BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS119B03

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625296.1|  PREDICTED: scarecrow-like protein 13               129   2e-31   Nicotiana tomentosiformis
ref|XP_006352339.1|  PREDICTED: scarecrow-like protein 13-like          128   5e-31   Solanum tuberosum [potatoes]
ref|XP_010312439.1|  PREDICTED: GRAS1 protein isoform X1                127   1e-30   
ref|XP_009773976.1|  PREDICTED: scarecrow-like protein 13               126   2e-30   Nicotiana sylvestris
ref|NP_001234305.1|  GRAS1 protein                                      125   4e-30   
ref|XP_009792736.1|  PREDICTED: scarecrow-like protein 13               124   1e-29   Nicotiana sylvestris
ref|XP_009594270.1|  PREDICTED: scarecrow-like protein 13               123   3e-29   Nicotiana tomentosiformis
ref|XP_006365847.1|  PREDICTED: scarecrow-like protein 13-like is...    114   7e-26   Solanum tuberosum [potatoes]
ref|XP_004239819.1|  PREDICTED: scarecrow-like protein 13               112   3e-25   Solanum lycopersicum
emb|CDP04504.1|  unnamed protein product                                104   2e-22   Coffea canephora [robusta coffee]
ref|XP_006346781.1|  PREDICTED: scarecrow-like protein 13-like is...  94.0    1e-18   Solanum tuberosum [potatoes]
gb|AGW99232.1|  scarecrow-like protein 13-like protein                90.9    1e-17   Cucumis melo [Oriental melon]
ref|XP_008440083.1|  PREDICTED: scarecrow-like protein 13             90.9    1e-17   
ref|XP_009804066.1|  PREDICTED: scarecrow-like protein 13             89.4    4e-17   Nicotiana sylvestris
gb|EYU27678.1|  hypothetical protein MIMGU_mgv1a003969mg              87.8    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_010094683.1|  hypothetical protein L484_004260                 87.8    2e-16   
ref|XP_007211536.1|  hypothetical protein PRUPE_ppa003910mg           86.3    5e-16   Prunus persica
ref|XP_008227448.1|  PREDICTED: scarecrow-like protein 13             86.3    5e-16   Prunus mume [ume]
ref|XP_004134801.1|  PREDICTED: scarecrow-like protein 13-like        85.9    6e-16   Cucumis sativus [cucumbers]
ref|XP_006467309.1|  PREDICTED: scarecrow-like protein 13-like        85.5    1e-15   Citrus sinensis [apfelsine]
ref|XP_004293381.1|  PREDICTED: scarecrow-like protein 13             84.7    2e-15   Fragaria vesca subsp. vesca
ref|XP_006449893.1|  hypothetical protein CICLE_v10014811mg           82.8    7e-15   Citrus clementina [clementine]
ref|XP_009629634.1|  PREDICTED: scarecrow-like protein 13             82.4    1e-14   Nicotiana tomentosiformis
ref|XP_004236663.1|  PREDICTED: scarecrow-like protein 21             79.3    1e-13   Solanum lycopersicum
ref|XP_010052945.1|  PREDICTED: scarecrow-like protein 13             76.6    8e-13   Eucalyptus grandis [rose gum]
ref|NP_001240165.1|  uncharacterized protein LOC100792931             76.6    8e-13   Glycine max [soybeans]
gb|KHN42281.1|  Scarecrow-like protein 13                             75.5    2e-12   Glycine soja [wild soybean]
ref|XP_010686653.1|  PREDICTED: scarecrow-like protein 21             75.1    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011040189.1|  PREDICTED: scarecrow-like protein 13             75.1    3e-12   Populus euphratica
ref|XP_007154029.1|  hypothetical protein PHAVU_003G085000g           74.7    4e-12   Phaseolus vulgaris [French bean]
ref|XP_003610571.1|  Chitin-inducible gibberellin-responsive protein  73.9    6e-12   Medicago truncatula
gb|AFK42187.1|  unknown                                               73.9    7e-12   Medicago truncatula
ref|XP_003549525.1|  PREDICTED: scarecrow-like protein 13-like        73.9    7e-12   Glycine max [soybeans]
gb|KHN03530.1|  Scarecrow-like protein 13                             73.9    7e-12   Glycine soja [wild soybean]
ref|XP_002534218.1|  Chitin-inducible gibberellin-responsive prot...  73.6    1e-11   Ricinus communis
ref|XP_007026309.1|  SCL domain class transcription factor            73.2    1e-11   
ref|XP_011086251.1|  PREDICTED: scarecrow-like protein 21             73.2    1e-11   Sesamum indicum [beniseed]
ref|XP_002322514.1|  hypothetical protein POPTR_0016s01110g           72.8    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002308802.1|  hypothetical protein POPTR_0006s01720g           72.8    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003546192.1|  PREDICTED: scarecrow-like protein 13-like        72.0    3e-11   Glycine max [soybeans]
ref|XP_008366083.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  70.1    1e-10   
ref|XP_004507608.1|  PREDICTED: scarecrow-like protein 13-like        70.1    1e-10   Cicer arietinum [garbanzo]
gb|ADL36815.1|  SCL domain class transcription factor                 70.1    1e-10   Malus domestica [apple tree]
ref|XP_009374874.1|  PREDICTED: scarecrow-like protein 13             69.7    1e-10   Pyrus x bretschneideri [bai li]
gb|KHN40815.1|  Scarecrow-like protein 13                             69.7    2e-10   Glycine soja [wild soybean]
ref|XP_011004506.1|  PREDICTED: scarecrow-like protein 13             69.7    2e-10   Populus euphratica
ref|XP_003534887.1|  PREDICTED: scarecrow-like protein 13-like        69.7    2e-10   Glycine max [soybeans]
gb|KJB68542.1|  hypothetical protein B456_010G249400                  67.8    7e-10   Gossypium raimondii
ref|XP_008370992.1|  PREDICTED: scarecrow-like protein 13             67.8    8e-10   Malus domestica [apple tree]
ref|XP_007147638.1|  hypothetical protein PHAVU_006G141700g           65.1    6e-09   Phaseolus vulgaris [French bean]
ref|XP_009348924.1|  PREDICTED: scarecrow-like protein 13             64.3    9e-09   Pyrus x bretschneideri [bai li]
gb|KJB57876.1|  hypothetical protein B456_009G184100                  61.6    8e-08   Gossypium raimondii
ref|XP_011095941.1|  PREDICTED: scarecrow-like protein 13             60.5    2e-07   Sesamum indicum [beniseed]
ref|XP_002272401.1|  PREDICTED: scarecrow-like protein 21             54.7    2e-05   Vitis vinifera
gb|KDP40388.1|  hypothetical protein JCGZ_04207                       53.5    4e-05   Jatropha curcas
ref|XP_010449649.1|  PREDICTED: scarecrow-like protein 13             53.5    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004243547.1|  PREDICTED: scarecrow-like transcription fact...  52.8    6e-05   Solanum lycopersicum
ref|XP_006414257.1|  hypothetical protein EUTSA_v10024887mg           52.4    8e-05   Eutrema salsugineum [saltwater cress]
dbj|BAJ33904.1|  unnamed protein product                              52.4    9e-05   Eutrema halophilum
ref|XP_002272334.1|  PREDICTED: scarecrow-like transcription fact...  52.0    1e-04   Vitis vinifera
ref|XP_010518733.1|  PREDICTED: scarecrow-like protein 13             51.2    2e-04   Tarenaya hassleriana [spider flower]
sp|Q9M0M5.2|SCL13_ARATH  RecName: Full=Scarecrow-like protein 13;...  50.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193456.4|  protein scarecrow-like 13                           50.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283515.1|  hypothetical protein CARUB_v10004566mg           50.8    3e-04   Capsella rubella
ref|XP_006283514.1|  hypothetical protein CARUB_v10004566mg           50.8    3e-04   
ref|XP_006363022.1|  PREDICTED: scarecrow-like transcription fact...  50.8    3e-04   Solanum tuberosum [potatoes]
ref|XP_010440036.1|  PREDICTED: scarecrow-like protein 13             49.7    6e-04   Camelina sativa [gold-of-pleasure]



