BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS117G06

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767447.1|  PREDICTED: uncharacterized protein LOC104218607    132   2e-31   Nicotiana sylvestris
ref|XP_009617547.1|  PREDICTED: uncharacterized protein LOC104109879    130   1e-30   Nicotiana tomentosiformis
ref|XP_004244210.1|  PREDICTED: WD repeat-containing protein 44 i...    104   5e-22   Solanum lycopersicum
ref|XP_004244209.1|  PREDICTED: uncharacterized protein LOC101249...    104   7e-22   Solanum lycopersicum
ref|XP_006348232.1|  PREDICTED: WD repeat-containing protein 44-like    101   9e-21   Solanum tuberosum [potatoes]
ref|XP_011098334.1|  PREDICTED: WD repeat-containing protein 44 i...  97.8    1e-19   Sesamum indicum [beniseed]
ref|XP_011098333.1|  PREDICTED: WD repeat-containing protein 44 i...  97.8    1e-19   Sesamum indicum [beniseed]
ref|XP_010644216.1|  PREDICTED: WD repeat-containing protein 44-l...  93.6    3e-18   
ref|XP_002282052.1|  PREDICTED: WD repeat-containing protein 44-l...  93.6    3e-18   Vitis vinifera
emb|CBI20340.3|  unnamed protein product                              92.8    5e-18   Vitis vinifera
ref|XP_008452481.1|  PREDICTED: WD repeat-containing protein 44 i...  89.4    9e-17   Cucumis melo [Oriental melon]
ref|XP_008452480.1|  PREDICTED: WD repeat-containing protein 44 i...  89.4    1e-16   Cucumis melo [Oriental melon]
ref|XP_009601333.1|  PREDICTED: WD repeat-containing protein 44-l...  88.2    1e-16   
ref|XP_009601332.1|  PREDICTED: WD repeat-containing protein 44-l...  88.2    2e-16   Nicotiana tomentosiformis
ref|XP_009343571.1|  PREDICTED: WD repeat-containing protein 44-like  85.5    2e-15   
ref|XP_008226666.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  85.1    2e-15   Prunus mume [ume]
ref|XP_007214620.1|  hypothetical protein PRUPE_ppa001338mg           85.1    2e-15   
ref|XP_008366762.1|  PREDICTED: WD repeat-containing protein 44-like  84.7    3e-15   Malus domestica [apple tree]
gb|EYU26402.1|  hypothetical protein MIMGU_mgv1a001267mg              84.0    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_009378485.1|  PREDICTED: WD repeat-containing protein 44       83.6    8e-15   Pyrus x bretschneideri [bai li]
ref|XP_008349982.1|  PREDICTED: WD repeat-containing protein 44-like  81.3    4e-14   
ref|XP_009774676.1|  PREDICTED: WD repeat-containing protein 44-like  81.3    5e-14   Nicotiana sylvestris
ref|XP_010099011.1|  WD repeat-containing protein 44                  80.5    8e-14   
ref|XP_004141232.1|  PREDICTED: WD repeat-containing protein 44-like  77.8    6e-13   Cucumis sativus [cucumbers]
emb|CDP05886.1|  unnamed protein product                              77.0    1e-12   Coffea canephora [robusta coffee]
gb|EPS59383.1|  hypothetical protein M569_15425                       75.5    2e-12   Genlisea aurea
ref|XP_004248274.1|  PREDICTED: WD repeat-containing protein 44-like  74.7    5e-12   Solanum lycopersicum
gb|KDO74136.1|  hypothetical protein CISIN_1g002407mg                 73.9    8e-12   Citrus sinensis [apfelsine]
gb|KDO74135.1|  hypothetical protein CISIN_1g002407mg                 73.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_006464715.1|  PREDICTED: WD repeat-containing protein 44-like  73.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_006451928.1|  hypothetical protein CICLE_v10007384mg           73.9    1e-11   Citrus clementina [clementine]
ref|XP_006362948.1|  PREDICTED: WD repeat-containing protein 44-like  72.8    2e-11   Solanum tuberosum [potatoes]
ref|NP_566515.1|  WD40 domain-containing protein                      71.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010242005.1|  PREDICTED: uncharacterized protein LOC104586456  70.5    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_002885089.1|  WD-40 repeat family protein                      69.7    2e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010245315.1|  PREDICTED: WD repeat-containing protein 44-like  69.7    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010535112.1|  PREDICTED: WD repeat-containing protein 44       67.8    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_010537008.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  65.9    4e-09   Tarenaya hassleriana [spider flower]
gb|KDP27024.1|  hypothetical protein JCGZ_20959                       65.1    6e-09   Jatropha curcas
ref|XP_010503009.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006296948.1|  hypothetical protein CARUB_v10012940mg           64.3    1e-08   Capsella rubella
ref|XP_010487372.1|  PREDICTED: WD repeat-containing protein 44-like  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002317512.1|  WD-40 repeat family protein                      63.5    2e-08   
ref|XP_011029441.1|  PREDICTED: WD repeat-containing protein 44-like  63.2    3e-08   Populus euphratica
ref|XP_006406965.1|  hypothetical protein EUTSA_v10020024mg           62.4    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008802503.1|  PREDICTED: WD repeat-containing protein 44-l...  62.4    5e-08   
ref|XP_010935623.1|  PREDICTED: WD repeat-containing protein 44-like  62.4    5e-08   Elaeis guineensis
ref|XP_008802494.1|  PREDICTED: WD repeat-containing protein 44-l...  62.4    5e-08   Phoenix dactylifera
ref|XP_010465516.1|  PREDICTED: WD repeat-containing protein 44-like  62.4    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011013674.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    6e-08   Populus euphratica
ref|XP_011042491.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    7e-08   Populus euphratica
gb|KFK38890.1|  hypothetical protein AALP_AA3G174300                  62.0    7e-08   Arabis alpina [alpine rockcress]
ref|XP_011042489.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    7e-08   Populus euphratica
ref|XP_011013673.1|  PREDICTED: WD repeat-containing protein 44-l...  62.0    7e-08   Populus euphratica
ref|XP_006370296.1|  hypothetical protein POPTR_0001s41390g           61.2    1e-07   
ref|XP_010060531.1|  PREDICTED: WD repeat-containing protein 44-l...  59.7    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010060530.1|  PREDICTED: WD repeat-containing protein 44-l...  59.7    3e-07   Eucalyptus grandis [rose gum]
ref|XP_002862468.1|  hypothetical protein ARALYDRAFT_359594           59.3    5e-07   
gb|KHG15000.1|  WD repeat-containing 44                               59.3    5e-07   Gossypium arboreum [tree cotton]
ref|XP_009146242.1|  PREDICTED: WD repeat-containing protein 44       59.3    5e-07   Brassica rapa
gb|KHG27240.1|  WD repeat-containing 44                               58.2    1e-06   Gossypium arboreum [tree cotton]
emb|CDY56822.1|  BnaC05g37770D                                        58.2    1e-06   Brassica napus [oilseed rape]
ref|XP_010062889.1|  PREDICTED: WD repeat-containing protein 44-like  57.4    2e-06   Eucalyptus grandis [rose gum]
ref|XP_004293101.1|  PREDICTED: WD repeat-containing protein 44       55.5    9e-06   Fragaria vesca subsp. vesca
ref|XP_009398403.1|  PREDICTED: WD repeat-containing protein 44-like  55.5    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB81918.1|  hypothetical protein B456_013G167600                  53.9    4e-05   Gossypium raimondii
gb|KJB81920.1|  hypothetical protein B456_013G167600                  53.5    4e-05   Gossypium raimondii
ref|XP_007021341.1|  Transducin/WD40 repeat-like superfamily protein  53.1    6e-05   
gb|KJB81919.1|  hypothetical protein B456_013G167600                  53.1    6e-05   Gossypium raimondii
ref|XP_010918446.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  53.1    6e-05   
ref|XP_004487750.1|  PREDICTED: uncharacterized protein LOC101506788  52.8    7e-05   
ref|XP_010932998.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...  51.2    2e-04   Elaeis guineensis
ref|XP_008790501.1|  PREDICTED: WD repeat-containing protein 44-like  51.2    3e-04   Phoenix dactylifera
gb|KFK27037.1|  hypothetical protein AALP_AA8G325800                  50.4    5e-04   Arabis alpina [alpine rockcress]



