BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS117B11

Length=584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234317.1|  TBG6 protein precursor                             339   1e-107   Solanum lycopersicum
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               338   2e-107   Solanum tuberosum [potatoes]
gb|ADO34791.1|  beta-galactosidase STBG6                                337   5e-107   Solanum lycopersicum
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    334   8e-106   Nicotiana sylvestris
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    334   9e-106   Nicotiana tomentosiformis
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                333   2e-105   Erythranthe guttata [common monkey flower]
gb|KHF97862.1|  Beta-galactosidase 3                                    322   2e-104   Gossypium arboreum [tree cotton]
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                323   2e-102   Erythranthe guttata [common monkey flower]
gb|KJB43420.1|  hypothetical protein B456_007G198900                    319   3e-102   Gossypium raimondii
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     320   1e-101   
gb|KJB43418.1|  hypothetical protein B456_007G198900                    318   3e-101   Gossypium raimondii
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     320   3e-100   
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   314   3e-100   Citrus sinensis [apfelsine]
gb|KJB43423.1|  hypothetical protein B456_007G198900                    318   5e-100   Gossypium raimondii
gb|KJB43422.1|  hypothetical protein B456_007G198900                    318   8e-100   Gossypium raimondii
gb|KJB43424.1|  hypothetical protein B456_007G198900                    318   8e-100   Gossypium raimondii
gb|KJB43419.1|  hypothetical protein B456_007G198900                    318   1e-99    Gossypium raimondii
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    317   4e-99    Vitis vinifera
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               317   5e-99    Sesamum indicum [beniseed]
ref|XP_010113483.1|  Beta-galactosidase 3                               316   6e-99    Morus notabilis
gb|EPS70273.1|  beta-galactosidase                                      310   2e-98    Genlisea aurea
ref|XP_007158612.1|  hypothetical protein PHAVU_002G1672000g            301   2e-98    Phaseolus vulgaris [French bean]
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             309   3e-98    
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   313   5e-98    Citrus sinensis [apfelsine]
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             310   5e-98    
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    314   6e-98    Fragaria vesca subsp. vesca
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       311   7e-98    Cucumis sativus [cucumbers]
gb|KJB17716.1|  hypothetical protein B456_003G011900                    313   7e-98    Gossypium raimondii
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   313   1e-97    Citrus sinensis [apfelsine]
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    311   4e-97    Populus euphratica
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             311   4e-97    Citrus clementina [clementine]
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               311   6e-97    Cucumis sativus [cucumbers]
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    311   7e-97    Cucumis melo [Oriental melon]
gb|AAW47739.1|  beta-galactosidase                                      311   9e-97    Prunus persica
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               310   2e-96    
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    309   3e-96    Prunus mume [ume]
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    308   5e-96    Eucalyptus grandis [rose gum]
ref|XP_002310279.2|  beta-galactosidase family protein                  308   6e-96    
ref|NP_568001.1|  beta-galactosidase 3                                  308   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849506.1|  beta-galactosidase 3                                  308   1e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CAA18137.1|  beta-galactosidase like protein                        307   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               305   8e-95    Nelumbo nucifera [Indian lotus]
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             305   9e-95    
gb|KJB58183.1|  hypothetical protein B456_009G198100                    298   2e-94    Gossypium raimondii
emb|CAB16852.1|  beta-galactosidase like protein                        305   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              305   2e-94    Vitis vinifera
emb|CBI19767.3|  unnamed protein product                                305   2e-94    Vitis vinifera
emb|CAN78072.1|  hypothetical protein VITISV_013292                     305   2e-94    Vitis vinifera
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             304   2e-94    Capsella rubella
ref|XP_006412010.1|  hypothetical protein EUTSA_v10024387mg             299   2e-94    
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               304   3e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               304   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    303   4e-94    Vitis vinifera
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    303   8e-94    Sesamum indicum [beniseed]
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    302   1e-93    
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               302   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    302   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               302   2e-93    Glycine max [soybeans]
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             299   2e-93    Phaseolus vulgaris [French bean]
dbj|BAD91082.1|  beta-D-galactosidase                                   301   3e-93    Pyrus pyrifolia [sha li]
ref|XP_002510455.1|  beta-galactosidase, putative                       301   3e-93    Ricinus communis
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               301   3e-93    Glycine max [soybeans]
gb|KHN27041.1|  Beta-galactosidase 3                                    301   3e-93    Glycine soja [wild soybean]
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               301   4e-93    Glycine max [soybeans]
emb|CDX75569.1|  BnaA01g01330D                                          300   4e-93    
emb|CDP01954.1|  unnamed protein product                                301   4e-93    Coffea canephora [robusta coffee]
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    301   5e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    301   5e-93    Brassica rapa
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               300   8e-93    
dbj|BAF31234.1|  beta-D-galactosidase                                   300   9e-93    Persea americana
gb|KHN36067.1|  Beta-galactosidase 3                                    300   9e-93    Glycine soja [wild soybean]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               300   9e-93    
gb|KHN41933.1|  Beta-galactosidase 3                                    300   1e-92    Glycine soja [wild soybean]
gb|KJB58182.1|  hypothetical protein B456_009G198100                    297   1e-92    Gossypium raimondii
ref|XP_002305449.1|  beta-galactosidase family protein                  297   1e-92    Populus trichocarpa [western balsam poplar]
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      298   1e-92    Gossypium arboreum [tree cotton]
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             300   1e-92    
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               300   1e-92    
emb|CDO97013.1|  unnamed protein product                                297   2e-92    Coffea canephora [robusta coffee]
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             299   2e-92    Phaseolus vulgaris [French bean]
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    299   2e-92    Arabis alpina [alpine rockcress]
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             299   3e-92    Eutrema salsugineum [saltwater cress]
dbj|BAJ34544.1|  unnamed protein product                                299   3e-92    Eutrema halophilum
gb|KHN00504.1|  Beta-galactosidase 3                                    298   4e-92    Glycine soja [wild soybean]
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                     293   5e-92    
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    295   5e-92    Nicotiana sylvestris
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    298   5e-92    Tarenaya hassleriana [spider flower]
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         298   7e-92    Jatropha curcas
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               296   8e-92    Populus euphratica
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    295   9e-92    Nicotiana tomentosiformis
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               297   1e-91    Cicer arietinum [garbanzo]
gb|AAF67342.1|  beta galactosidase                                      293   3e-91    Vigna radiata [mung bean]