>ref|XP_009625296.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=542

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 80/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYYA +H  NN+ +N S     Q  FQ QNE FFTLDS PA  D V YDSPPA SVSSN
Sbjct  25   EQYYAPYHFKNNNCNNTSSVT--QFAFQTQNEHFFTLDSLPA-TDYVVYDSPPALSVSSN  81

Query  476  RSAFSPQCSQSYM------SDNTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQSYM      SDN TCGSP SGCSGV DG +L+HVLRELEN    P
Sbjct  82   RSPFSPQCSQSYMSDLHHSSDNNTCGSPFSGCSGVDDG-DLKHVLRELENKLLGP  135



>ref|XP_006352339.1| PREDICTED: scarecrow-like protein 13-like [Solanum tuberosum]
Length=534

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 8/114 (7%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYY  ++VL N   +   S G Q  FQAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  17   EQYYTPYNVLKNSCKDTRSS-GMQFSFQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  74

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQSYMSD     + TCGSPLSGCSG+ DG+ LRHVLRELEN    P
Sbjct  75   RSPFSPQCSQSYMSDLHHSSDNTCGSPLSGCSGIDDGD-LRHVLRELENKLLGP  127



>ref|XP_010312439.1| PREDICTED: GRAS1 protein isoform X1 [Solanum lycopersicum]
Length=542

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 81/114 (71%), Gaps = 8/114 (7%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYYA + VL N   +   S G Q   QAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  25   EQYYAPYDVLKNSCKDNRSS-GMQFSLQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  82

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQSYMSD     + TCGSPLSGCSG+ DG+ LRHVLRELEN    P
Sbjct  83   RSPFSPQCSQSYMSDLHHSSDNTCGSPLSGCSGIDDGD-LRHVLRELENKLLGP  135



>ref|XP_009773976.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=542

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 79/115 (69%), Gaps = 10/115 (9%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYYA +H  NN+ +N S     Q  FQ QNE FFTLDS PA  D V YDSP A SVSSN
Sbjct  25   EQYYAPYHFKNNNCNNTSSVT--QFTFQTQNEHFFTLDSLPA-TDYVVYDSPTALSVSSN  81

Query  476  RSAFSPQCSQSYM------SDNTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQSYM      SDN TCGSP SGCSGV DG +L+HVLRELEN    P
Sbjct  82   RSPFSPQCSQSYMSDLHHSSDNNTCGSPFSGCSGVDDG-DLKHVLRELENKLLGP  135



>ref|NP_001234305.1| GRAS1 protein [Solanum lycopersicum]
 gb|ABD72958.1| GRAS1 [Solanum lycopersicum]
Length=542

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 81/114 (71%), Gaps = 8/114 (7%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYYA + VL N   +   S G Q   QAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  25   EQYYAPYDVLKNSCKDNRSS-GMQFSLQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  82

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCS+SYMSD     + TCGSPLSGCSG+ DG+ LRHVLRELEN    P
Sbjct  83   RSPFSPQCSRSYMSDLHHSSDNTCGSPLSGCSGIDDGD-LRHVLRELENKLLGP  135



>ref|XP_009792736.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=544

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            QQYY  +  ++N++ N+S S G Q  FQ QNEQ FTLDS PA  D   YD+ P+ SVSSN
Sbjct  25   QQYYTPYQAVDNNIYNDSSSSGTQFSFQTQNEQVFTLDSLPA-TDYAIYDAAPSVSVSSN  83

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQSY+SD     + TCGSP+SGCSGV DGN ++H L EL+N    P
Sbjct  84   RSPFSPQCSQSYISDPHHSFDNTCGSPVSGCSGVDDGNGMKHALWELKNKLRGP  137



>ref|XP_009594270.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=544

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            YY  +   +N + N+S S G Q  FQ QNEQFFTLDS PA  D   YD+ P+ S+SSNRS
Sbjct  27   YYTPYRAFDNSIYNDSSSSGTQFSFQTQNEQFFTLDSLPA-TDYTVYDADPSVSISSNRS  85

Query  482  AFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
             FSPQCSQSYMSD     + TCGSP+S CSGV DGN  +HVLREL+N    P
Sbjct  86   PFSPQCSQSYMSDPHHSYDNTCGSPVSWCSGVDDGNGTKHVLRELKNKLLGP  137



>ref|XP_006365847.1| PREDICTED: scarecrow-like protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365848.1| PREDICTED: scarecrow-like protein 13-like isoform X2 [Solanum 
tuberosum]
Length=559

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 84/115 (73%), Gaps = 9/115 (8%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAP-AGIDSVYYDSPPAASVSS  472
            +QYY+ +HV+NN+ S+ S S G Q  +Q QNE+FFTLDS P AG   V YDSPPA SVSS
Sbjct  25   EQYYSPYHVVNNNSSDTS-SSGTQLSYQTQNEKFFTLDSLPDAGY--VSYDSPPAVSVSS  81