>ref|XP_009767447.1| PREDICTED: uncharacterized protein LOC104218607 [Nicotiana sylvestris]
Length=944

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 102/139 (73%), Gaps = 6/139 (4%)
 Frame = +2

Query  224  MKKAGDEEE--EDECFHDSFDRLIssantscsssalpsDeeeeeeeeRI-LGSPPNYACP  394
            M K  DEEE  ED+ FHDS DRL+SS NTSCSSS    +E+++ ++    LGSP NY  P
Sbjct  1    MSKTRDEEENEEDQSFHDSLDRLLSSTNTSCSSSPSSDNEQDDIKDLSFNLGSPLNYGVP  60

Query  395  QPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL---SAAEC  565
             P  VP FPMGVS NYDVWIS+PSS+EERR+ LL +MGLSRDPS+LRHRPSL   SAA+ 
Sbjct  61   DPLPVPRFPMGVSNNYDVWISEPSSVEERRIRLLSQMGLSRDPSLLRHRPSLSQSSAADY  120

Query  566  SSSGDGGEFFARSVSSDQL  622
             ++GD  E F RSVS++ L
Sbjct  121  GAAGDIPEIFGRSVSANHL  139



>ref|XP_009617547.1| PREDICTED: uncharacterized protein LOC104109879 [Nicotiana tomentosiformis]
Length=943

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 6/139 (4%)
 Frame = +2

Query  224  MKKAGDEEEEDE--CFHDSFDRLIssantscsssalpsDeeeeeeeeRI-LGSPPNYACP  394
            M K  DEEE +E   FHDS DRL+SS NTSCSSS    +E+++ ++    LGSP NY  P
Sbjct  1    MSKTRDEEENEEGQSFHDSLDRLLSSTNTSCSSSPSSDNEQDDIKDLSFNLGSPLNYGVP  60

Query  395  QPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL---SAAEC  565
             P  VP FPMGVS NYDVWIS+PSS+EERR+ LL +MGLSRDPS+LRHRPSL   SAA+ 
Sbjct  61   DPLPVPRFPMGVSNNYDVWISEPSSVEERRIRLLSQMGLSRDPSLLRHRPSLSQSSAADY  120

Query  566  SSSGDGGEFFARSVSSDQL  622
             ++GD  E F RSVS++ L
Sbjct  121  GAAGDRPEIFGRSVSANHL  139



>ref|XP_004244210.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Solanum 
lycopersicum]
Length=870

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K  DEEEEDE FHDS DRL+SS NTSCSSS    +EE++ ++       PNY   +P 
Sbjct  1    MSKTRDEEEEDERFHDSLDRLLSSTNTSCSSSPSSDNEEDDIKDLSFNLGSPNYGVSEPL  60

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL--SAAECSSSG  577
             VP FP GVS NYDVWIS+P S+EERR+ LL +MGL+RDPS+LRHRPSL  SAA      
Sbjct  61   PVPRFPRGVSNNYDVWISEPISVEERRIRLLSQMGLARDPSLLRHRPSLSQSAAADYDFD  120

Query  578  DGGEFFARSVSSDQLSSPI  634
            +  E F RS+S + L  P+
Sbjct  121  ERPEIFGRSISENHLKCPL  139



>ref|XP_004244209.1| PREDICTED: uncharacterized protein LOC101249662 isoform X1 [Solanum 
lycopersicum]
Length=928

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K  DEEEEDE FHDS DRL+SS NTSCSSS    +EE++ ++       PNY   +P 
Sbjct  1    MSKTRDEEEEDERFHDSLDRLLSSTNTSCSSSPSSDNEEDDIKDLSFNLGSPNYGVSEPL  60

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL--SAAECSSSG  577
             VP FP GVS NYDVWIS+P S+EERR+ LL +MGL+RDPS+LRHRPSL  SAA      
Sbjct  61   PVPRFPRGVSNNYDVWISEPISVEERRIRLLSQMGLARDPSLLRHRPSLSQSAAADYDFD  120

Query  578  DGGEFFARSVSSDQLSSPI  634
            +  E F RS+S + L  P+
Sbjct  121  ERPEIFGRSISENHLKCPL  139



>ref|XP_006348232.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=928

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K  DEEEEDE FHDS DRL+SS NTSCSSS    +EE++ ++       PNY   +P 
Sbjct  1    MSKTRDEEEEDERFHDSLDRLLSSTNTSCSSSPSSDNEEDDIKDLSFNLGSPNYGVSEPL  60

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL--SAAECSSSG  577
             VP FP GVS NYDVWIS+P S++ERR+ LL +MGL+RDPS+LRHRPSL  SAA      
Sbjct  61   PVPRFPRGVSNNYDVWISEPISVDERRIRLLSQMGLARDPSLLRHRPSLSQSAAADYDFD  120

Query  578  DGGEFFARSVSSDQLSSPI  634
            +  + F RSVS + L  P+
Sbjct  121  ERPDIFGRSVSENLLKCPL  139



>ref|XP_011098334.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Sesamum 
indicum]
Length=735

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 6/107 (6%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KAG+EEE++ECFHDS DRL+SS+NTSCS S   SD EE+ +        P+Y  P   
Sbjct  1    MSKAGEEEEDEECFHDSLDRLLSSSNTSCSCSPSTSDPEEDYDPNS--NCSPDYNDP---  55

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
             VP FPMGVS NYDVWISQPSS+EERR+ LL++MGL+RDPS+LRHRP
Sbjct  56   -VPKFPMGVSQNYDVWISQPSSVEERRIRLLRQMGLTRDPSLLRHRP  101



>ref|XP_011098333.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Sesamum 
indicum]
Length=909

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 6/107 (6%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KAG+EEE++ECFHDS DRL+SS+NTSCS S   SD EE+ +        P+Y  P   
Sbjct  1    MSKAGEEEEDEECFHDSLDRLLSSSNTSCSCSPSTSDPEEDYDPNS--NCSPDYNDP---  55

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
             VP FPMGVS NYDVWISQPSS+EERR+ LL++MGL+RDPS+LRHRP
Sbjct  56   -VPKFPMGVSQNYDVWISQPSSVEERRIRLLRQMGLTRDPSLLRHRP  101



>ref|XP_010644216.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Vitis 
vinifera]
Length=870

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 18/134 (13%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KAGDE+++DECF++S DR++SS+ +  SS++    +           + PNYA   P 
Sbjct  1    MSKAGDEDDDDECFYESLDRVLSSSCSCSSSNSDDDADP---------NASPNYASEHPF  51

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FP+G S  YD+WIS+PSSIEERR  LL++MGLS DPS+ R +P+       S+GD 
Sbjct  52   PIPKFPIGAS-KYDIWISEPSSIEERRSRLLREMGLSNDPSLSRVKPTAD----RSNGDI  106

Query  584  GEFFARSVSSDQLS  625
            G    RSVSSD+L+
Sbjct  107  G----RSVSSDRLA  116



>ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Vitis 
vinifera]
Length=880

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 18/134 (13%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KAGDE+++DECF++S DR++SS+ +  SS++    +           + PNYA   P 
Sbjct  1    MSKAGDEDDDDECFYESLDRVLSSSCSCSSSNSDDDADP---------NASPNYASEHPF  51