emb|CDX69219.1|  BnaC01g02340D                                          295   4e-91    
gb|KHN12675.1|  Beta-galactosidase 5                                    293   5e-91    Glycine soja [wild soybean]
gb|KJB32548.1|  hypothetical protein B456_005G246600                    289   5e-91    Gossypium raimondii
gb|KJB63588.1|  hypothetical protein B456_010G007300                    289   5e-91    Gossypium raimondii
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     293   6e-91    Theobroma cacao [chocolate]
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               292   7e-91    
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   290   1e-90    Citrus sinensis [apfelsine]
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             295   1e-90    Prunus persica
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               294   1e-90    Sesamum indicum [beniseed]
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               294   1e-90    Prunus mume [ume]
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    292   1e-90    Solanum lycopersicum
gb|KJB63586.1|  hypothetical protein B456_010G007300                    286   2e-90    Gossypium raimondii
emb|CDY59693.1|  BnaC07g51120D                                          294   2e-90    Brassica napus [oilseed rape]
gb|KCW64027.1|  hypothetical protein EUGRSUZ_G01704                     286   4e-90    Eucalyptus grandis [rose gum]
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    290   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_002306893.1|  beta-galactosidase family protein                  292   7e-90    Populus trichocarpa [western balsam poplar]
gb|KHN20946.1|  Beta-galactosidase 5                                    290   8e-90    Glycine soja [wild soybean]
ref|XP_003589339.1|  Beta-galactosidase                                 290   8e-90    Medicago truncatula
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                290   9e-90    Cicer arietinum [garbanzo]
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               292   1e-89    
dbj|BAD91085.1|  beta-D-galactosidase                                   291   1e-89    Pyrus pyrifolia [sha li]
ref|XP_003612092.1|  Beta-galactosidase                                 291   2e-89    Medicago truncatula
gb|KJB32549.1|  hypothetical protein B456_005G246600                    288   2e-89    Gossypium raimondii
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   289   2e-89    Citrus sinensis [apfelsine]
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    289   2e-89    
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             288   2e-89    Eutrema salsugineum [saltwater cress]
gb|KJB63587.1|  hypothetical protein B456_010G007300                    288   3e-89    Gossypium raimondii
gb|KJB63585.1|  hypothetical protein B456_010G007300                    288   3e-89    Gossypium raimondii
emb|CDP11590.1|  unnamed protein product                                271   3e-89    Coffea canephora [robusta coffee]
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    288   3e-89    Brassica rapa
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   290   3e-89    Citrus sinensis [apfelsine]
gb|KJB32547.1|  hypothetical protein B456_005G246600                    288   3e-89    Gossypium raimondii
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   290   4e-89    Citrus sinensis [apfelsine]
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      288   4e-89    Gossypium arboreum [tree cotton]
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               290   5e-89    Cucumis sativus [cucumbers]
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    287   7e-89    Sesamum indicum [beniseed]
gb|KHN45883.1|  Beta-galactosidase 5                                    287   7e-89    Glycine soja [wild soybean]
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     287   8e-89    Glycine max [soybeans]
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   290   8e-89    Citrus sinensis [apfelsine]
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             290   8e-89    Citrus clementina [clementine]
gb|KDO49473.1|  hypothetical protein CISIN_1g0051602mg                  278   9e-89    Citrus sinensis [apfelsine]
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               289   9e-89    Phoenix dactylifera
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               289   9e-89    Citrus sinensis [apfelsine]
ref|XP_010110010.1|  Beta-galactosidase 3                               289   9e-89    
emb|CDY47949.1|  BnaA10g28210D                                          286   1e-88    Brassica napus [oilseed rape]
ref|XP_010066194.1|  PREDICTED: beta-galactosidase 5-like isoform X3    286   1e-88    
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       288   1e-88    Oryza sativa Japonica Group [Japonica rice]
emb|CDY53959.1|  BnaCnng25850D                                          286   1e-88    Brassica napus [oilseed rape]
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    289   1e-88    Populus euphratica
gb|AAM22973.1|AF499737_1  beta-galactosidase                            289   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049068.1|  Os03g0165400                                       289   1e-88    
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               288   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    285   3e-88    Eucalyptus grandis [rose gum]
gb|KGN59998.1|  hypothetical protein Csa_3G865330                       286   4e-88    Cucumis sativus [cucumbers]
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g             285   4e-88    Phaseolus vulgaris [French bean]
emb|CDY36028.1|  BnaA08g04330D                                          285   5e-88    Brassica napus [oilseed rape]
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2    285   5e-88    Eucalyptus grandis [rose gum]
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               287   6e-88    Oryza brachyantha
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               287   6e-88    
gb|EEE58382.1|  hypothetical protein OsJ_09539                          287   6e-88    Oryza sativa Japonica Group [Japonica rice]
gb|AGR44466.1|  beta-D-galactosidase 7                                  287   6e-88    Pyrus x bretschneideri [bai li]
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1    285   7e-88    Eucalyptus grandis [rose gum]
gb|EEC74580.1|  hypothetical protein OsI_10152                          287   7e-88    Oryza sativa Indica Group [Indian rice]
dbj|BAD91084.1|  beta-D-galactosidase                                   287   7e-88    Pyrus pyrifolia [sha li]
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               284   8e-88    Nicotiana tomentosiformis
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               287   8e-88    Cucumis melo [Oriental melon]
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             286   9e-88    Prunus persica
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             284   1e-87    
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5                    284   1e-87    Fragaria vesca subsp. vesca
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                286   1e-87    Erythranthe guttata [common monkey flower]
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    286   1e-87    Brachypodium distachyon [annual false brome]
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    283   1e-87    Arabis alpina [alpine rockcress]
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    286   1e-87    Prunus mume [ume]
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               283   2e-87    Nicotiana sylvestris
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    286   2e-87    Zea mays [maize]
emb|CAB64741.1|  putative beta-galactosidase                            283   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175127.1|  beta-galactosidase 5                                  283   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               283   2e-87    Solanum lycopersicum
dbj|BAJ96054.1|  predicted protein                                      286   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL24206.1|  At1g45130/F27F5_20                                      283   2e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK07157.1|  predicted protein                                      285   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               285   3e-87    Cucumis sativus [cucumbers]
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             283   3e-87    Capsella rubella
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          285   3e-87    Amborella trichopoda
emb|CDP07463.1|  unnamed protein product                                285   4e-87    Coffea canephora [robusta coffee]
gb|KEH36209.1|  beta-galactosidase-like protein                         282   5e-87    Medicago truncatula
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               285   6e-87    Cucumis melo [Oriental melon]
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               284   8e-87    Elaeis guineensis