Query  473  NRSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            N S FSPQCSQSY+SD     + T GSPLSGCS + DGNEL+HVLRE+ NN   P
Sbjct  82   NWSPFSPQCSQSYISDQHHSSDNTYGSPLSGCSVINDGNELKHVLREMANNLLGP  136



>ref|XP_004239819.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_004239821.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_010321394.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
Length=559

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 9/115 (8%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAP-AGIDSVYYDSPPAASVSS  472
            +QYY+ +HV+NN+ S+ S S G Q  +Q QN++FFTLDS P AG   V YDSPPA SVSS
Sbjct  25   EQYYSPYHVVNNNSSDTS-SSGTQLSYQTQNDKFFTLDSLPDAGY--VSYDSPPAVSVSS  81

Query  473  NRSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            N S FSPQCSQSY+SD     + T GSPLSGCS + DGNEL+HVLRE+ NN   P
Sbjct  82   NWSPFSPQCSQSYISDQHHSSDNTYGSPLSGCSVINDGNELKHVLREMANNLLGP  136



>emb|CDP04504.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F VLN++V  ++ S G Q  FQA NEQF TL+S P   D V  DSP   S+SSNRS FSP
Sbjct  32   FQVLNSNVCADNSSQGAQVSFQACNEQFATLESLPM-TDYVNSDSPSTVSISSNRSPFSP  90

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            QCSQSYMSD     + T GSPLSG SGV D NELR+VLRELE
Sbjct  91   QCSQSYMSDVHHSSDNTYGSPLSGSSGVDDSNELRNVLRELE  132



>ref|XP_006346781.1| PREDICTED: scarecrow-like protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346782.1| PREDICTED: scarecrow-like protein 13-like isoform X2 [Solanum 
tuberosum]
Length=544

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 67/114 (59%), Gaps = 6/114 (5%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            QQYY   H  +N   N+  + G +   + QNE+FFT+DS PA  D   YD+ P+ SVSSN
Sbjct  25   QQYYTPCHASDNSSYNDGSNSGTEVSLKTQNEKFFTMDSFPA-TDCAIYDADPSISVSSN  83

Query  476  RSAFSPQCSQSYM-----SDNTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FSPQCSQS M     S   T GSP+S CSGV D N  +H L EL N    P
Sbjct  84   RSPFSPQCSQSNMFEKRRSSENTSGSPVSLCSGVDDSNGKKHELWELNNKLLRP  137



>gb|AGW99232.1| scarecrow-like protein 13-like protein [Cucumis melo]
Length=541

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y + FHVL N VS+++ S G    F +  +QFFTL+S PA  D    +SP A SV S+RS
Sbjct  20   YLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAGSVLSSRS  79

Query  482  AFSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELE  604
             FSPQ SQS  SD       TCGSPLSGCS   D N+++H L+ELE
Sbjct  80   PFSPQGSQSCSSDQHHSFENTCGSPLSGCSVTDDDNDIKHKLKELE  125



>ref|XP_008440083.1| PREDICTED: scarecrow-like protein 13 [Cucumis melo]
Length=541

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y + FHVL N VS+++ S G    F +  +QFFTL+S PA  D    +SP A SV S+RS
Sbjct  20   YLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAGSVLSSRS  79

Query  482  AFSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELE  604
             FSPQ SQS  SD       TCGSPLSGCS   D N+++H L+ELE
Sbjct  80   PFSPQGSQSCSSDQHHSFENTCGSPLSGCSVTDDDNDIKHKLKELE  125



>ref|XP_009804066.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
 ref|XP_009804067.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=524

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYY+ ++V NN+ ++ S S G Q  FQ+QNEQFFTLDS PA    V YDSPPA SVSSN
Sbjct  12   EQYYSPYYVFNNNSNDTSSS-GTQFSFQSQNEQFFTLDSLPAA-GYVIYDSPPAVSVSSN  69

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
             S FSPQ SQS +SD     + T GSPLSGCSG VDG     VL E+ N    P
Sbjct  70   WSPFSPQYSQSTISDQHHSSDNTYGSPLSGCSG-VDG-----VLSEMANKLLGP  117



>gb|EYU27678.1| hypothetical protein MIMGU_mgv1a003969mg [Erythranthe guttata]
Length=552

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  305  YAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            +++   LNND S +S S G +  FQA NEQFFTL+S PA  D + Y+SP   SVSSNRS 
Sbjct  29   FSSLQALNND-STDSKSQGTEVTFQAYNEQFFTLESTPAA-DYIAYNSPSTISVSSNRSP  86

Query  485  FSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            FSPQ S SY SD     + TC SPLSG S   D N+L   L  L N    P
Sbjct  87   FSPQGSHSYASDLHPPSDNTCSSPLSGSSEFDDENKLLRALWVLRNELLGP  137



>ref|XP_010094683.1| hypothetical protein L484_004260 [Morus notabilis]
 gb|EXB56655.1| hypothetical protein L484_004260 [Morus notabilis]
Length=597

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 7/108 (6%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYD--SPPAASVSSN  475
            Y   F +L N++  ++GS G+   F+  NEQ+FTLDS+PA  D +  D  SP A SV S+
Sbjct  76   YSPHFQILENNMFPDTGSQGKSLSFETCNEQYFTLDSSPATADFLTCDSHSPSAVSVLSH  135

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            RS FSPQ S S  SD         GSP+SGCS   DGNEL+H LRELE
Sbjct  136  RSPFSPQGSHSCSSDPHHSSEIYSGSPISGCSVTDDGNELKHKLRELE  183



>ref|XP_007211536.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
 gb|EMJ12735.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
Length=540

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F +L N V +++GS G    FQ   E++FTL+S+PA    V  DSP A S  SNRS FS 
Sbjct  30   FQILENSVCSDTGSQGNNVSFQTYKEEYFTLESSPATTGFVACDSPSAGSGLSNRSPFSS  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q SQS +SD     + T GSP+SGCS   DGN LR+ LRELE
Sbjct  90   QGSQSCLSDQRHSPDNTSGSPISGCSVADDGNGLRYKLRELE  131



>ref|XP_008227448.1| PREDICTED: scarecrow-like protein 13 [Prunus mume]
Length=540

