHS+QICH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLLSGVSYCHSMQICH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSSLLHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSQPKSTVGTPAYI  185



>ref|XP_006412293.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum]
 gb|ESQ53746.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum]
Length=287

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  183



>gb|ACU23651.1| unknown [Glycine max]
Length=349

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE VKD+G+GNFGVARLMRNK TKELVAMKYIERG KIDENVAREI+NHRSLRHPNI
Sbjct  1    MDKYEAVKDLGAGNFGVARLMRNKVTKELVAMKYIERGPKIDENVAREIMNHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IR+KEV+LTPTHL IVMEYAAGGELF+RIC+AGRFSEDEARY FQQLISGV +CH++QIC
Sbjct  61   IRYKEVVLTPTHLVIVMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVHFCHTMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAY+
Sbjct  121  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYV  166



>ref|XP_006280694.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
 gb|EOA13592.1| hypothetical protein CARUB_v10026657mg [Capsella rubella]
Length=359

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYE+VKD+G+GNFGVARL+R+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYEVVKDLGAGNFGVARLLRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYA+GGELF+RICNAGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYASGGELFERICNAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSRPKSTVGTPAYI  166



>ref|XP_002886574.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62833.1| hypothetical protein ARALYDRAFT_475237 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLMR K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTH+AI ME+AAGGELF+RIC+AGRFSEDEARY FQQLISGVSYCH++QIC
Sbjct  61   IRFKEVVLTPTHIAIAMEFAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSSLLHS PKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSLLHSMPKSTVGTPAYI  166



>ref|XP_009780712.1| PREDICTED: serine/threonine-protein kinase SAPK7-like [Nicotiana 
sylvestris]
Length=362

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+ YE+VK++GSGNFGVARLMR+KETK+LVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MQNYEVVKELGSGNFGVARLMRHKETKQLVAMKYIERGRKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIVMEYAAGGELFDRIC AGRFSE EARY FQQLI GV YCHS+QIC
Sbjct  61   IRFKEVVLTPTHLAIVMEYAAGGELFDRICQAGRFSEAEARYFFQQLICGVHYCHSMQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDG+ APRLKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGNPAPRLKICDFGYSKSSVLHSRPKSTVGTPAYI  166



>ref|XP_009403694.1| PREDICTED: serine/threonine-protein kinase SAPK7-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=360

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            ME YELVKDIGSGNFGVARLMRNK+T ELVAMKYI RG KI+ENVAREIIN RSL HPNI
Sbjct  2    MEMYELVKDIGSGNFGVARLMRNKDTGELVAMKYIPRGPKINENVAREIINQRSLSHPNI  61

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEV+LTPTHLAIV+EYAAGGELFDRIC+AGRFSEDEARY FQQLISGVSYCH +QIC
Sbjct  62   IRFKEVMLTPTHLAIVLEYAAGGELFDRICHAGRFSEDEARYFFQQLISGVSYCHFMQIC  121

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  122  HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  167



>ref|XP_006423077.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
 gb|ESR36317.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
Length=330

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVS+CHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSFCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_006480145.1| PREDICTED: serine/threonine-protein kinase SRK2E-like [Citrus 
sinensis]
Length=363

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>gb|KDO49166.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
 gb|KDO49167.1| hypothetical protein CISIN_1g017936mg [Citrus sinensis]
Length=363

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_006283988.1| hypothetical protein CARUB_v10005110mg [Capsella rubella]
 gb|EOA16886.1| hypothetical protein CARUB_v10005110mg [Capsella rubella]
Length=362

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  183



>ref|XP_004505181.1| PREDICTED: serine/threonine-protein kinase SRK2E-like [Cicer 
arietinum]
Length=363

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHTMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_007042345.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007042347.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX98176.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX98178.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=363

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_009774098.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774100.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774101.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
 ref|XP_009774102.1| PREDICTED: serine/threonine-protein kinase SRK2E [Nicotiana sylvestris]
Length=363