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    284   1e-86    
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               283   2e-86    Elaeis guineensis
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             280   2e-86    
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2    278   2e-86    
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    283   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 280   4e-86    Eucalyptus grandis [rose gum]
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               280   5e-86    Solanum tuberosum [potatoes]
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               282   7e-86    Phoenix dactylifera
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                279   7e-86    Erythranthe guttata [common monkey flower]
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               279   7e-86    Citrus sinensis [apfelsine]
gb|KJB65165.1|  hypothetical protein B456_010G082900                    277   8e-86    Gossypium raimondii
gb|EYU45189.1|  hypothetical protein MIMGU_mgv1a003101mg                276   9e-86    Erythranthe guttata [common monkey flower]
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 279   1e-85    Sesamum indicum [beniseed]
gb|ABR16628.1|  unknown                                                 281   1e-85    Picea sitchensis
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               281   2e-85    Fragaria vesca subsp. vesca
ref|XP_002512959.1|  beta-galactosidase, putative                       278   2e-85    Ricinus communis
gb|EMT10014.1|  Beta-galactosidase 5                                    280   2e-85    
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    280   4e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1    277   4e-85    Cicer arietinum [garbanzo]
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    280   5e-85    Pyrus x bretschneideri [bai li]
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    280   5e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    279   5e-85    Zea mays [maize]
gb|KJB65166.1|  hypothetical protein B456_010G082900                    276   5e-85    Gossypium raimondii
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    278   1e-84    Setaria italica
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 276   1e-84    Solanum tuberosum [potatoes]
emb|CDX88594.1|  BnaA03g10550D                                          265   2e-84    
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      277   4e-84    Nelumbo nucifera [Indian lotus]
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          276   5e-84    Sorghum bicolor [broomcorn]
ref|NP_194344.2|  beta-galactosidase 12                                 272   6e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 274   6e-84    Eucalyptus grandis [rose gum]
gb|KGN53283.1|  hypothetical protein Csa_4G044980                       258   7e-84    Cucumis sativus [cucumbers]
gb|KJB65169.1|  hypothetical protein B456_010G082900                    276   7e-84    Gossypium raimondii
ref|NP_001266133.1|  beta-galactosidase-like                            274   9e-84    Cicer arietinum [garbanzo]
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                    268   1e-83    Eucalyptus grandis [rose gum]
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     274   1e-83    
gb|KJB65170.1|  hypothetical protein B456_010G082900                    275   2e-83    Gossypium raimondii
gb|KJB65167.1|  hypothetical protein B456_010G082900                    275   2e-83    Gossypium raimondii
gb|AHL69742.1|  beta-galactosidase                                      275   2e-83    Hylocereus undatus [dragon fruit]
gb|AAC25984.1|  beta-galactosidase                                      273   2e-83    Solanum lycopersicum
gb|ADO34789.1|  beta-galactosidase STBG4                                273   2e-83    Solanum lycopersicum
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      274   2e-83    
dbj|BAF31233.1|  beta-D-galactosidase                                   275   2e-83    Persea americana
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                    268   3e-83    Eucalyptus grandis [rose gum]
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...    269   3e-83    Tarenaya hassleriana [spider flower]
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           275   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 274   4e-83    Nicotiana sylvestris
ref|XP_004174126.1|  PREDICTED: beta-galactosidase-like                 255   4e-83    
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           274   4e-83    Nelumbo nucifera [Indian lotus]
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                     270   4e-83    Eucalyptus grandis [rose gum]
gb|ADV41669.1|  beta-D-galactosidase                                    272   4e-83    Actinidia deliciosa var. deliciosa
ref|XP_010107841.1|  Beta-galactosidase 3                               274   4e-83    Morus notabilis
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     272   5e-83    Eucalyptus grandis [rose gum]
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    271   6e-83    Solanum lycopersicum
ref|NP_849553.1|  beta-galactosidase 12                                 271   6e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CAB39679.1|  putative beta-galactosidase                            271   6e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAF67341.1|  beta galactosidase                                      271   6e-83    Vigna radiata [mung bean]
gb|KEH39519.1|  beta-galactosidase                                      268   8e-83    Medicago truncatula
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             271   8e-83    Phaseolus vulgaris [French bean]
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                   268   1e-82    Citrus sinensis [apfelsine]
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     270   1e-82    Eucalyptus grandis [rose gum]
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 271   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 270   2e-82    Cucumis melo [Oriental melon]
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 270   2e-82    
ref|NP_001234842.1|  ss-galactosidase precursor                         270   2e-82    
ref|XP_003595163.1|  Beta-galactosidase                                 268   2e-82    
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 270   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              270   2e-82    Brassica rapa
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             270   2e-82    Eutrema salsugineum [saltwater cress]
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   268   2e-82    Citrus sinensis [apfelsine]
gb|AAN60229.1|  unknown                                                 266   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KDP40776.1|  hypothetical protein JCGZ_24775                         265   2e-82    Jatropha curcas
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                   268   2e-82    Citrus sinensis [apfelsine]
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       268   2e-82    Cucumis sativus [cucumbers]
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   270   2e-82    Tarenaya hassleriana [spider flower]
gb|KHN32687.1|  Beta-galactosidase 1                                    272   3e-82    Glycine soja [wild soybean]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               272   3e-82    Glycine max [soybeans]
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 270   3e-82    Nicotiana sylvestris
gb|AAB61470.1|  beta-D-galactosidase                                    268   3e-82    Mangifera indica
gb|KJB07253.1|  hypothetical protein B456_001G011600                    268   4e-82    Gossypium raimondii
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               271   4e-82    Glycine max [soybeans]
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      271   4e-82    Populus euphratica
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             271   4e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      271   4e-82    Nicotiana sylvestris
emb|CAA09467.1|  exo galactanase                                        269   4e-82    Lupinus angustifolius
gb|KEH37473.1|  beta-like galactosidase                                 268   4e-82    Medicago truncatula
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      271   5e-82    Nicotiana sylvestris
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    269   5e-82    
gb|AIU34464.1|  putative beta-galactosidase 1 precursor                 262   5e-82    Taraxacum brevicorniculatum
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    269   6e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    269   7e-82    Tarenaya hassleriana [spider flower]
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    271   7e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    269   7e-82    Camelina sativa [gold-of-pleasure]
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 268   8e-82    
gb|EPS69033.1|  beta-galactosidase                                      268   9e-82    Genlisea aurea