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F +L N V +++GS G    FQ   E++FTL+S+PA    V  DSP A S  SNRS FS 
Sbjct  30   FQILENSVCSDTGSQGNNVSFQTYKEEYFTLESSPATTGFVACDSPSAVSGLSNRSPFSS  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q SQS +SD     + T GSP+SGCS   DGN LR+ LRELE
Sbjct  90   QGSQSCLSDQHHSPDNTSGSPISGCSVADDGNGLRYKLRELE  131



>ref|XP_004134801.1| PREDICTED: scarecrow-like protein 13-like [Cucumis sativus]
 ref|XP_004170199.1| PREDICTED: scarecrow-like protein 13-like [Cucumis sativus]
 gb|KGN49047.1| hypothetical protein Csa_6G511620 [Cucumis sativus]
Length=541

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y + FHVL N VS ++ S G    F +  +QFFTL+S PA  D    +SP   SV S+RS
Sbjct  20   YLSGFHVLGNHVSPDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSTGSVLSSRS  79

Query  482  AFSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELE  604
             FSPQ SQS  SD       TCGSP+SGCS   + N+++H L+ELE
Sbjct  80   PFSPQGSQSCSSDQHHSFENTCGSPMSGCSVTDEDNDIKHKLKELE  125



>ref|XP_006467309.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 ref|XP_006475190.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 gb|KDO78491.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
 gb|KDO78492.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
Length=547

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +2

Query  320  VLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQC  499
            +L+N++ ++  S G    FQ   EQF+TLDS+ A      +DSP A S+SSNRS FSPQ 
Sbjct  34   ILDNNICSDVSSQGTNMSFQTYKEQFYTLDSSTA-TTGFSHDSPSAVSISSNRSTFSPQG  92

Query  500  SQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            SQSY SD     +   GSP+SG S V +GNELR+ LRELE
Sbjct  93   SQSYQSDPHHSPDNAYGSPMSGSSIVDEGNELRNKLRELE  132



>ref|XP_004293381.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
 ref|XP_011460052.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
Length=547

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 62/104 (60%), Gaps = 7/104 (7%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F +L N V  ++GS G+   FQ   E+FFTL+S P     +  DSP A S  SNRS FSP
Sbjct  31   FQILENSVCPDTGSQGKNVSFQTDKEEFFTLESTPVNDGFIACDSPSAISGLSNRSPFSP  90

Query  494  Q-------CSQSYMSDNTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q           +   +TT GSP+SGCSGV DGN+L++ LRELE
Sbjct  91   QGSHSYSSDHHHHHFSDTTSGSPVSGCSGVDDGNDLKYKLRELE  134



>ref|XP_006449893.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 ref|XP_006449894.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63133.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63134.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
Length=547

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +2

Query  320  VLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQC  499
            +L+N++ ++  S G    FQ   EQF+TLDS+ A      +DSP A S+SSNRS FSPQ 
Sbjct  34   ILDNNICSDVSSQGTNMSFQTYKEQFYTLDSSTA-TTGFSHDSPSAVSISSNRSTFSPQG  92

Query  500  SQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            SQSY SD     +   GSP+SG S V + NELR+ LRELE
Sbjct  93   SQSYQSDPHHSPDNAYGSPMSGSSIVDESNELRNKLRELE  132



>ref|XP_009629634.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=521

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 71/114 (62%), Gaps = 16/114 (14%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            +QYY  F    N+ SN++ S G Q   Q+QNEQFFTLDS PA    V YDSPPA SVSSN
Sbjct  12   EQYYYVF----NNNSNDTSSSGTQFSCQSQNEQFFTLDSLPAA-GYVIYDSPPAVSVSSN  66

Query  476  RSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
             S FSPQ SQS +SD     + T GSPLSGCSG VDG     VL E+ N    P
Sbjct  67   WSPFSPQYSQSTISDQHHSSDNTYGSPLSGCSG-VDG-----VLSEMANKLLGP  114



>ref|XP_004236663.1| PREDICTED: scarecrow-like protein 21 [Solanum lycopersicum]
Length=553

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +2

Query  296  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  475
            QQ Y      +N   N+  +   Q     +NE+FFT+D+ PA  D   YD  P+ SVSSN
Sbjct  25   QQNYTPCRASDNSNYNDGSNSQAQVSLTTENEKFFTVDTFPA-TDCAIYDGDPSVSVSSN  83

Query  476  RSAFSPQCSQSYM-----SDNTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            RS FS QCSQS M     S   T GSP+S CSGV D N  +H LREL N    P
Sbjct  84   RSPFSSQCSQSNMFEQRRSYEKTAGSPVSLCSGVDDSNGKKHELRELNNKLLRP  137



>ref|XP_010052945.1| PREDICTED: scarecrow-like protein 13 [Eucalyptus grandis]
 gb|KCW77094.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
 gb|KCW77095.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
Length=548

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F ++ N+VS + GS G     Q  + Q+FTLDSAPA      YDSP A SV+SNRS FS 
Sbjct  32   FQIMENNVSPDIGSQGTNFSIQGYDGQYFTLDSAPAVSSFGSYDSPSAVSVASNRSPFST  91

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            Q S SY+SD     +   GSP+SG S    G ++   LRELEN+   P
Sbjct  92   QGSHSYVSDAQHSSDYLYGSPISGSSVANGGPQMWDKLRELENSLLGP  139



>ref|NP_001240165.1| uncharacterized protein LOC100792931 [Glycine max]
 gb|ACU22951.1| unknown [Glycine max]
Length=542

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 64/104 (62%), Gaps = 7/104 (7%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYY--DSPPAASVSSNRSAF  487
            + +L +++ ++S S G    F+   EQ+FTL+S PA         DSP  ASVSS R+ F
Sbjct  24   YQMLQSNLCHDSSSQGTSVSFETCKEQYFTLESCPAPTTCFVDCDDSPSYASVSSKRTPF  83

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            SPQ SQS  SD     + T GSP+SG S V DG+EL+H LRELE
Sbjct  84   SPQGSQSCYSDHQQSSDNTYGSPISGLSSVDDGHELKHKLRELE  127



>gb|KHN42281.1| Scarecrow-like protein 13 [Glycine soja]
Length=517

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = +2

Query  320  VLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYY--DSPPAASVSSNRSAFSP  493
            +L +++ ++S S G    F+   EQ+FTL+S PA         DSP  ASVSS R+ FSP
Sbjct  1    MLQSNLCHDSSSQGTSVSFETCKEQYFTLESCPAPTTCFVDCDDSPSYASVSSKRTPFSP  60

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q SQS  SD     + T GSP+SG S V DG+EL+H LRELE
Sbjct  61   QGSQSCYSDHQQSSDNTYGSPISGLSSVDDGHELKHKLRELE  102