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+++T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGSGNFGVARLMRDRQTNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_007042344.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98175.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=370

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  28   DRYELVRDIGSGNFGVARLMRDKQTEELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  87

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  88   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  147

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  148  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  192



>ref|XP_008236629.1| PREDICTED: serine/threonine-protein kinase SRK2E [Prunus mume]
Length=362

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CAN62745.1| hypothetical protein VITISV_025025 [Vitis vinifera]
Length=363

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTGELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQL+SGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLVSGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS+APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSSAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_002521837.1| Serine/threonine-protein kinase SAPK10, putative [Ricinus communis]
 gb|EEF40473.1| Serine/threonine-protein kinase SAPK10, putative [Ricinus communis]
Length=363

 Score =   314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIG+GNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVKDIGAGNFGVARLMRDKQTDELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_006288056.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
 gb|EOA20954.1| hypothetical protein CARUB_v10001287mg [Capsella rubella]
Length=272

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KY++VKD+G+GNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1    MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELFDRIC AGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSILHSRPKSTVGTPAYI  166



>ref|XP_009379612.1| PREDICTED: serine/threonine-protein kinase SRK2E [Pyrus x bretschneideri]
 ref|XP_009379613.1| PREDICTED: serine/threonine-protein kinase SRK2E [Pyrus x bretschneideri]
 gb|AII82270.1| SnRK2.6 [Malus domestica]
 gb|AIK22401.1| sucrose non-fermenting-1-related protein kinase 2.10 [Malus prunifolia]
Length=362

 Score =   314 bits (804),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTGELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_006583766.1| PREDICTED: serine/threonine-protein kinase SRK2E-like isoform 
X3 [Glycine max]
Length=293

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            +KYELV+DIGSGNFGVARLMR+K T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DKYELVRDIGSGNFGVARLMRDKHTEELVAVKYIERGDKIDENVRREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKE+ILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEIILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1
Length=361

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  18   DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  77

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  78   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  137

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  138  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  182



>ref|NP_001031021.2| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
 gb|AEE28667.1| serine/threonine-protein kinase SRK2A [Arabidopsis thaliana]
Length=371

 Score =   314 bits (804),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 160/174 (92%), Gaps = 8/174 (5%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KYELVKDIG+GNFGVARLM+ K +KELVAMKYIERG KIDENVAREIINHRSLRHPNI
Sbjct  1    MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDE--------ARYSFQQLISGVS  459
            IRFKEV+LTPTHLAI MEYAAGGELF+RIC+AGRFSEDE        ARY FQQLISGVS
Sbjct  61   IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEEEGNKRKHARYFFQQLISGVS  120

Query  460  YCHSLQICHRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            YCH++QICHRDLKLENTLLDGS APRLKICDFGYSKSSLLHSRPKSTVGTPAYI
Sbjct  121  YCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  174



>ref|XP_009398292.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Musa 
acuminata subsp. malaccensis]
Length=367

 Score =   314 bits (804),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFG+ARLMR+K+TKELVA+KYIERG KIDENV REIINHRSLRHPNII
Sbjct  21   DRYELVRDIGSGNFGIARLMRDKQTKELVAVKYIERGEKIDENVQREIINHRSLRHPNII  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RF+EVILTPTHLAIVMEYA+GGELF+RIC+AGRF+EDEAR+ FQQLISGVSYCHS+Q+CH
Sbjct  81   RFREVILTPTHLAIVMEYASGGELFERICSAGRFNEDEARFFFQQLISGVSYCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGSAAPRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSAAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_006423078.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
 gb|ESR36318.1| hypothetical protein CICLE_v10028703mg [Citrus clementina]
Length=363

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVS+CHS+Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSFCHSMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>emb|CAA19877.1| protein kinase-like protein [Arabidopsis thaliana]
 emb|CAB80112.1| protein kinase-like protein [Arabidopsis thaliana]
Length=357