gb|AES65414.2|  beta-like galactosidase                                 268   9e-82    Medicago truncatula
emb|CDX94367.1|  BnaC01g18170D                                          268   9e-82    
ref|XP_002514108.1|  beta-galactosidase, putative                       270   1e-81    
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      270   1e-81    Nicotiana sylvestris
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    268   1e-81    Arabis alpina [alpine rockcress]
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      270   1e-81    
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   268   1e-81    
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      270   1e-81    
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      270   1e-81    
ref|XP_010090042.1|  Beta-galactosidase 1                               268   1e-81    
gb|KJB07254.1|  hypothetical protein B456_001G011600                    267   1e-81    
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                268   1e-81    
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        268   2e-81    
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like                 265   2e-81    
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 268   2e-81    
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   267   2e-81    
dbj|BAB83260.1|  beta-D-galactosidase                                   268   2e-81    
gb|KGN59822.1|  hypothetical protein Csa_3G848310                       268   2e-81    
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        268   2e-81    
gb|ACC78255.1|  beta-galactosidase                                      267   2e-81    
emb|CDY32919.1|  BnaC02g12030D                                          267   2e-81    
ref|XP_010418820.1|  PREDICTED: beta-galactosidase 8-like               253   2e-81    
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               270   2e-81    
ref|XP_003595162.1|  Beta-galactosidase                                 267   2e-81    
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               267   2e-81    
gb|KHN30042.1|  Beta-galactosidase 1                                    269   2e-81    
emb|CDY20708.1|  BnaA02g08480D                                          267   3e-81    
gb|KJB07252.1|  hypothetical protein B456_001G011600                    267   3e-81    
dbj|BAE72073.1|  pear beta-galactosidase1                               267   3e-81    
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             266   3e-81    
emb|CDX89360.1|  BnaA01g15330D                                          266   3e-81    
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like                 264   3e-81    
ref|XP_004135820.1|  PREDICTED: beta-galactosidase-like                 261   4e-81    
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 267   4e-81    
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like               269   4e-81    
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         269   4e-81    
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   267   4e-81    
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 269   4e-81    
gb|AEG76892.1|  putative beta-galactosidase                             266   5e-81    
ref|NP_001275845.1|  beta-galactosidase                                 267   5e-81    
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    268   5e-81    
ref|XP_002867577.1|  beta-galactosidase 12                              266   5e-81    
dbj|BAB21492.1|  beta-D-galactosidase                                   266   6e-81    
emb|CDY11899.1|  BnaC03g13250D                                          266   6e-81    
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      266   6e-81    
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   267   6e-81    
gb|AHG94613.1|  beta-galactosidase                                      266   6e-81    
emb|CAH18936.1|  beta-galactosidase                                     266   7e-81    
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    266   7e-81    
gb|KEH18344.1|  beta-galactosidase                                      268   7e-81    
ref|NP_001280755.1|  beta-galactosidase precursor                       266   7e-81    
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    266   7e-81    
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             266   7e-81    
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 268   8e-81    
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             266   8e-81    
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             265   8e-81    
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 266   8e-81    
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             266   9e-81    
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    267   1e-80    
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 268   1e-80    
gb|AAC77377.1|  beta-galactosidase precursor                            265   1e-80    
gb|ACJ86256.1|  unknown                                                 253   1e-80    
emb|CAB86888.1|  beta-galactosidase precursor-like protein              265   1e-80    
ref|NP_200498.1|  beta-galactosidase 4                                  265   1e-80    
gb|AAK96780.1|  beta-galactosidase                                      265   1e-80    
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               267   1e-80    
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 265   1e-80    
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    267   1e-80    
ref|NP_190852.2|  beta-galactosidase 2                                  265   1e-80    
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      267   1e-80    
ref|XP_003597608.1|  Beta-galactosidase                                 267   1e-80    
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 267   2e-80    
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  265   2e-80    
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             267   2e-80    
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    265   2e-80    
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      267   2e-80    
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    265   2e-80    
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    265   2e-80    
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     264   2e-80    
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    265   2e-80    
gb|KGN66239.1|  hypothetical protein Csa_1G587990                       262   2e-80    
ref|NP_001140495.1|  hypothetical protein precursor                     254   3e-80    
gb|AAK40304.1|  beta-galactosidase                                      265   3e-80    
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               265   3e-80    
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      266   3e-80    
dbj|BAC10578.2|  beta-galactosidase                                     265   3e-80    
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      266   3e-80    
ref|XP_002864484.1|  predicted protein                                  265   3e-80    
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      266   3e-80    
gb|ACF22882.1|  beta-galactosidase                                      264   3e-80    
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               264   3e-80    
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 264   4e-80    
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             266   4e-80    
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               266   4e-80    
emb|CBI27912.3|  unnamed protein product                                266   4e-80    
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               266   4e-80    
gb|KHG01120.1|  Beta-galactosidase                                      266   4e-80    
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      264   4e-80    
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     263   5e-80    
gb|ACJ86220.1|  unknown                                                 249   5e-80    
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        264   6e-80    
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 266   6e-80    
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        264   6e-80    
gb|ACP18874.1|  beta-galactosidase pBG(b)                               258   6e-80    
gb|EPS72701.1|  beta-galactosidase                                      253   6e-80    
gb|KDO73223.1|  hypothetical protein CISIN_1g003095mg                   259   6e-80    
gb|KJB56892.1|  hypothetical protein B456_009G140800                    266   6e-80    
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    265   7e-80    
gb|KHN24609.1|  Beta-galactosidase                                      263   8e-80    
ref|XP_007024475.1|  Beta galactosidase 1                               265   9e-80    
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         263   9e-80    
ref|NP_001289260.1|  beta-galactosidase precursor                       263   9e-80    
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    265   1e-79    
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         263   1e-79    