>ref|XP_010686653.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
Length=548

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 63/110 (57%), Gaps = 6/110 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGF-FQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFS  490
            +  LN ++  ++ + G Q   FQ  +E F TLDS+P       YDSP   S SSNRS  S
Sbjct  32   YQALNKNMYPDNTTKGNQIISFQTFDEGFVTLDSSPNIGLYTNYDSPSGVSTSSNRSQVS  91

Query  491  PQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            PQCSQSY+SD     + T GSP SG S V D  ELR+ LR LE +   P+
Sbjct  92   PQCSQSYISDPQQSSDNTYGSPTSGSSVVDDNTELRNRLRYLERSLMGPD  141



>ref|XP_011040189.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=545

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +LNN + ++ GS G    FQ    +FFTL+S+ A   S+ YDS PAASVSSNRS FSP
Sbjct  31   IQILNN-MYSDGGSQGAAISFQTDQGEFFTLESSSATAGSINYDS-PAASVSSNRSPFSP  88

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q S S +SD     +T  GSPLSG S   + + LR  LRELE
Sbjct  89   QGSHSCISDPHHSPDTAYGSPLSGSSSADEDHILRQKLRELE  130



>ref|XP_007154029.1| hypothetical protein PHAVU_003G085000g [Phaseolus vulgaris]
 gb|ESW26023.1| hypothetical protein PHAVU_003G085000g [Phaseolus vulgaris]
Length=549

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 10/107 (9%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGF---FQAQNEQFFTLDSAPAGIDSVYY--DSPPAASVSSNR  478
            + VL +D+ ++      QG    F+   +Q+FTL+S PA         DSP  ASVSS R
Sbjct  25   YQVLKSDLCHDGRDSSSQGTSVSFETCKQQYFTLESCPAPTTGFLDCDDSPSYASVSSKR  84

Query  479  SAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            S FSPQ SQS  SD     + T GSP+SG S V DG+EL+H LRELE
Sbjct  85   SPFSPQGSQSCYSDHHPSSDNTYGSPISGLSSVDDGHELKHKLRELE  131



>ref|XP_003610571.1| Chitin-inducible gibberellin-responsive protein [Medicago truncatula]
 gb|AES92768.1| GRAS family transcription factor [Medicago truncatula]
Length=544

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  347  SGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD--  520
            S S G    F+    Q FTL+S P     +  DSP  ASVSSNR+ FSPQ SQS  SD  
Sbjct  36   SSSQGTDLSFETYKPQRFTLESYPEITGFIDCDSPSYASVSSNRTPFSPQESQSCHSDHH  95

Query  521  ---NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
               + T GSP+SG S V DGN+L+H LRE+EN+   P
Sbjct  96   QSPDNTYGSPISGMSSVDDGNDLKHKLREIENSLLGP  132



>gb|AFK42187.1| unknown [Medicago truncatula]
Length=520

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  347  SGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD--  520
            S S G    F+    Q FTL+S P     +  DSP  ASVSSNR+ FSPQ SQS  SD  
Sbjct  36   SSSQGTDLSFETYKPQRFTLESYPEITGFIDCDSPSYASVSSNRTPFSPQESQSCHSDHH  95

Query  521  ---NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
               + T GSP+SG S V DGN+L+H LRE+EN+   P
Sbjct  96   QSPDNTYGSPISGMSSVDDGNDLKHKLREIENSLLGP  132



>ref|XP_003549525.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
Length=545

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYY--DSPPAASVSSNRSAF  487
            + +L +++  +S S G    F+   EQ+FTL+S PA  +      DSP  ASVSS R+ F
Sbjct  24   YQMLQSNLCQDSSSQGTSVSFETCKEQYFTLESCPAPTNDFMDCDDSPSYASVSSKRTPF  83

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            SPQ SQS  SD     + T GSP+SG S V D ++L+H LRELE +   P
Sbjct  84   SPQGSQSCYSDHHQSSDNTYGSPISGLSSVDDRHQLKHKLRELEISLLAP  133



>gb|KHN03530.1| Scarecrow-like protein 13 [Glycine soja]
Length=545

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYY--DSPPAASVSSNRSAF  487
            + +L +++  +S S G    F+   EQ+FTL+S PA  +      DSP  ASVSS R+ F
Sbjct  24   YQMLQSNLCQDSSSQGTSVSFETCKEQYFTLESCPAPTNDFMDCDDSPSYASVSSKRTPF  83

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            SPQ SQS  SD     + T GSP+SG S V D ++L+H LRELE +   P
Sbjct  84   SPQGSQSCYSDHHQSSDNTYGSPISGLSSVDDRHQLKHKLRELEISLLAP  133



>ref|XP_002534218.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
 gb|EEF28164.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
Length=542

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 61/103 (59%), Gaps = 7/103 (7%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L N   ++ GS G    FQ   E++FTL+S+ A    V YDS PAASVSSNRS FSP
Sbjct  31   IQILENSAFSDVGSQGTSVSFQTYKEEYFTLESSSANAGFVGYDS-PAASVSSNRSPFSP  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNEL-RHVLRELE  604
            Q S S +SD     + T GSP+SG S   D N L R  LRELE
Sbjct  90   QGSNSCLSDPHRSPDNTYGSPMSGVSSADDENALMRQKLRELE  132



>ref|XP_007026309.1| SCL domain class transcription factor [Theobroma cacao]
 gb|EOY28931.1| SCL domain class transcription factor [Theobroma cacao]
Length=548

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 5/102 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L+N+V ++ GS G    FQ   +QFFTL+S+ A    V YDSP A S+SS+RS FSP
Sbjct  32   IQILDNNVCSDVGSQGTSVSFQTYKDQFFTLESSTATAGFVVYDSPSAVSISSSRSPFSP  91

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q SQSY+SD     + T GSP SG S V DGNE +H LRELE
Sbjct  92   QGSQSYLSDPHHSPDNTYGSPFSGSSVVDDGNEWKHKLRELE  133



>ref|XP_011086251.1| PREDICTED: scarecrow-like protein 21 [Sesamum indicum]
Length=552

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 61/110 (55%), Gaps = 7/110 (6%)
 Frame = +2

Query  308  AAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAF  487
            + F VLN+D ++      E    +   EQFFTL+S PA   +VY +SP    VSSN S F
Sbjct  30   STFEVLNDDSTHIRRQATEFPL-RTYAEQFFTLESTPASEYAVY-NSPSTPGVSSNMSPF  87