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  183



>ref|XP_002284959.1| PREDICTED: serine/threonine-protein kinase SAPK10 isoform X1 
[Vitis vinifera]
 emb|CBI32467.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTGELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQL+SGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLVSGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010423046.1| PREDICTED: serine/threonine-protein kinase SRK2G [Camelina sativa]
Length=354

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KY++VKD+GSGNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1    MDKYDVVKDLGSGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELFDRIC AGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSILHSRPKSTVGTPAYI  166



>ref|XP_011088303.1| PREDICTED: serine/threonine-protein kinase SRK2E isoform X1 [Sesamum 
indicum]
 ref|XP_011088304.1| PREDICTED: serine/threonine-protein kinase SRK2E isoform X1 [Sesamum 
indicum]
Length=364

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+++T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  22   DRYELVRDIGSGNFGVARLMRDRQTNELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  81

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++QICH
Sbjct  82   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQICH  141

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  142  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  186



>ref|XP_008339244.1| PREDICTED: serine/threonine-protein kinase SRK2E [Malus domestica]
 gb|AIK22400.1| sucrose non-fermenting-1-related protein kinase 2 [Malus prunifolia]
Length=362

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELV+DIGSGNFGVARLMR+K+T ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DRYELVRDIGSGNFGVARLMRDKQTGELVAVKYIERGEKIDENVQREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



>ref|XP_010452877.1| PREDICTED: serine/threonine-protein kinase SRK2G-like [Camelina 
sativa]
Length=356

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MEKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNI  303
            M+KY++VKD+GSGNFGVARL+R+K+TKELVAMKYIERG KIDENVAREIINHRSL+HPNI
Sbjct  1    MDKYDVVKDLGSGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNI  60

Query  304  IRFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQIC  483
            IRFKEVILTPTHLAIVMEYA+GGELFDRIC AGRFSE EARY FQQLI GV YCHSLQIC
Sbjct  61   IRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQIC  120

Query  484  HRDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            HRDLKLENTLLDGS AP LKICDFGYSKSS+LHSRPKSTVGTPAYI
Sbjct  121  HRDLKLENTLLDGSPAPLLKICDFGYSKSSILHSRPKSTVGTPAYI  166



>ref|XP_010432490.1| PREDICTED: serine/threonine-protein kinase SRK2E isoform X1 [Camelina 
sativa]
 ref|XP_010432491.1| PREDICTED: serine/threonine-protein kinase SRK2E isoform X2 [Camelina 
sativa]
 ref|XP_010437694.1| PREDICTED: serine/threonine-protein kinase SRK2E isoform X1 [Camelina 
sativa]
Length=364

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            ++YELVKDIGSGNFGVARLMR+K++ ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  19   DRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIV  78

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKEVILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  79   RFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  138

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  139  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  183



>ref|XP_003529248.1| PREDICTED: serine/threonine-protein kinase SRK2E-like isoformX1 
[Glycine max]
 gb|KHN48440.1| Serine/threonine-protein kinase SRK2E [Glycine soja]
Length=364

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  EKYELVKDIGSGNFGVARLMRNKETKELVAMKYIERGFKIDENVAREIINHRSLRHPNII  306
            +KYELV+DIGSGNFGVARLMR+K T+ELVA+KYIERG KIDENV REIINHRSLRHPNI+
Sbjct  21   DKYELVRDIGSGNFGVARLMRDKHTEELVAVKYIERGDKIDENVRREIINHRSLRHPNIV  80

Query  307  RFKEVILTPTHLAIVMEYAAGGELFDRICNAGRFSEDEARYSFQQLISGVSYCHSLQICH  486
            RFKE+ILTPTHLAIVMEYA+GGELF+RICNAGRFSEDEAR+ FQQLISGVSYCH++Q+CH
Sbjct  81   RFKEIILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCH  140

Query  487  RDLKLENTLLDGSAAPRLKICDFGYSKSSLLHSRPKSTVGTPAYI  621
            RDLKLENTLLDGS APRLKICDFGYSKSS+LHS+PKSTVGTPAYI
Sbjct  141  RDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYI  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950