dbj|BAE72074.1|  pear beta-galactosidase2                               263   1e-79    
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 265   1e-79    
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 263   1e-79    
emb|CDY51738.1|  BnaA01g37210D                                          265   1e-79    
gb|ABV32545.1|  beta-galactosidase protein 2                            265   1e-79    
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               265   1e-79    
ref|XP_011460033.1|  PREDICTED: beta-galactosidase isoform X3           263   1e-79    
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 265   2e-79    
gb|ACR35908.1|  unknown                                                 252   2e-79    
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             262   2e-79    
ref|XP_011460028.1|  PREDICTED: beta-galactosidase isoform X2           263   2e-79    
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             265   2e-79    
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      264   2e-79    
gb|ABY71826.1|  beta-galactosidase                                      264   2e-79    
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               264   2e-79    
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             264   2e-79    
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               264   2e-79    
gb|ACC60981.1|  beta-galactosidase 1 precursor                          264   3e-79    
ref|XP_004287560.2|  PREDICTED: beta-galactosidase isoform X1           263   3e-79    
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    264   3e-79    
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 259   3e-79    
gb|AES59331.2|  beta-like galactosidase                                 262   3e-79    
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               264   3e-79    
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    264   3e-79    
ref|NP_187988.1|  beta galactosidase 1                                  264   3e-79    
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             264   3e-79    
gb|AAM13196.1|  galactosidase, putative                                 264   4e-79    
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 261   4e-79    
emb|CDX95380.1|  BnaC04g27780D                                          261   4e-79    
gb|EPS62826.1|  beta-galactosidase                                      259   4e-79    
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    263   5e-79    
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             263   5e-79    
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    263   5e-79    
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                263   5e-79    
gb|EPS64494.1|  beta-galactosidase                                      261   5e-79    
ref|XP_010106660.1|  Beta-galactosidase 1                               263   5e-79    
gb|ABV32546.1|  beta-galactosidase protein 1                            263   6e-79    
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               263   6e-79    
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               263   6e-79    
gb|KDO73222.1|  hypothetical protein CISIN_1g003095mg                   259   6e-79    
emb|CDY37486.1|  BnaC01g37460D                                          263   6e-79    
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               263   8e-79    
gb|ABK96254.1|  unknown                                                 263   9e-79    
ref|NP_001265889.1|  beta-galactosidase-like precursor                  260   9e-79    
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 263   9e-79    
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 260   9e-79    
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           262   1e-78    
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           262   1e-78    
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               260   1e-78    
gb|AHG94611.1|  beta-galactosidase                                      262   1e-78    
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                     259   1e-78    
ref|XP_006385360.1|  beta-galactosidase 1 family protein                262   1e-78    
ref|XP_002527409.1|  beta-galactosidase, putative                       261   2e-78    
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             259   2e-78    
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               261   2e-78    
ref|XP_010090040.1|  hypothetical protein L484_027271                   261   2e-78    
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               261   3e-78    
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             261   3e-78    
gb|AFW61988.1|  hypothetical protein ZEAMMB73_453254                    248   3e-78    
emb|CAC44502.1|  beta-galactosidase                                     259   3e-78    
gb|EEC70952.1|  hypothetical protein OsI_02561                          261   3e-78    
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                 260   3e-78    
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               261   4e-78    
emb|CAC44500.1|  beta-galactosidase                                     261   4e-78    
ref|NP_001043405.1|  Os01g0580200                                       260   4e-78    
ref|NP_001234465.1|  beta-galactosidase precursor                       260   6e-78    
gb|AGW47883.1|  beta-galactosidase precursor                            260   6e-78    
gb|KJB70253.1|  hypothetical protein B456_011G065300                    259   6e-78    
ref|XP_004287559.1|  PREDICTED: beta-galactosidase isoform X5           258   6e-78    
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    260   7e-78    
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               260   7e-78    
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               260   7e-78    
emb|CBI35944.3|  unnamed protein product                                260   8e-78    
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      260   8e-78    
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    260   8e-78    
gb|KHN39301.1|  Beta-galactosidase 1                                    259   9e-78    
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like               260   9e-78    
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like               258   1e-77    
emb|CDX97513.1|  BnaA05g25660D                                          259   1e-77    
ref|XP_011460037.1|  PREDICTED: beta-galactosidase isoform X4           258   1e-77    
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    259   1e-77    
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      259   1e-77    
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      259   1e-77    
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 257   2e-77    
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    259   2e-77    
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               259   2e-77    
ref|XP_007012844.1|  Beta-galactosidase                                 259   2e-77    
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    259   2e-77    
emb|CDO97918.1|  unnamed protein product                                259   2e-77    
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   259   2e-77    
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             259   2e-77    
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   259   2e-77    
gb|KJB70251.1|  hypothetical protein B456_011G065300                    258   3e-77    
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                 261   3e-77    
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 258   3e-77    
gb|KJB70252.1|  hypothetical protein B456_011G065300                    258   3e-77    
gb|KEH39323.1|  beta-galactosidase-like protein                         255   3e-77    
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      258   4e-77    
gb|ACP18875.1|  beta-galactosidase pBG(a)                               258   4e-77    
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               258   4e-77    
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                    256   4e-77    
tpg|DAA58690.1|  TPA: hypothetical protein ZEAMMB73_223728              246   5e-77    
emb|CDY15749.1|  BnaC04g15750D                                          258   5e-77    
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             258   5e-77    
ref|NP_001234303.1|  beta-galactosidase precursor                       258   5e-77    
gb|ADO34788.1|  beta-galactosidase STBG3                                258   5e-77    
gb|AFD54987.1|  beta-galactosidase                                      256   5e-77    
ref|XP_004170887.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    255   8e-77    
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   254   8e-77    
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 257   9e-77    
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             257   1e-76    
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             257   1e-76    