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FP+G S  YD+WIS+PSSIEERR  LL++MGLS DPS+ R +P+       S+GD 
Sbjct  52   PIPKFPIGAS-KYDIWISEPSSIEERRSRLLREMGLSNDPSLSRVKPTAD----RSNGDI  106

Query  584  GEFFARSVSSDQLS  625
            G    RSVSSD+L+
Sbjct  107  G----RSVSSDRLA  116



>emb|CBI20340.3| unnamed protein product [Vitis vinifera]
Length=749

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 18/137 (13%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KAGDE+++DECF++S DR++SS+ +  SS++    +           + PNYA   P 
Sbjct  1    MSKAGDEDDDDECFYESLDRVLSSSCSCSSSNSDDDADP---------NASPNYASEHPF  51

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FP+G S  YD+WIS+PSSIEERR  LL++MGLS DPS+ R +P+       S+GD 
Sbjct  52   PIPKFPIGAS-KYDIWISEPSSIEERRSRLLREMGLSNDPSLSRVKPTAD----RSNGDI  106

Query  584  GEFFARSVSSDQLSSPI  634
            G    RSVSS    SPI
Sbjct  107  G----RSVSSGSNGSPI  119



>ref|XP_008452481.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Cucumis 
melo]
Length=886

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K+ DE++E+ECF++S DR+ SS + S S+S    D          + + PNY    P 
Sbjct  2    MNKSVDEDDEEECFYESLDRIASSGSCSTSNSDDDRDS---------IVNSPNYDSEHPF  52

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FPM VS NYD+WIS+P+S+ ERR  LL++MGLS DPS+ R   +L   E      G
Sbjct  53   PIPKFPMAVS-NYDIWISEPASVLERRSRLLREMGLSGDPSLSRANTAL---ELDHKEKG  108

Query  584  GEFFARSVSSDQLSS  628
               F RSVSSD L+S
Sbjct  109  VGDFGRSVSSDYLTS  123



>ref|XP_008452480.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Cucumis 
melo]
Length=918

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K+ DE++E+ECF++S DR+ SS + S S+S    D          + + PNY    P 
Sbjct  2    MNKSVDEDDEEECFYESLDRIASSGSCSTSNSDDDRDS---------IVNSPNYDSEHPF  52

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FPM VS NYD+WIS+P+S+ ERR  LL++MGLS DPS+ R   +L   E      G
Sbjct  53   PIPKFPMAVS-NYDIWISEPASVLERRSRLLREMGLSGDPSLSRANTAL---ELDHKEKG  108

Query  584  GEFFARSVSSDQLSS  628
               F RSVSSD L+S
Sbjct  109  VGDFGRSVSSDYLTS  123



>ref|XP_009601333.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Nicotiana 
tomentosiformis]
Length=670

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            +E EE++ FHDS DRL+SS++TSCSSS+   DE E+      LGSP NYA   P SVP F
Sbjct  8    EEYEENDYFHDSLDRLLSSSHTSCSSSSE--DENEDGYPISNLGSP-NYAILDPHSVPKF  64

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLS-RDPSILRHR-PSLSAAECSSSG  577
            PMGV  NYDVWIS+PSSIEERR  L ++MGLS R  S L  +  ++S+++CS SG
Sbjct  65   PMGVLNNYDVWISEPSSIEERRFRLFRQMGLSLRSVSSLHLKCQTISSSKCSVSG  119



>ref|XP_009601332.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Nicotiana 
tomentosiformis]
Length=866

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            +E EE++ FHDS DRL+SS++TSCSSS+   DE E+      LGSP NYA   P SVP F
Sbjct  8    EEYEENDYFHDSLDRLLSSSHTSCSSSSE--DENEDGYPISNLGSP-NYAILDPHSVPKF  64

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLS-RDPSILRHR-PSLSAAECSSSG  577
            PMGV  NYDVWIS+PSSIEERR  L ++MGLS R  S L  +  ++S+++CS SG
Sbjct  65   PMGVLNNYDVWISEPSSIEERRFRLFRQMGLSLRSVSSLHLKCQTISSSKCSVSG  119



>ref|XP_009343571.1| PREDICTED: WD repeat-containing protein 44-like [Pyrus x bretschneideri]
Length=877

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 82/138 (59%), Gaps = 25/138 (18%)
 Frame = +2

Query  224  MKKAGDEEEED-ECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP  400
            M +AG+EE++D ECF++S DR++SS+ +  +S++    + +           PNYA    
Sbjct  1    MSRAGEEEDKDSECFYESLDRIVSSSCSCSTSNSDSEADPDPN---------PNYA----  47

Query  401  PSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGD  580
              VP FPMG +  YDVWIS+PSSI ERR  LL +MGL+ DP + R +P L        G 
Sbjct  48   --VPKFPMGATTKYDVWISEPSSISERRSKLLTEMGLTGDPVLTRAKPQL--------GF  97

Query  581  GGEFFARSVSSDQLSSPI  634
             GE F RSVSSD L + +
Sbjct  98   AGE-FGRSVSSDYLINEV  114



>ref|XP_008226666.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Prunus mume]
Length=872

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 25/138 (18%)
 Frame = +2

Query  224  MKKA-GDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP  400
            M KA G+E+E+ ECF++S DR++SS+ +  +S++    E +           PNYA    
Sbjct  1    MSKARGEEDEDTECFYESLDRIVSSSCSCSTSNSGSDTESDPN---------PNYA----  47

Query  401  PSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGD  580
              VP FPMG S  YDVWIS+PSS+ ERR  LL +MGL+ DP + R +P L        G+
Sbjct  48   --VPKFPMGASIKYDVWISEPSSVSERRSKLLSEMGLTGDPVLTRAKPHL--------GN  97

Query  581  GGEFFARSVSSDQLSSPI  634
             G+ F RSVSSD L S +
Sbjct  98   AGD-FGRSVSSDYLISQL  114



>ref|XP_007214620.1| hypothetical protein PRUPE_ppa001338mg [Prunus persica]
 gb|EMJ15819.1| hypothetical protein PRUPE_ppa001338mg [Prunus persica]
Length=850

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 81/138 (59%), Gaps = 25/138 (18%)
 Frame = +2

Query  224  MKKA-GDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP  400
            M KA G+E+E+ ECF++S DR++SS+ +  +S++    E +           PNYA    
Sbjct  1    MSKARGEEDEDTECFYESLDRIVSSSCSCSTSNSGSDTESDPN---------PNYA----  47

Query  401  PSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGD  580
              VP FPMG S  YDVWIS+PSS+ ERR  LL +MGL+ DP + R +P L  A     GD
Sbjct  48   --VPKFPMGASIKYDVWISEPSSVSERRSKLLSEMGLTGDPVLTRAKPHLGYA-----GD  100

Query  581  GGEFFARSVSSDQLSSPI  634
                F RSVSSD L S +
Sbjct  101  ----FGRSVSSDYLISQL  114



>ref|XP_008366762.1| PREDICTED: WD repeat-containing protein 44-like [Malus domestica]
Length=877

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 82/139 (59%), Gaps = 25/139 (18%)
 Frame = +2

Query  224  MKKAGDEEEED-ECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP  400
            M +AG+EE++D ECF++S DR++SS+ +  +S++    + +           PNYA    
Sbjct  1    MSRAGEEEDKDSECFYESLDRIVSSSCSCSTSNSDSEADPDPN---------PNYA----  47

Query  401  PSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGD  580
              VP FPMG S  YDVW S+PSSI ERR  LL +MGL+ DP + R +P L        G 
Sbjct  48   --VPKFPMGASTKYDVWTSEPSSISERRSKLLTEMGLTGDPVLTRAKPQL--------GF  97