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            SPQ  QSY SD     +  CGSP+SG SGV D N+L H L  L N    P
Sbjct  88   SPQYFQSYASDLHHASDNPCGSPMSGSSGVDDENKLMHALWVLRNELLGP  137



>ref|XP_002322514.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
 gb|EEF04275.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
Length=546

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L++++ ++ GS G    FQ    +FFTL+S+ A    V YDS PAASVSSNRS FSP
Sbjct  31   IQILDSNMYSDGGSQGAAISFQTDQGEFFTLESSSATAGFVNYDS-PAASVSSNRSPFSP  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q S S +SD     +T  GSPLSG S   +   LR  LRELE
Sbjct  90   QGSHSCISDPHHSPDTVYGSPLSGSSSADEDIILRQKLRELE  131



>ref|XP_002308802.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
 gb|EEE92325.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
Length=546

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 60/102 (59%), Gaps = 6/102 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L+  + +++GS G    F+    QFFTL+S+ A    V YDS PAAS+SSNRS FS 
Sbjct  31   IQILDKTLYSDAGSQGTSVSFETCLGQFFTLESSSATAGFVVYDS-PAASISSNRSPFSS  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q S S +SD         GSPLSG S   DGN LR  LRELE
Sbjct  90   QGSHSCISDPRHSPENMYGSPLSGSSSADDGNILRQKLRELE  131



>ref|XP_003546192.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
 gb|KHN32954.1| Scarecrow-like protein 13 [Glycine soja]
Length=552

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (57%), Gaps = 9/109 (8%)
 Frame = +2

Query  305  YAAFHVLN----NDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSS  472
            Y  + +L     +++ + S S G    F+   +Q+FTL+S+P   D +  DSP  ASVSS
Sbjct  26   YTHYQILQSNSCHEIHDNSSSQGTTISFETSKDQYFTLESSPVINDLIGCDSPSYASVSS  85

Query  473  NRSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            NRS FSPQ S SY SD     + T GSP S  S   D  EL++ LRELE
Sbjct  86   NRSPFSPQASHSYHSDQHQSSDNTYGSPTSSHSTADDSYELKNKLRELE  134



>ref|XP_008366083.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 13 [Malus 
domestica]
Length=542

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQA---QNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            + +L N V  ++GS G    FQ      EQFFTL+S+PA    V  DSP A S  SN+S 
Sbjct  30   YQILENSVFPDTGSQGNNVSFQTGKDDEEQFFTLESSPA-TAFVXCDSPSAVSGLSNKSP  88

Query  485  FSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            FSPQ S S +SD         GSP SGCS V D NE ++ LRE+E +   P+
Sbjct  89   FSPQGSHSCLSDQHHSSGNNYGSPTSGCSVVEDDNEFKYRLREVEVSLLGPD  140



>ref|XP_004507608.1| PREDICTED: scarecrow-like protein 13-like [Cicer arietinum]
Length=543

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +2

Query  374  FQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSDN-----TTCGS  538
            F+  +EQ FTL+S P     +  DSP  ASVSSN+S FSPQ SQ   SD+      T GS
Sbjct  45   FETFDEQCFTLESYPEITGFIDCDSPSYASVSSNKSPFSPQDSQPCYSDHHQSSYNTNGS  104

Query  539  PLSGCSGVVDGNELRHVLRELENNCSVPN  625
            P SG S V DGN+L+H LRELE +   P+
Sbjct  105  PTSGLSSVDDGNDLKHKLRELEMSLLGPD  133



>gb|ADL36815.1| SCL domain class transcription factor [Malus domestica]
Length=542

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQA---QNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            + +L N V  ++GS G    FQ      EQFFTL+S+PA    V  DSP A S  SN+S 
Sbjct  30   YQILENSVFPDTGSQGNNVSFQTGKDDEEQFFTLESSPA-TAFVTCDSPSAVSGLSNKSP  88

Query  485  FSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            FSPQ S S +SD         GSP SGCS V D NE ++ LRE+E +   P+
Sbjct  89   FSPQGSHSCLSDQHHSSGNNYGSPTSGCSVVEDDNEFKYRLREVEVSLLGPD  140



>ref|XP_009374874.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009374875.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009344952.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009344953.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
Length=542

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 9/112 (8%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQA---QNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            + +L N V  ++GS G    FQ      EQFFTL+S+PA    V  DSP A S  SN+S 
Sbjct  30   YQILENSVFPDTGSQGNNVSFQTCKDGEEQFFTLESSPA-TAFVTCDSPSAVSSLSNKSP  88

Query  485  FSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            FSPQ S S +SD         GSP SGCS V D NE ++ LRE+E +   P+
Sbjct  89   FSPQGSHSCLSDQHHSSGNNYGSPTSGCSVVEDDNEFKYRLREVEVSLLGPD  140



>gb|KHN40815.1| Scarecrow-like protein 13 [Glycine soja]
Length=548

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  305  YAAFHVL-NNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y  + +L +N   + S S G    F+   EQ+FTL+S+PA  D +  DSP  ASVSSNRS
Sbjct  26   YTHYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPSYASVSSNRS  85

Query  482  AFSPQCSQS--YMSDNTTCGSPLSGCSGV-VDGNELRHVLRELENNCSVPN  625
             FSPQ S S  + S + T GSP S  S    DG EL++ LRELE +   P+
Sbjct  86   PFSPQASHSDQHQSSDNTYGSPTSAHSRYDDDGYELKNKLRELEISLLGPD  136



>ref|XP_011004506.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
 ref|XP_011004507.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=546

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 60/102 (59%), Gaps = 6/102 (6%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L+ ++ +++GS G    F+    QFFTL+S+ A    V YDS PAAS+SSNRS FS 
Sbjct  31   IQILDKNMYSDAGSQGTSVSFETCLGQFFTLESSSATAGFVVYDS-PAASISSNRSPFSS  89

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q S S +SD         GSPLSG S   D N LR  LRELE
Sbjct  90   QGSLSCISDPRHSPENLYGSPLSGSSSADDSNILRQKLRELE  131



>ref|XP_003534887.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
Length=548

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  305  YAAFHVL-NNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y  + +L +N   + S S G    F+   EQ+FTL+S+PA  D +  DSP  ASVSSNRS
Sbjct  26   YTHYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPSYASVSSNRS  85

Query  482  AFSPQCSQS--YMSDNTTCGSPLSGCSGV-VDGNELRHVLRELENNCSVPN  625
             FSPQ S S  + S + T GSP S  S    DG EL++ LRELE +   P+
Sbjct  86   PFSPQASHSDQHQSSDNTYGSPTSAHSRYDDDGYELKNKLRELEISLLGPD  136