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5    SLQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQI  181



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5    SVQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQI  181



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   337 bits (865),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +++KWVL+ C+V F+SSGL  C V+YDR+AIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5    SLQKWVLLWCIVLFISSGLVHCDVTYDREAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQI  181



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   334 bits (857),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5    SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQI  181



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   334 bits (857),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5    SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQI  181



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +1

Query  58   RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            +KWVL  CMV ++ SG  QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI+KA
Sbjct  14   KKWVLWACMVVYIGSGYVQCSVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLINKA  73

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            KEGGVDVIETYVFWNVHEPSPGNY+FEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNF
Sbjct  74   KEGGVDVIETYVFWNVHEPSPGNYDFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNF  133

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK+VPGISFR DNEPFKMAMKGFTEKIVNLMKS  L+ESQGGPIILSQI
Sbjct  134  GGFPVWLKYVPGISFRTDNEPFKMAMKGFTEKIVNLMKSEKLYESQGGPIILSQI  188



>gb|KHF97862.1| Beta-galactosidase 3 [Gossypium arboreum]
 gb|KHF97863.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=515

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   +  ++++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWE
Sbjct  1    MERSSFSRFLIVFCFAVCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAH+RIGPY+
Sbjct  61   DLIQKAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHVRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|EYU31167.1| hypothetical protein MIMGU_mgv1a001956mg [Erythranthe guttata]
Length=734

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCM--VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEM  213
            ++  ++ KWV  +CM  V FL  G+ Q  ++YDRKA++INGQRR+L SGSIHYPRSTPEM
Sbjct  1    MKNNSVSKWVFSVCMAVVVFLECGVVQSRITYDRKALIINGQRRILISGSIHYPRSTPEM  60

Query  214  WEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGP  393
            WEDLI+KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTI+KAGLYA+LRIGP
Sbjct  61   WEDLINKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIKKAGLYANLRIGP  120

Query  394  YICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIIL  573
            YIC EWNFGGFPVWLK+VPGISFR DNEPFKMAMKGFTEKIVN+MKS NL+ESQGGPIIL
Sbjct  121  YICAEWNFGGFPVWLKYVPGISFRTDNEPFKMAMKGFTEKIVNIMKSENLYESQGGPIIL  180

Query  574  SQI  582
            SQI
Sbjct  181  SQI  183



>gb|KJB43420.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
 gb|KJB43421.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=608

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8    RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  128  GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>ref|XP_007046795.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX90952.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=702

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   +  + ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP+MWE
Sbjct  1    METSSFSRLLIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|KJB43418.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=693

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  130  PVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   +  + ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP+MWE
Sbjct  1    METSSFSRLLIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|KDO71054.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=626

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8    RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQI  181



>gb|KJB43423.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=807

 Score =   318 bits (815),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  130  PVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>gb|KJB43422.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=850

 Score =   318 bits (816),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +  + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  5    SCSRLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EW
Sbjct  65   KAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>gb|KJB43424.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=854

 Score =   318 bits (816),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +  + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  5    SCSRLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EW
Sbjct  65   KAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>gb|KJB43419.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=859

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            +  + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  5    SCSRLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EW
Sbjct  65   KAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQI  181



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K  LVLCMV  L S L QCSV+YDRKAIVINGQRR+L SGSIHYPRSTP+MWE
Sbjct  1    MEANSVSKLFLVLCMVLQLGSQLIQCSVTYDRKAIVINGQRRILISGSIHYPRSTPDMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            D+I KAK+GG+DV+ETYVFWNVHEPSPG+YNFEGRYDLVRF++T+QKAGLYAHLRIGPY+
Sbjct  61   DIIQKAKDGGLDVVETYVFWNVHEPSPGSYNFEGRYDLVRFIRTVQKAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSERLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  282
            GL QCSV+YD+KA+VINGQRR+L SGSIHYPRSTPEMWEDLI+KAKEGG+DVIETYVFWN
Sbjct  22   GLVQCSVTYDKKAMVINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIETYVFWN  81

Query  283  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  462
            VHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  82   VHEPSPGNYNFEGRYDLVRFIKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  141

Query  463  RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            R DNEPFKMAMKGFTEKIVNLMKS NL+ESQGGPIILSQI
Sbjct  142  RTDNEPFKMAMKGFTEKIVNLMKSENLYESQGGPIILSQI  181



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =   316 bits (810),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++RK+ L +C+V  + S L QC+V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  4    SVRKFWLFICLVLVVGSELIQCNVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  63

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+K IQ+AGLYAHLRIGPY+C EW
Sbjct  64   KAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKLIQRAGLYAHLRIGPYVCAEW  123

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK  NLFESQGGPIILSQI
Sbjct  124  NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGMMKKENLFESQGGPIILSQI  180



>gb|EPS70273.1| beta-galactosidase, partial [Genlisea aurea]
Length=634

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  76   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  255
            +C+V FL   L QCSV+YDRKAIVING+RR+L SGSIHYPRSTPEMWEDL++KAKEGG+D
Sbjct  2    VCIVVFLGGSLVQCSVTYDRKAIVINGERRILISGSIHYPRSTPEMWEDLMNKAKEGGLD  61

Query  256  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  435
            VI+TYVFWNVHEPS G+YNFEGRYDLVRFVKT QK+GLY HLRIGPYICGEWNFGGFPVW
Sbjct  62   VIDTYVFWNVHEPSQGHYNFEGRYDLVRFVKTAQKSGLYVHLRIGPYICGEWNFGGFPVW  121

Query  436  LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            LK+VPGISFR DNEPFKM MKGFT KIVNLMKS NL++SQGGPIILSQI
Sbjct  122  LKYVPGISFRTDNEPFKMLMKGFTRKIVNLMKSENLYQSQGGPIILSQI  170