Query  581  GGEFFARSVSSDQLSSPID  637
             GE F RSVSSD L + ++
Sbjct  98   AGE-FGRSVSSDYLIAQVN  115



>gb|EYU26402.1| hypothetical protein MIMGU_mgv1a001267mg [Erythranthe guttata]
Length=849

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 71/111 (64%), Gaps = 12/111 (11%)
 Frame = +2

Query  254  DECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFPMGVS  433
            D  FHDS DRL+SS NTSCS S   S+ E          +  N++      VP FP  V+
Sbjct  19   DVSFHDSLDRLLSSTNTSCSCSPSTSEPE----------ADSNFSPDHNEPVPKFPKSVA  68

Query  434  GNYDVWISQPSSIEERRLSLLQKMGLSRDPSIL--RHRPSLSAAECSSSGD  580
            GNYDVW SQPSS+EERRL LL++MGL+RDPS+L  RHRPSLS +  S   D
Sbjct  69   GNYDVWTSQPSSVEERRLRLLRQMGLARDPSLLRHRHRPSLSLSLASHHSD  119



>ref|XP_009378485.1| PREDICTED: WD repeat-containing protein 44 [Pyrus x bretschneideri]
Length=875

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 25/139 (18%)
 Frame = +2

Query  224  MKKAGDEEEED-ECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP  400
            M +AG EE+ED ECF++S DR++SS+ +  +S++    + +           PNYA    
Sbjct  1    MSRAGQEEDEDNECFYESLDRIVSSSCSCSTSNSDSDPDPD---------PNPNYA----  47

Query  401  PSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGD  580
              VP FPMG S  YDVWIS+PSS+ ERR  LL +MGL+ DP + R +P L        G 
Sbjct  48   --VPKFPMGASTKYDVWISEPSSVSERRSKLLTEMGLTGDPVLTRAKPQL--------GF  97

Query  581  GGEFFARSVSSDQLSSPID  637
             GE F RSVSSD L + ++
Sbjct  98   SGE-FGRSVSSDYLITQVN  115



>ref|XP_008349982.1| PREDICTED: WD repeat-containing protein 44-like [Malus domestica]
Length=875

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 22/138 (16%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M +AG EE+ED  F++S DR++SS+ +  +S++    + + +         PNYA     
Sbjct  1    MSRAGQEEDEDNEFYESLDRIVSSSCSCSTSNSDSDPDPDPD-------PNPNYA-----  48

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             VP FPMG S  YDVWIS+PSS+ ERR  LL +MGL+ DP + R +P L        G  
Sbjct  49   -VPKFPMGASTKYDVWISEPSSVSERRSKLLTEMGLTGDPVLTRAKPQL--------GFS  99

Query  584  GEFFARSVSSDQLSSPID  637
            GE F RSVSSD L + ++
Sbjct  100  GE-FGRSVSSDYLMTEVN  116



>ref|XP_009774676.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=872

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQP-PSVPC  415
            +E EE++ FHDS DRL+SS +TSCSSS+   DE+E++     LGSP NYA   P  SVP 
Sbjct  8    EEYEENDYFHDSLDRLLSSTHTSCSSSSPSEDEDEDKYPISNLGSP-NYAISDPLKSVPK  66

Query  416  FPMGVSGNYDVWISQPSSIEERRLSLLQKMGLS  514
            FPMG+  NYDVWIS+PSSIEERR  L ++MGLS
Sbjct  67   FPMGILNNYDVWISEPSSIEERRFRLFRQMGLS  99



>ref|XP_010099011.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXB76313.1| WD repeat-containing protein 44 [Morus notabilis]
Length=981

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 15/137 (11%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeee---eeeeRILGSPPNYACP  394
            M K GDEE+EDECF++S DR++SS+ +  +S++    E+E+      + I  S PNY   
Sbjct  1    MSKTGDEEDEDECFYESLDRIVSSSCSCSTSNSDSEQEQEQEEEANAKNISNSNPNYDRH  60

Query  395  QPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSS  574
             P  +P FPM VS +YDVWIS+PSS+ ERR  LL++MGLS DPS+ R +P         +
Sbjct  61   FP--IPKFPMRVS-HYDVWISEPSSVSERRRRLLREMGLSHDPSLSRAKP---------T  108

Query  575  GDGGEFFARSVSSDQLS  625
             DG   F RS SSDQL+
Sbjct  109  DDGCGEFGRSASSDQLT  125



>ref|XP_004141232.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 ref|XP_004160597.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus]
 gb|KGN55147.1| hypothetical protein Csa_4G638360 [Cucumis sativus]
Length=918

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M K+ DE+EE+ECF++S DR+ SS + S S+S    D          + + PNY    P 
Sbjct  2    MNKSVDEDEEEECFYESLDRIASSGSCSTSNSDDDRDS---------IVNSPNYDSEHPF  52

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             +P FPM VS NYD+WIS+P+S+ ERR  LL++MGLS DPS+ R   +L   E      G
Sbjct  53   PIPKFPMAVS-NYDIWISEPASVLERRSRLLREMGLSGDPSLSRANTAL---ELDHKEKG  108

Query  584  GEFFARSVSSDQLSS  628
               F RSVSSD L+S
Sbjct  109  VGDFGRSVSSDYLTS  123



>emb|CDP05886.1| unnamed protein product [Coffea canephora]
Length=896

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 74/108 (69%), Gaps = 10/108 (9%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSP--PNYACPQ  397
            M KAG+EEEEDE FHDS DRL+SS NTSCS S   S+ E+         +P  PNYA   
Sbjct  1    MSKAGEEEEEDERFHDSLDRLLSSTNTSCSCSPSSSESEDPNP----FSNPGSPNYAADG  56

Query  398  PPS----VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSI  529
                   VP FPMG+S NYDVWISQPSS++ERRL LL +MGLSRDPS+
Sbjct  57   LSDPVRVVPKFPMGLSNNYDVWISQPSSVQERRLRLLSQMGLSRDPSL  104



>gb|EPS59383.1| hypothetical protein M569_15425, partial [Genlisea aurea]
Length=486

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLS  553
            VP FP GVS NYDVW S+P S+EERR+ LL +MGL+ DPS+ RHRPSLS
Sbjct  52   VPKFPRGVSQNYDVWTSRPCSVEERRVRLLHRMGLNHDPSLSRHRPSLS  100



>ref|XP_004248274.1| PREDICTED: WD repeat-containing protein 44-like [Solanum lycopersicum]
Length=884

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KA + E+E+ECFHDS DRL+SSANTSCSSS+ PS++E             +  C    
Sbjct  1    MSKAREGEDENECFHDSLDRLLSSANTSCSSSSSPSEDE----------GEEDRDCISNW  50

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSR  517
             +P + MGV  NYDVWIS+PSSIEERRL L ++MGLSR
Sbjct  51   GLPNYAMGVLNNYDVWISEPSSIEERRLRLFRQMGLSR  88



>gb|KDO74136.1| hypothetical protein CISIN_1g002407mg [Citrus sinensis]
Length=630

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +2

Query  377  PNYACPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSA  556
            PNY       VP FPMGVS  YDVWIS+P S+ ERR  LL++MGLS D ++ R +P    
Sbjct  52   PNYEF----RVPKFPMGVSTKYDVWISEPISVSERRSRLLREMGLSHDRALARAKP---G  104

Query  557  AECSSSGDGGEFFARSVSSDQLS  625
            +E    G G   F RS S+DQL+
Sbjct  105  SEVQDRGMGNGDFGRSASTDQLT  127



>gb|KDO74135.1| hypothetical protein CISIN_1g002407mg [Citrus sinensis]
Length=755