>gb|KJB68542.1| hypothetical protein B456_010G249400 [Gossypium raimondii]
Length=548

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 5/102 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              +L N+  ++ GS G    +QA N+Q FTL+S+ A    V YDSP A SVSS+RS FSP
Sbjct  32   IQILENNACSDIGSQGPSVSYQAYNDQIFTLESSTAAASIVAYDSPSAISVSSSRSPFSP  91

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            Q SQS+MSD     + T GSP SG S V D N L+H LRELE
Sbjct  92   QGSQSWMSDPHHSPDNTHGSPFSGSSVVDDSNGLKHKLRELE  133



>ref|XP_008370992.1| PREDICTED: scarecrow-like protein 13 [Malus domestica]
Length=536

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 65/112 (58%), Gaps = 10/112 (9%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQN---EQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            F +L N +  ++GS G    FQ      EQFFTL+S+P+  D +  DSP A S  SNRS 
Sbjct  25   FQILENSMYPDTGSQGNNLSFQTDKDDKEQFFTLESSPS-TDFLPCDSPSAISGLSNRSP  83

Query  485  FSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            FSPQ S S  SD         GSP+SGCS +VD ++ ++ LRE+E +   P+
Sbjct  84   FSPQGSHSCFSDQHHSSGNNYGSPISGCSIIVD-DDFKYKLREMEVSLLGPD  134



>ref|XP_007147638.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
 gb|ESW19632.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
Length=553

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +2

Query  305  YAAFHVLNNDVSNE---SGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVS--  469
            Y  + VL ++  +E   S S G    F+   EQ+FTL+S+P   D +  DSP  ASVS  
Sbjct  26   YTRYQVLQSNSCHEIHDSSSQGTTISFEPSKEQYFTLESSPQINDLIGCDSPSYASVSSN  85

Query  470  SNRSAFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            SNRS FSP  S SY SD     +   GSP S  S   +  EL+H LRELE
Sbjct  86   SNRSPFSPHASHSYHSDQHQSSDNNYGSPTSANSSADESYELKHKLRELE  135



>ref|XP_009348924.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
Length=536

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 62/112 (55%), Gaps = 10/112 (9%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQ---AQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  484
            F +L   +  ++GS G    FQ      EQFFTLDS+PA    +  DSP A S  SNRS 
Sbjct  25   FQILEKSMYPDTGSQGNNLSFQNYKDDKEQFFTLDSSPA-TAFLTCDSPSAISGLSNRSP  83

Query  485  FSPQCSQSYMSDN-----TTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            FSPQ S S  SD         GSP+SGCS +VD ++ +  LRE+E +   P+
Sbjct  84   FSPQGSHSCFSDQHHSSGNNYGSPISGCSIIVD-DDFKSKLREMEVSLLGPD  134



>gb|KJB57876.1| hypothetical protein B456_009G184100 [Gossypium raimondii]
Length=548

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y +   +L+N+  +++G  G    FQ   +Q FTL+S+ AG   V YDSP A S+SS+RS
Sbjct  28   YLSRIQMLDNNACSDTGVQGTNVSFQTCKDQVFTLESSMAGAGFVAYDSPSAVSISSSRS  87

Query  482  AFSPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
             FSP  SQS +SD       T GSP SG S V D N+L+H LRELE
Sbjct  88   PFSPHGSQSCLSDPRPSPENTYGSPYSGSSVVDDSNKLKHKLRELE  133



>ref|XP_011095941.1| PREDICTED: scarecrow-like protein 13 [Sesamum indicum]
Length=552

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  308  AAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAF  487
            + F VLNN+ S  S S G    FQ   EQFFTL+S PA  D   Y+SP A SVSS+RS F
Sbjct  30   STFQVLNNN-STSSKSQGSGFSFQTYTEQFFTLESTPA-TDFAAYNSPSAVSVSSSRSPF  87

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVP  622
            SPQ S SY SD     + T GSPLSG SGV D N+L H L  L N    P
Sbjct  88   SPQGSHSYGSDLHHSSDNTYGSPLSGSSGVEDENKLMHALWVLRNELLGP  137



>ref|XP_002272401.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 ref|XP_010647042.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
Length=545

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAP--AGIDSVYYDSPPAASVSSNRSAF  487
              +L+N+    +G       F   NEQ+FTL+SAP  AG + V   SP A S+SSNRS F
Sbjct  32   IQILDNNECPSNGIQQTHLSFGTYNEQYFTLESAPVTAGYN-VCDSSPSAGSISSNRSPF  90

Query  488  SPQCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELE  604
            SPQ SQSY+SD     +   GSP+SG SGV DGNELRH LRELE
Sbjct  91   SPQGSQSYLSDPHHSPDNASGSPISGSSGVDDGNELRHKLRELE  134



>gb|KDP40388.1| hypothetical protein JCGZ_04207 [Jatropha curcas]
 gb|AIY30623.1| GRAS18 [Jatropha curcas]
Length=542

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 62/103 (60%), Gaps = 8/103 (8%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
              VL+N+  ++ GS G    FQ+  E++FTL+S+ A      YDS PAASVSS +S FSP
Sbjct  31   IQVLDNNALSDGGSQGTSLSFQSYKEEYFTLESSSATTGFAVYDS-PAASVSS-KSPFSP  88

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNEL-RHVLRELE  604
            Q S S +SD     + T GSP+SG S   D N L +  LRELE
Sbjct  89   QGSHSCLSDPHHSPDNTYGSPMSGSSSASDDNILMKQKLRELE  131



>ref|XP_010449649.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010449650.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
Length=532

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = +2

Query  308  AAFHVLNNDV--SNESGSVGEQGFFQAQ-NEQFFTLDSAPAGIDSVYYDSPPAASVSSNR  478
            A  H+L   V  S +  ++ + GF   Q  E FFTL+S+ A      YDSP + S++S R
Sbjct  11   AGLHMLYPQVYCSPQFQAIDKNGFSDIQSKENFFTLESSTASGSLPSYDSP-SVSITSGR  69

Query  479  SAFSPQCSQSYMSD-----NTTCGSPLSGCSGVV-DGNELRHVLRELE  604
            S FSPQ SQS +SD         GSPLSG S    D  +++  +RELE
Sbjct  70   SPFSPQGSQSCISDLHPSPENVYGSPLSGASSFAYDEADVKSKIRELE  117