>ref|XP_007158612.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
 gb|ESW30606.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
Length=365

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +1

Query  73   VLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            + C+  +L   L    C+V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEG
Sbjct  13   LFCLALWLGVQLEWVHCTVTYDRKAILINGQRRLLFSGSIHYPRSTPDMWEDLIYKAKEG  72

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVIETYVFWNVHEPSPGN+NFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  73   GLDVIETYVFWNVHEPSPGNFNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGF  132

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQI
Sbjct  133  PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGMMKSERLYESQGGPIILSQI  184



>ref|XP_006380782.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
 gb|ERP58579.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
Length=626

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12   LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72   IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV LMK+ +LFESQGGPIILSQI
Sbjct  132  VWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKAEHLFESQGGPIILSQI  182



>gb|KDO71053.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=816

 Score =   313 bits (802),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8    RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQI  181



>ref|XP_007204246.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
 gb|EMJ05445.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
Length=693

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5    SVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQI  181



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   314 bits (804),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            + G ++ K  L L +V+FL   L QC+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    MEGNSVSKLCLFLGLVWFLGFQLVQCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DV+ETYVFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNGHEPSPGNYNFEGRYDLVRFLKTVQKAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|KGN48881.1| hypothetical protein Csa_6G504610 [Cucumis sativus]
Length=750

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQI  182



>gb|KJB17716.1| hypothetical protein B456_003G011900 [Gossypium raimondii]
Length=854

 Score =   313 bits (803),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  91   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  270
            +LS  L Q SV+YD+KAIVINGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG+DVIETY
Sbjct  19   YLSPQLVQTSVTYDKKAIVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETY  78

Query  271  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  450
            VFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+C EWNFGGFPVWLKFVP
Sbjct  79   VFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKFVP  138

Query  451  GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQI
Sbjct  139  GISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQI  182



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8    RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQI  181



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
              VL +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+G
Sbjct  11   CFVLLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  71   GIDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AMKGFTEKIV LMK+ NLFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKRAMKGFTEKIVGLMKAENLFESQGGPIILSQI  182



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8    RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTI+KAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIKKAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQI  181



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =   311 bits (797),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQI  182



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =   311 bits (796),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQI  182



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =   311 bits (796),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METNSVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_004158882.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDL RF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLARFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQI  182



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METNSVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKA LYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFLKTIQKARLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L QCSVSYDRKA+VI+GQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG+DV+ETYVFWNV
Sbjct  25   LIQCSVSYDRKALVIDGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVVETYVFWNV  84

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  85   HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFK AM+GFT+KIVNLMKS NLFESQGGPIIL+QI
Sbjct  145  TDNEPFKRAMEGFTKKIVNLMKSENLFESQGGPIILNQI  183



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12   LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72   IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV LMK+ +LFESQGGPIILSQI
Sbjct  132  VWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKAEHLFESQGGPIILSQI  182



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +1

Query  28   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  204
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  205  PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  384
            P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  385  IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  564
            IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121  IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  565  IILSQI  582
            IILSQI
Sbjct  181  IILSQI  186



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +1

Query  28   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  204
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  205  PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  384
            P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  385  IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  564
            IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121  IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  565  IILSQI  582
            IILSQI
Sbjct  181  IILSQI  186



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +1

Query  28   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  204
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  205  PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  384
            P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  385  IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  564
            IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121  IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  565  IILSQI  582
            IILSQI
Sbjct  181  IILSQI  186



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   305 bits (782),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
            +CSV+YDRKAI+INGQRR+LFSGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWNVHE
Sbjct  24   ECSVTYDRKAIIINGQRRILFSGSIHYPRSTPEMWGDLIQKAKEGGLDVIQTYVFWNVHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFKMAM+GFT+KIV +MKS  LFESQGGPIILSQI
Sbjct  144  NEPFKMAMQGFTQKIVQMMKSERLFESQGGPIILSQI  180



>ref|XP_006283100.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15998.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=813

 Score =   305 bits (780),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>gb|KJB58183.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=590

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METSSVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYI
Sbjct  61   DLIKKAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYI  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWED
Sbjct  4    GDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWED  63

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  124  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  183



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQI
Sbjct  137  VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQI  182



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQI
Sbjct  137  VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQI  182



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQI
Sbjct  137  VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQI  182



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>ref|XP_006412010.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53463.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=626

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   304 bits (779),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            + V  +V  +S     C+V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAKEG
Sbjct  9    LFVFFLVLSVSFQWILCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEG  68

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGF
Sbjct  69   GLDVIQTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGF  128

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFKMAM+GFT+KIV +MKS  LFESQGGPIILSQI
Sbjct  129  PVWLKYVPGISFRTDNEPFKMAMQGFTQKIVEMMKSEMLFESQGGPIILSQI  180



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   304 bits (778),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSASRMILWLCLGFLILDVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            KW L LCM  FL   LTQCSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK
Sbjct  8    KWFL-LCMWVFLCIQLTQCSVTYDRKALIINGQRRILFSGSIHYPRSTPQMWEGLIQKAK  66

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+D I+TYVFWN+HEPSPG YNFEGRYDLVRF+K IQKAGLY HLRIGPYIC EWNFG
Sbjct  67   DGGLDAIDTYVFWNLHEPSPGKYNFEGRYDLVRFIKLIQKAGLYVHLRIGPYICAEWNFG  126

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLKFVPG+SFR DNEPFKMAM+ FT+KIV +MK+  LFESQGGPII+SQI
Sbjct  127  GFPVWLKFVPGVSFRTDNEPFKMAMQRFTQKIVQMMKNEKLFESQGGPIIISQI  180



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =   303 bits (775),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
            +CSV+YDRKA++INGQRR+L SGSIHYPRSTPEMWEDLI+KAKEGG+DVI+TYVFWNVHE
Sbjct  26   ECSVTYDRKALIINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIDTYVFWNVHE  85

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPGNYNFEGRYDLV+FVKTIQKAGLYAHLRIGPY+C EWNFGG PVWLKFVPGISFR D
Sbjct  86   PSPGNYNFEGRYDLVKFVKTIQKAGLYAHLRIGPYVCAEWNFGGLPVWLKFVPGISFRTD  145