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +2

Query  377  PNYACPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSA  556
            PNY       VP FPMGVS  YDVWIS+P S+ ERR  LL++MGLS D ++ R +P    
Sbjct  52   PNYEF----RVPKFPMGVSTKYDVWISEPISVSERRSRLLREMGLSHDRALARAKP---G  104

Query  557  AECSSSGDGGEFFARSVSSDQLS  625
            +E    G G   F RS S+DQL+
Sbjct  105  SEVQDRGMGNGDFGRSASTDQLT  127



>ref|XP_006464715.1| PREDICTED: WD repeat-containing protein 44-like [Citrus sinensis]
Length=927

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +2

Query  377  PNYACPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSA  556
            PNY       VP FPMGVS  YDVWIS+P S+ ERR  LL++MGLS D ++ R +P    
Sbjct  52   PNYEF----RVPKFPMGVSTKYDVWISEPISVSERRSRLLREMGLSHDRALARAKP---G  104

Query  557  AECSSSGDGGEFFARSVSSDQLS  625
            +E    G G   F RS S+DQL+
Sbjct  105  SEVQDRGMGNGDFGRSASTDQLT  127



>ref|XP_006451928.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 ref|XP_006451929.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|ESR65168.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|ESR65169.1| hypothetical protein CICLE_v10007384mg [Citrus clementina]
 gb|KDO74134.1| hypothetical protein CISIN_1g002407mg [Citrus sinensis]
Length=927

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +2

Query  377  PNYACPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSA  556
            PNY       VP FPMGVS  YDVWIS+P S+ ERR  LL++MGLS D ++ R +P    
Sbjct  52   PNYEF----RVPKFPMGVSTKYDVWISEPISVSERRSRLLREMGLSHDRALARAKP---G  104

Query  557  AECSSSGDGGEFFARSVSSDQLS  625
            +E    G G   F RS S+DQL+
Sbjct  105  SEVQDRGMGNGDFGRSASTDQLT  127



>ref|XP_006362948.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=883

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 10/98 (10%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M KA + E ++ECFHDS DRL+SSANTSCSSS+ PS++E                C    
Sbjct  1    MSKAREGEGKNECFHDSLDRLLSSANTSCSSSSSPSEDE----------GEEGRDCISNW  50

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSR  517
              P + MGVS NYDVWIS+PSSIEERRL L ++MGLSR
Sbjct  51   GFPNYAMGVSNNYDVWISEPSSIEERRLRLFRQMGLSR  88



>ref|NP_566515.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AAK50098.1|AF372960_1 AT3g15470/MJK13_13 [Arabidopsis thaliana]
 gb|AAF35413.1| unknown protein [Arabidopsis thaliana]
 dbj|BAB02376.1| WD-40 repeat protein-like [Arabidopsis thaliana]
 gb|AAL87370.1| AT3g15470/MJK13_13 [Arabidopsis thaliana]
 gb|AEE75680.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=883

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 15/146 (10%)
 Frame = +2

Query  224  MKKAGDEEEE----DECFHDSFDRLIssantscsssalpsDe--------eeeeeeeRIL  367
            M    +EEEE    ++CF++S DRL SS++ SCS+S    D             + E + 
Sbjct  1    MSYQNEEEEEGGDTNDCFYESLDRLASSSSCSCSASNSDYDSESSPRISSAASHDSEELY  60

Query  368  GSPPNYACPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPS  547
            G       P P  VP FPMG S  +DVW S+P+S+ ERR  LL +MGLSRDP + R +P 
Sbjct  61   GGGRRRRYPFP--VPRFPMGAS-KFDVWTSEPASVSERRSKLLNEMGLSRDPVLSRLKPV  117

Query  548  LSAAECSSSGDGGEFFARSVSSDQLS  625
              ++    +G  G   +RS+S +QL+
Sbjct  118  SDSSSSKDTGAAGFEISRSISCNQLA  143



>ref|XP_010242005.1| PREDICTED: uncharacterized protein LOC104586456 [Nelumbo nucifera]
Length=923

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 9/133 (7%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M  AGDEEEE+ECF++S DR++SS+++S SSSA  SD+++         + PNYA   PP
Sbjct  1    MSYAGDEEEEEECFYESLDRILSSSHSSSSSSAAVSDDDDPS-------NSPNYASDHPP  53

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDG  583
             V  FPM ++  YDVWI++PSSIEERR  LL++MGLS D  + R + S  +   S     
Sbjct  54   -VLKFPMALT-KYDVWIAEPSSIEERRKRLLREMGLSGDRLLSRLKSSNESNNSSGRTRE  111

Query  584  GEFFARSVSSDQL  622
             E F RSVS+D L
Sbjct  112  PELFGRSVSADPL  124



>ref|XP_002885089.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61348.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=885

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 83/147 (56%), Gaps = 19/147 (13%)
 Frame = +2

Query  224  MKKAGDEEEE---DECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACP  394
            M    +EEEE   ++CF++S DRL SS++ SCS+S    D E        + S  ++   
Sbjct  1    MSYHNEEEEEGDTNDCFYESLDRLASSSSCSCSASNSDYDSESSPR----ISSAASHDSE  56

Query  395  Q----------PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            +          P  VP FPMG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P
Sbjct  57   EHNGGGRRRRYPFPVPRFPMGAS-KFDVWISEPASVSERRSKLLNEMGLSRDPVLSRLKP  115

Query  545  SLSAAECSSSGDGGEFFARSVSSDQLS  625
             +S +    +G G    +RS+S +QL+
Sbjct  116  -VSDSSSKETGAGSSDISRSISCNQLA  141



>ref|XP_010245315.1| PREDICTED: WD repeat-containing protein 44-like [Nelumbo nucifera]
Length=928

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = +2

Query  224  MKKAGDEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPP  403
            M   GDEEE++ECF++S DR++SS+++S SSSA+ S+++E         + PNYA   PP
Sbjct  1    MSITGDEEEDEECFYESLDRILSSSHSSTSSSAVVSEDDEPS-------NSPNYASDHPP  53

Query  404  SVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG--  577
              P FP  VS  YDVWI++PSSIEERR  LL++MGLS D S+ R + S        +G  
Sbjct  54   -FPRFPTVVS-KYDVWIAEPSSIEERRKRLLREMGLSGDRSLSRLKSSNDPNHQGGTGRR  111

Query  578  -DGGEFFARSVSSDQL  622
                E F RSVS+D+L
Sbjct  112  TKETELFGRSVSADRL  127



>ref|XP_010535112.1| PREDICTED: WD repeat-containing protein 44 [Tarenaya hassleriana]
Length=914

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 16/130 (12%)
 Frame = +2

Query  254  DECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACP------QPPSVPC  415
            + CF++S DRL+SS++ S S+S    D E    +     SPP  +         P  VP 
Sbjct  18   NNCFYESLDRLVSSSSCSASNSDYDYDSEPTNSDS----SPPISSAADTRRRRNPFPVPR  73

Query  416  FPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFF  595
            FPMG S  +DVWIS+P+S+ ERR  LL++MGLSRD  ++R +P+ SA E   S D    F
Sbjct  74   FPMGAS-RFDVWISEPASVSERRSRLLREMGLSRDRGVVRLKPA-SAGEFGDSLD----F  127

Query  596  ARSVSSDQLS  625
             RS SS QL+
Sbjct  128  PRSASSCQLT  137



>ref|XP_010537008.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44 [Tarenaya hassleriana]
Length=884

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 19/132 (14%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            DEEE +ECF++S DR++SS + S S+S   SD           G   +   P P  VP F
Sbjct  11   DEEEGNECFYESLDRVLSSCSCSTSNSDYDSDP----------GISDSAHDPNPFPVPKF  60