>ref|XP_004243547.1| PREDICTED: scarecrow-like transcription factor PAT1 [Solanum 
lycopersicum]
Length=545

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = +2

Query  302  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  481
            Y   F  L + +S  +GS+G    FQ  ++++  L+++ A   +  Y SP  AS SSN S
Sbjct  27   YLPQFQTLESHLSCINGSLGGNHSFQTYHDRYCMLEASSATGSNAVYHSPSTASFSSNGS  86

Query  482  AFSPQCSQSYMSD------NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
                Q SQ Y+SD       T  GSP+SG     D  +  H L+ELE     P+
Sbjct  87   TTCNQESQLYLSDVRQSPETTNYGSPISGSCITDDVTDFMHKLKELETAMLGPD  140



>ref|XP_006414257.1| hypothetical protein EUTSA_v10024887mg [Eutrema salsugineum]
 gb|ESQ55710.1| hypothetical protein EUTSA_v10024887mg [Eutrema salsugineum]
Length=532

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD         GSPLSG
Sbjct  40   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSG  98

Query  551  CSG-VVDGNELRHVLRELE  604
             S  V D   +R  +RELE
Sbjct  99   ASSYVYDEAGVRSKIRELE  117



>dbj|BAJ33904.1| unnamed protein product [Thellungiella halophila]
Length=532

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD         GSPLSG
Sbjct  40   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSG  98

Query  551  CSG-VVDGNELRHVLRELE  604
             S  V D   +R  +RELE
Sbjct  99   ASSYVYDEAGVRSKIRELE  117



>ref|XP_002272334.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
 ref|XP_010657429.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
 ref|XP_010657430.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
Length=545

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 5/109 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F   ++ +    GS G    FQ  +E++ TL+S+ A      Y+SP   S S N S  S 
Sbjct  32   FQSFDHQLCYNDGSQGTNFSFQGSSERYCTLESSSATGSYAIYNSPSTVSFSPNGSPNSQ  91

Query  494  QCSQSYMSD-----NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            Q SQSY SD     + T GSP+S      D ++L+H LRELE     P+
Sbjct  92   QDSQSYPSDPHHSPDNTYGSPMSASCITDDVSDLKHKLRELETVMLGPD  140



>ref|XP_010518733.1| PREDICTED: scarecrow-like protein 13 [Tarenaya hassleriana]
 ref|XP_010518735.1| PREDICTED: scarecrow-like protein 13 [Tarenaya hassleriana]
Length=527

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +2

Query  389  EQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSGC  553
            E FFTL+S+ A      YDSP + SVSSN S FSPQ S S +SD     +   GSP SG 
Sbjct  41   EHFFTLESSTASGSLPAYDSP-SVSVSSNHSPFSPQASHSCLSDPRQSPDNVYGSPFSGS  99

Query  554  SGVV-DGNELRHVLRELE  604
            S    D  E ++ +RELE
Sbjct  100  SSYTCDEAEFKNKIRELE  117



>sp|Q9M0M5.2|SCL13_ARATH RecName: Full=Scarecrow-like protein 13; Short=AtSCL13; AltName: 
Full=GRAS family protein 24; Short=AtGRAS-24 [Arabidopsis 
thaliana]
Length=529

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD     +   GSPLSG
Sbjct  40   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHHSPDNVYGSPLSG  98

Query  551  CSGVV-DGNELRHVLRELE  604
             S +  D   ++  +RELE
Sbjct  99   VSSLAYDEAGVKSKIRELE  117



>ref|NP_193456.4| protein scarecrow-like 13 [Arabidopsis thaliana]
 gb|AEE83865.1| protein scarecrow-like 13 [Arabidopsis thaliana]
Length=529

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD     +   GSPLSG
Sbjct  40   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHHSPDNVYGSPLSG  98

Query  551  CSGVV-DGNELRHVLRELE  604
             S +  D   ++  +RELE
Sbjct  99   VSSLAYDEAGVKSKIRELE  117



>ref|XP_006283515.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
 gb|EOA16413.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
Length=532

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD     +   GSPLSG
Sbjct  40   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHPSPDNVYGSPLSG  98

Query  551  CSGVV-DGNELRHVLRELE  604
             S +  D   ++  +RELE
Sbjct  99   TSSLAYDEAGVKSKIRELE  117



>ref|XP_006283514.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
 gb|EOA16412.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
Length=518

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +2

Query  386  NEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD-----NTTCGSPLSG  550
             E FFTL+S+ A      YDSP + S++S RS FSPQ SQS +SD     +   GSPLSG
Sbjct  26   KENFFTLESSTASGSLPSYDSP-SVSITSGRSPFSPQGSQSCISDLHPSPDNVYGSPLSG  84

Query  551  CSGVV-DGNELRHVLRELE  604
             S +  D   ++  +RELE
Sbjct  85   TSSLAYDEAGVKSKIRELE  103



>ref|XP_006363022.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Solanum 
tuberosum]
Length=545

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 53/110 (48%), Gaps = 6/110 (5%)
 Frame = +2

Query  314  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  493
            F  L + +S  +GS+G    FQ   +++  L+++ A      Y SP  AS SSN S    
Sbjct  31   FQTLESHLSYINGSLGGNHSFQTYRDRYCMLEASSATGSYGVYHSPSTASFSSNGSTTCN  90

Query  494  QCSQSYMSD------NTTCGSPLSGCSGVVDGNELRHVLRELENNCSVPN  625
            Q SQ Y+SD       T  GSP+SG     D  +  H L+ELE     P+
Sbjct  91   QESQPYLSDIRQSPETTNYGSPISGSCITDDATDFMHKLKELETVMLGPD  140



>ref|XP_010440036.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010440037.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
Length=532

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 10/108 (9%)
 Frame = +2

Query  308  AAFHVLNNDV--SNESGSVGEQGFFQA-QNEQFFTLDSAPAGIDSVYYDSPPAASVSSNR  478
            A  H+L   V  S +  ++ + GF      E FFTL+S+ A      YDSP + S++S R
Sbjct  11   AGLHMLYPQVYCSPQFQAIDKNGFSDIPSKENFFTLESSTASGSLPSYDSP-SVSITSGR  69

Query  479  SAFSPQCSQSYMSD-----NTTCGSPLSGCSGVV-DGNELRHVLRELE  604
            S FSPQ SQS +SD         GSPLSG S    D   ++  +RELE
Sbjct  70   SPFSPQGSQSCISDLHPSPENVYGSPLSGASSFAYDEAGVKTKIRELE  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380