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSI---LRHRPSLSAAECSSSGDGGE  589
            PMG  G +++W S+P S+ ERR  LL++MGLS DP +    + RP     E      G  
Sbjct  61   PMGPPG-FELWKSEPESVSERRSKLLREMGLSNDPDLPPATQFRPGSRRREM-----GSA  114

Query  590  FFARSVSSDQLS  625
             F+RSVSSD L+
Sbjct  115  HFSRSVSSDGLT  126



>gb|KDP27024.1| hypothetical protein JCGZ_20959 [Jatropha curcas]
Length=954

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 15/74 (20%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGG  586
            +P FP+     YDVWIS+P+S+ ERR  LL +MGLS DPS+ R +P           +GG
Sbjct  86   IPNFPLS---KYDVWISEPASVSERRQRLLHQMGLSSDPSLSRVKP-----------EGG  131

Query  587  EF-FARSVSSDQLS  625
            +F F RSVSSD LS
Sbjct  132  DFNFNRSVSSDHLS  145



>ref|XP_010503009.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
 ref|XP_010503014.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=901

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 7/76 (9%)
 Frame = +2

Query  398  PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG  577
            P  VP FPMG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P   + E  +S 
Sbjct  77   PFPVPRFPMGAS-KFDVWISEPASVSERRSKLLNQMGLSRDPVLSRLKP--GSKETGASS  133

Query  578  DGGEFFARSVSSDQLS  625
            D     +RS+S +QL+
Sbjct  134  D----ISRSISFNQLA  145



>ref|XP_006296948.1| hypothetical protein CARUB_v10012940mg [Capsella rubella]
 gb|EOA29846.1| hypothetical protein CARUB_v10012940mg [Capsella rubella]
Length=892

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 7/76 (9%)
 Frame = +2

Query  398  PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG  577
            P  VP FPMG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P   + E  +S 
Sbjct  71   PFPVPRFPMGAS-KFDVWISEPASVSERRSKLLNEMGLSRDPVLSRLKP--GSKETGASS  127

Query  578  DGGEFFARSVSSDQLS  625
            D     +RS+S +QL+
Sbjct  128  D----ISRSISCNQLA  139



>ref|XP_010487372.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=901

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 7/76 (9%)
 Frame = +2

Query  398  PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG  577
            P  VP FPMG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P   + E  +S 
Sbjct  77   PFPVPRFPMGAS-KFDVWISEPASVSERRSKLLNQMGLSRDPVLSRLKP--GSKETGASS  133

Query  578  DGGEFFARSVSSDQLS  625
            D     +RS+S +QL+
Sbjct  134  D----ISRSISFNQLA  145



>ref|XP_002317512.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE98124.1| WD-40 repeat family protein [Populus trichocarpa]
Length=882

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 8/62 (13%)
 Frame = +2

Query  437  NYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFARSVSSD  616
            NYDVWISQP SI ERR  LL  MGLS DPS+ R +P  +         G  +F RSVSSD
Sbjct  68   NYDVWISQPESISERRQRLLHNMGLSSDPSLSRSKPETT--------HGDFYFKRSVSSD  119

Query  617  QL  622
            +L
Sbjct  120  RL  121



>ref|XP_011029441.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=938

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 8/62 (13%)
 Frame = +2

Query  437  NYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFARSVSSD  616
            NYDVWISQP SI ERR  LL  MGLS DPS+ R +P  +         G  +F RSVSSD
Sbjct  68   NYDVWISQPESISERRQRLLHTMGLSSDPSLSRSKPETT--------HGDFYFNRSVSSD  119

Query  617  QL  622
            +L
Sbjct  120  RL  121



>ref|XP_006406965.1| hypothetical protein EUTSA_v10020024mg [Eutrema salsugineum]
 gb|ESQ48418.1| hypothetical protein EUTSA_v10020024mg [Eutrema salsugineum]
Length=888

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 73/126 (58%), Gaps = 12/126 (10%)
 Frame = +2

Query  260  CFHDSFDRLIssantscsssalpsDeeeeeeee--RILGSPPNYACPQ--PPSVPCFPMG  427
            CF++S DRL SS++ SCS+S    D +    E   RI    PN    +  P  VP FPMG
Sbjct  14   CFYESLDRLASSSSCSCSASNSDYDSDLANSESSPRISSEEPNGTRRRRYPFPVPRFPMG  73

Query  428  VSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG-DGGEFFARS  604
             S  +DVWIS+P+S+ ERR  LL +MGLSR+P   R +P       S SG +G    +RS
Sbjct  74   -SSRFDVWISEPASVSERRSRLLSEMGLSREPLHSRLKP------VSDSGSNGASDISRS  126

Query  605  VSSDQL  622
            +S +QL
Sbjct  127  ISCNQL  132



>ref|XP_008802503.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Phoenix 
dactylifera]
Length=668

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL-SAAECSSSGDG  583
            VP FP  ++ +YDVWIS+PSS+EERR  LL +MGL+ DP++ R RP+     +C  +  G
Sbjct  48   VPRFPPPIAASYDVWISEPSSVEERRRRLLHQMGLTADPALSRSRPAAPDGGDCGIADVG  107

Query  584  GEFFARSVSSDQL  622
                 RSVS D L
Sbjct  108  -----RSVSCDGL  115



>ref|XP_010935623.1| PREDICTED: WD repeat-containing protein 44-like [Elaeis guineensis]
Length=857

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGG  586
            VP FP+ ++ +YD+WIS+PSSIEERR  LL +MGL+ DP++ R  P+         GDGG
Sbjct  49   VPRFPLPIAASYDLWISEPSSIEERRRRLLHQMGLAADPALSRSLPA-----APDGGDGG  103

Query  587  -EFFARSVSSDQL  622
                 RSV +D L
Sbjct  104  IADVGRSVLADGL  116



>ref|XP_008802494.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Phoenix 
dactylifera]
Length=857

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSL-SAAECSSSGDG  583
            VP FP  ++ +YDVWIS+PSS+EERR  LL +MGL+ DP++ R RP+     +C  +  G
Sbjct  48   VPRFPPPIAASYDVWISEPSSVEERRRRLLHQMGLTADPALSRSRPAAPDGGDCGIADVG  107

Query  584  GEFFARSVSSDQL  622
                 RSVS D L
Sbjct  108  -----RSVSCDGL  115



>ref|XP_010465516.1| PREDICTED: WD repeat-containing protein 44-like [Camelina sativa]
Length=891

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 7/76 (9%)
 Frame = +2

Query  398  PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSG  577
            P  VP FPMG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P   + E  +S 
Sbjct  73   PFPVPRFPMGAS-KFDVWISEPASVSERRSKLLNQMGLSRDPVLSRLKP--GSKETGASS  129

Query  578  DGGEFFARSVSSDQLS  625
            D     +RS+S + L+
Sbjct  130  D----ISRSISFNHLA  141



>ref|XP_011013674.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Populus 
euphratica]
Length=941

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +2

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFA  598
            P  ++ NY VWISQP SI ERR  LL +MGLS DPS+ R +P     E +++GD   +F 
Sbjct  61   PRLLASNYHVWISQPESISERRQRLLLQMGLSSDPSLSRSKP-----ETANNGDF--YFN  113

Query  599  RSVSSDQL  622
            RS+SSD+L
Sbjct  114  RSLSSDRL  121



>ref|XP_011042491.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Populus 
euphratica]
Length=941

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +2

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFA  598
            P  ++ NY VWISQP SI ERR  LL +MGLS DPS+ R +P     E +++GD   +F 
Sbjct  61   PRLLASNYHVWISQPESISERRQRLLLQMGLSSDPSLSRSKP-----ETANNGDF--YFN  113

Query  599  RSVSSDQL  622
            RS+SSD+L
Sbjct  114  RSLSSDRL  121



>gb|KFK38890.1| hypothetical protein AALP_AA3G174300 [Arabis alpina]
Length=866

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 78/149 (52%), Gaps = 20/149 (13%)
 Frame = +2

Query  224  MKKAGDEEEED-ECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQ-  397
            M    +EEE D +CF++S DRL SS++ SCS+S    D +    E   L S      P+ 
Sbjct  1    MSNPNEEEEGDTDCFYESLDRLASSSSCSCSASNSDYDSDHANSESSPLISSAASHDPEE  60

Query  398  ------------PPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHR  541
                        P  VP FPMG S  +DVWIS+P S+ ERR  LL +MGL+R+P   R +
Sbjct  61   SNDGGHRRNRRYPFPVPRFPMG-SSRFDVWISEPVSVSERRSKLLNEMGLTREPVTSRLK  119

Query  542  PSLSAAECSSSGDGGEF-FARSVSSDQLS  625
            P       S S D   F  +RS+S +QL+
Sbjct  120  P----VSDSGSKDARAFDISRSISCNQLA  144



>ref|XP_011042489.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
 ref|XP_011042490.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
Length=964

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +2

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFA  598
            P  ++ NY VWISQP SI ERR  LL +MGLS DPS+ R +P     E +++GD   +F 
Sbjct  61   PRLLASNYHVWISQPESISERRQRLLLQMGLSSDPSLSRSKP-----ETANNGDF--YFN  113

Query  599  RSVSSDQL  622
            RS+SSD+L
Sbjct  114  RSLSSDRL  121



>ref|XP_011013673.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Populus 
euphratica]
Length=964

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +2

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFA  598
            P  ++ NY VWISQP SI ERR  LL +MGLS DPS+ R +P     E +++GD   +F 
Sbjct  61   PRLLASNYHVWISQPESISERRQRLLLQMGLSSDPSLSRSKP-----ETANNGDF--YFN  113

Query  599  RSVSSDQL  622
            RS+SSD+L
Sbjct  114  RSLSSDRL  121



>ref|XP_006370296.1| hypothetical protein POPTR_0001s41390g [Populus trichocarpa]
 gb|ERP66865.1| hypothetical protein POPTR_0001s41390g [Populus trichocarpa]
Length=913

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 7/68 (10%)
 Frame = +2

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFA  598
            P  ++ NY VWISQP SI ERR  LL +MGLS DPS+ R +P     E + +GD   +F 
Sbjct  61   PRLLASNYHVWISQPESISERRQRLLLQMGLSSDPSLSRSKP-----ETAHNGD--FYFN  113

Query  599  RSVSSDQL  622
            RS+SSD+L
Sbjct  114  RSLSSDRL  121



>ref|XP_010060531.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW67310.1| hypothetical protein EUGRSUZ_F01096 [Eucalyptus grandis]
Length=874

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 72/125 (58%), Gaps = 20/125 (16%)
 Frame = +2

Query  242  EEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFP  421
            E++E+E F++S DR+ SS++ SCS+S    ++              N+A  +   VP FP
Sbjct  26   EDDEEEHFYESLDRITSSSSCSCSNSDDEPEDAAL---------DSNFASLKKLRVPKFP  76

Query  422  MGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEF-FA  598
              V+  YDVWIS+PSS+ ERR  LLQ+MGL         RP+LS A   +  D G+  FA
Sbjct  77   KSVA-RYDVWISEPSSVLERRSRLLQEMGLGA-------RPALSLA--GTEKDAGQVDFA  126

Query  599  RSVSS  613
            RSVSS
Sbjct  127  RSVSS  131



>ref|XP_010060530.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Eucalyptus 
grandis]
Length=910

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 73/128 (57%), Gaps = 20/128 (16%)
 Frame = +2

Query  242  EEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFP  421
            E++E+E F++S DR+ SS++ SCS+S    ++              N+A  +   VP FP
Sbjct  26   EDDEEEHFYESLDRITSSSSCSCSNSDDEPEDAAL---------DSNFASLKKLRVPKFP  76

Query  422  MGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEF-FA  598
              V+  YDVWIS+PSS+ ERR  LLQ+MGL         RP+LS A   +  D G+  FA
Sbjct  77   KSVA-RYDVWISEPSSVLERRSRLLQEMGLGA-------RPALSLA--GTEKDAGQVDFA  126

Query  599  RSVSSDQL  622
            RSVSS  L
Sbjct  127  RSVSSHCL  134



>ref|XP_002862468.1| hypothetical protein ARALYDRAFT_359594 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38726.1| hypothetical protein ARALYDRAFT_359594 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +2

Query  422  MGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFAR  601
            MG S  +DVWIS+P+S+ ERR  LL +MGLSRDP + R +P +S +    +G G    +R
Sbjct  1    MGAS-KFDVWISEPASVSERRSKLLNEMGLSRDPVLSRLKP-VSDSSFKETGAGSSDISR  58

Query  602  SVSSDQLS  625
            S+S +QL+
Sbjct  59   SISCNQLA  66



>gb|KHG15000.1| WD repeat-containing 44 [Gossypium arboreum]
Length=928

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 15/129 (12%)
 Frame = +2

Query  260  CFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFPMGVSGN  439
             F++S DR+ SS + SCS+S  PS + + +   R      N   P P  VP FPM VS  
Sbjct  31   YFYESLDRIASSNSCSCSNSTTPSSDSDSDPVTR----SSNARHPFP--VPKFPMAVS-K  83

Query  440  YDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP----SLSAAECSSSGDGG----EFF  595
            +D+WIS+P+S+ ERR  LL++MGLSRDP + R  P     L       +GD G    +  
Sbjct  84   FDIWISEPASVSERRTRLLREMGLSRDPGLSRSIPGSETELGLGREMGAGDAGGRGVQLE  143

Query  596  ARSVSSDQL  622
             RSVSSD+L
Sbjct  144  RRSVSSDRL  152



>ref|XP_009146242.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=845

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 17/125 (14%)
 Frame = +2

Query  263  FHDSFDRLIssantscsssalpsDeeeeeeeeRIL-----GSPPNYACPQPPSVPCFPMG  427
            FHDS DRL+SS++ SCS+S    D E              G+P     P P  VP FPMG
Sbjct  15   FHDSLDRLVSSSSCSCSASNSDYDSESSPRISSSHDPDGGGAPRRRHHPFP--VPRFPMG  72

Query  428  VSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFARSV  607
             S  +D+WIS+P+S+ ERR  LL +MGL+R+P   R +P           D G   +RS+
Sbjct  73   AS-RFDLWISEPASVSERRSKLLTEMGLNREPVQSRLKP---------VSDSGPDISRSI  122

Query  608  SSDQL  622
            S +QL
Sbjct  123  SCNQL  127



>gb|KHG27240.1| WD repeat-containing 44 [Gossypium arboreum]
 gb|KHG29204.1| WD repeat-containing 44 [Gossypium arboreum]
Length=909

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            ++E E+E F+DS DR+ SS + SCS+SA PS + + +       +P N A   P  VP F
Sbjct  25   NQEAEEEYFYDSLDRIASSNSCSCSNSASPSSDSDSDPI-----APSNNA-HHPFPVPKF  78

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            P  VS  +D+WIS+PSS+ ERR  LL+ MGLSR P + R RP
Sbjct  79   PKVVS-QFDIWISEPSSVSERRTRLLRDMGLSRHPGLSRIRP  119



>emb|CDY56822.1| BnaC05g37770D [Brassica napus]
Length=773

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 69/130 (53%), Gaps = 25/130 (19%)
 Frame = +2

Query  263  FHDSFDRLIssantscsssalpsDeeeeeeeeRIL----------GSPPNYACPQPPSVP  412
            FHDS DRL+SS++ SCS+S    D E      RI           G P     P P  VP
Sbjct  15   FHDSLDRLVSSSSCSCSASNSDYDSESSP---RISSHDPEEPDGGGGPRRRHHPFP--VP  69

Query  413  CFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEF  592
             FPMG S  +D+WIS+P+S+ ERR  LL +MGL+R+P   R +P           D G  
Sbjct  70   RFPMGAS-RFDLWISEPASVSERRSKLLTEMGLNREPVRSRLKP---------VSDSGSD  119

Query  593  FARSVSSDQL  622
             +RS+S +QL
Sbjct  120  ISRSISCNQL  129



>ref|XP_010062889.1| PREDICTED: WD repeat-containing protein 44-like [Eucalyptus grandis]
 gb|KCW70030.1| hypothetical protein EUGRSUZ_F03337 [Eucalyptus grandis]
Length=912

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 43/78 (55%), Gaps = 14/78 (18%)
 Frame = +2

Query  407  VPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGL-----SRDPSILRHRPSLSAAECSS  571
            VP FP GV   YDVWISQPSS+ ERR  LL +MGL     + DPS+ R +P      C  
Sbjct  64   VPRFPAGVF-RYDVWISQPSSVSERRSRLLHEMGLAAAAAAADPSLPRAKPGKELGHCD-  121

Query  572  SGDGGEFFARSVSSDQLS  625
                   F RS S+D L+
Sbjct  122  -------FWRSASADHLT  132



>ref|XP_004293101.1| PREDICTED: WD repeat-containing protein 44 [Fragaria vesca subsp. 
vesca]
Length=878

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 18/121 (15%)
 Frame = +2

Query  260  CFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFPMGVSGN  439
            CF++S DR+++S++ SCS+S    D ++  + +    +  NYA  +    P FPM     
Sbjct  15   CFYESLDRILTSSSCSCSTSNSDDDTDDISDSD---AASANYASRRRFPTPRFPMEAY-K  70

Query  440  YDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFFARSVSSDQ  619
            YDVWIS+P+S+ +RR  LL++M LS DP++ R +P              E   RSVSSD 
Sbjct  71   YDVWISEPASVSDRRSRLLREMRLSGDPALSRAKP--------------ETVGRSVSSDH  116

Query  620  L  622
            L
Sbjct  117  L  117



>ref|XP_009398403.1| PREDICTED: WD repeat-containing protein 44-like [Musa acuminata 
subsp. malaccensis]
Length=870

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  416  FPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPS  547
            FP  V+ +YDVWIS+PSS+EERR  LLQ+MGL  DP++ R + +
Sbjct  63   FPPPVASSYDVWISEPSSVEERRRRLLQQMGLIGDPALARAKST  106



>gb|KJB81918.1| hypothetical protein B456_013G167600 [Gossypium raimondii]
Length=911

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            ++E E+E F+DS DR+ SS + SCS+SA PS + + +       +P N A   P  VP F
Sbjct  25   NQEAEEEYFYDSLDRIASSNSCSCSNSASPSSDSDSDPI-----TPSNNA-HHPFPVPKF  78

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            P  VS  +D+WIS+PSS+ ERR  L ++MGLSR   + R RP
Sbjct  79   PKVVS-QFDIWISEPSSVSERRTRLHREMGLSRHLGLCRIRP  119



>gb|KJB81920.1| hypothetical protein B456_013G167600 [Gossypium raimondii]
Length=917

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            ++E E+E F+DS DR+ SS + SCS+SA PS + + +       +P N A   P  VP F
Sbjct  25   NQEAEEEYFYDSLDRIASSNSCSCSNSASPSSDSDSDPI-----TPSNNA-HHPFPVPKF  78

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            P  VS  +D+WIS+PSS+ ERR  L ++MGLSR   + R RP
Sbjct  79   PKVVS-QFDIWISEPSSVSERRTRLHREMGLSRHLGLCRIRP  119



>ref|XP_007021341.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY12866.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=937

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query  260  CFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCFPMGVSGN  439
             F++S DR+ SS + SCS+S  PS + + +   R      N   P P  VP FPM VS  
Sbjct  35   YFYESLDRIASSNSCSCSNSTSPSSDSDSDPITR----SNNAHHPFP--VPKFPMAVS-K  87

Query  440  YDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            +D+WIS+P+S+ ERR  LL++MGLSRD  + R RP
Sbjct  88   FDIWISEPASVSERRTRLLREMGLSRDRGLSRTRP  122



>gb|KJB81919.1| hypothetical protein B456_013G167600 [Gossypium raimondii]
Length=662

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +2

Query  239  DEEEEDECFHDSFDRLIssantscsssalpsDeeeeeeeeRILGSPPNYACPQPPSVPCF  418
            ++E E+E F+DS DR+ SS + SCS+SA PS + + +       +P N A   P  VP F
Sbjct  25   NQEAEEEYFYDSLDRIASSNSCSCSNSASPSSDSDSDPI-----TPSNNA-HHPFPVPKF  78

Query  419  PMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            P  VS  +D+WIS+PSS+ ERR  L ++MGLSR   + R RP
Sbjct  79   PKVVS-QFDIWISEPSSVSERRTRLHREMGLSRHLGLCRIRP  119



>ref|XP_010918446.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44-like [Elaeis guineensis]
Length=868

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 9/75 (12%)
 Frame = +2

Query  416  FPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEF-  592
            FP+  S + DVWIS+P+S+E RR  LLQ++GL+ DP++ R +   S A     G GGE  
Sbjct  54   FPLPSSVSLDVWISEPASVEVRRRRLLQQLGLAGDPALARRK---SPAAGDPDGAGGEVG  110

Query  593  -----FARSVSSDQL  622
                   RSVS D L
Sbjct  111  IRKGEIGRSVSCDGL  125



>ref|XP_004487750.1| PREDICTED: uncharacterized protein LOC101506788 [Cicer arietinum]
Length=1057

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  440  YDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRP  544
            YD+WISQPSS+ ERR  LLQ +GLS DPS+ R  P
Sbjct  72   YDIWISQPSSVSERRTRLLQTIGLSSDPSLSRGNP  106



>ref|XP_010932998.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
44-like [Elaeis guineensis]
Length=800

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  389  CPQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECS  568
            C +   +P FP   S + DVWIS+P+SIEERR  L Q++GL+ DP++ R +   +     
Sbjct  35   CRRRRHLPRFPPPSSVSLDVWISEPASIEERRQRLFQQLGLAGDPALARRKAPAADGPPG  94

Query  569  SSGDGGEFFARSVSSDQL  622
             +        RSVS D L
Sbjct  95   EARTRTGVVGRSVSCDGL  112



>ref|XP_008790501.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera]
Length=862

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = +2

Query  416  FPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSILRHRPSLSAAECSSSGDGGEFF  595
            FP   + + DVWIS+P+S+EERR  LLQ++GL+ DP++ R +   +       G+ G   
Sbjct  55   FPPLSAVSLDVWISEPASVEERRRRLLQQLGLAGDPALARLKSPAAGEAGIREGEIG---  111

Query  596  ARSVSSDQL  622
             RSVSSD L
Sbjct  112  -RSVSSDGL  119



>gb|KFK27037.1| hypothetical protein AALP_AA8G325800 [Arabis alpina]
Length=855

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  392  PQPPSVPCFPMGVSGNYDVWISQPSSIEERRLSLLQKMGLSRDPSI  529
            P P  VP FPMG SG +++W S+P S+ ERR+ LL+ +GLS +P +
Sbjct  61   PNPFPVPRFPMGNSG-FELWKSEPESVSERRIRLLRGLGLSNEPDL  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125