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFKMAMK FT+KIVN+MK+ NL+ESQGGPIILSQI
Sbjct  146  NEPFKMAMKRFTKKIVNMMKTENLYESQGGPIILSQI  182



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L  C+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWEDLI KAKEGG+DV+ETYVFWNV
Sbjct  23   LVHCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVVETYVFWNV  82

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEP+PGNYNFEGRYDLVRF+KTIQ AGLYAHLRIGPY+C EWN GGFPVWLK+VPGISFR
Sbjct  83   HEPTPGNYNFEGRYDLVRFLKTIQNAGLYAHLRIGPYVCAEWNNGGFPVWLKYVPGISFR  142

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQI
Sbjct  143  TDNEPFKRAMQGFTEKIVRLMKSENLFESQGGPIILSQI  181



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G ++ + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSVSRMILWLCLGFLILVVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVELMKSENLFESQGGPIILSQI  186



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSASRMILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVELMKSENLFESQGGPIILSQI  186



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 2/171 (1%)
 Frame = +1

Query  76   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQI
Sbjct  135  VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQI  185



>ref|XP_007160714.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
 gb|ESW32708.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
Length=739

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K +L++  +FF+ S L  CSV+YDRKAI+INGQRR+L SGSIHYPRS PEMWE
Sbjct  1    METNSVSKLLLLVFTIFFVGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSAPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+D I+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+
Sbjct  61   DLIRKAKDGGLDAIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DV+ETYVFWNVHE
Sbjct  25   HCAVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNVHE  84

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  85   PTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  144

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFT+KIV LMKS +LFESQGGPIILSQI
Sbjct  145  NEPFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQI  181



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K +    MV  + S L QC+V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METNSVSKLLTFFLMVLLMGSKLVQCTVTYDKKAIIINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVI+TYVFW+VHE SPGNYNF+GRYDLVRF+KT+QK GLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVIDTYVFWDVHETSPGNYNFDGRYDLVRFIKTVQKVGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+ NLF SQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQGFTQKIVQMMKNENLFASQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S + + SV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFW
Sbjct  20   SHVARASVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFW  79

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  80   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIS  139

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQI
Sbjct  140  FRTDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQI  180



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
            +  SV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23   SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  83   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  142

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQI
Sbjct  143  DNEPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQI  180



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
            +  SV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23   SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  83   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  142

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQI
Sbjct  143  DNEPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQI  180



>emb|CDX75569.1| BnaA01g01330D [Brassica napus]
Length=827

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 154/173 (89%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+
Sbjct  14   ILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKD  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNFGG
Sbjct  74   GGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  134  FPVWLKYVPGISFRTDNEPFKRAMQGFTERIVQLMKSENLYESQGGPIILSQI  186



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            KWVLVLCMV  L +   Q SVSYDRKA+VIN QRR+L SGSIHYPRSTPEMWEDLI+KAK
Sbjct  8    KWVLVLCMVVVLGAEFVQSSVSYDRKAVVINEQRRILISGSIHYPRSTPEMWEDLINKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFKM M+ FTEKIV LMKS NLFESQGGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKMYMQRFTEKIVRLMKSENLFESQGGPIILSQI  181



>ref|XP_010679814.1| PREDICTED: beta-galactosidase 3 [Beta vulgaris subsp. vulgaris]
Length=853

 Score =   301 bits (770),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            M+  +L   ++ FL+    QCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWEDLI K
Sbjct  1    MKSLMLFWVLMLFLNCKFMQCSVSYDRKALLIDGQRRILMSGSIHYPRSTPDMWEDLIMK  60

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK GG+D I+TYVFWNVHEPSPGNYNFEGRYD+V+F+K IQKAGLYAHLRIGPY+C EWN
Sbjct  61   AKNGGLDAIDTYVFWNVHEPSPGNYNFEGRYDIVKFLKIIQKAGLYAHLRIGPYVCAEWN  120

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR DNEPFK  M+ FTEKIVNL+KSHNLFESQGGPIIL+Q+
Sbjct  121  FGGFPVWLKYVPGISFRTDNEPFKREMQRFTEKIVNLLKSHNLFESQGGPIILAQV  176



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =   301 bits (770),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVQLMKSENLYESQGGPIILSQI  186



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   300 bits (768),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 2/171 (1%)
 Frame = +1

Query  76   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQI
Sbjct  135  VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQI  185



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   300 bits (768),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L QCSV+YDRKAI+INGQR++L SGSIHYPRSTP+MWE L+ KAK+GG+DVI+TYVFWNV
Sbjct  25   LIQCSVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLMQKAKDGGLDVIQTYVFWNV  84

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNYNFEGRYDLVRFVKT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  85   HEPSPGNYNFEGRYDLVRFVKTVQKAGLYMHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFKMAM+GFTEKIV +MKS +LFESQGGPIILSQI
Sbjct  145  TDNEPFKMAMQGFTEKIVQMMKSESLFESQGGPIILSQI  183



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =   300 bits (768),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 2/171 (1%)
 Frame = +1

Query  76   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQI
Sbjct  135  VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQI  185



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   300 bits (768),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L  C+V+YDRKAIVINGQRR+L SGSIHYPRSTPE WEDLI KAK+GG+DV+ETYVFWNV
Sbjct  23   LVHCAVTYDRKAIVINGQRRILISGSIHYPRSTPEXWEDLIQKAKDGGLDVVETYVFWNV  82

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEP+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83   HEPTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFK AM+GFT+KIV LMKS +LFESQGGPIILSQI
Sbjct  143  TDNEPFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQI  181



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +1

Query  76   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQ
Sbjct  135  VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQ  184



>gb|KJB58182.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=733

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METSSVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYI
Sbjct  61   DLIKKAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYI  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_002305449.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE85960.1| beta-galactosidase family protein [Populus trichocarpa]
Length=731

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   +  KW+  L +V   S  L QC+V+YD+KA++INGQR+VLFSGSIHYPRSTPEMWE
Sbjct  1    MAANSTTKWLFSLSVVLLTSLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
             LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIGPYI
Sbjct  61   GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIGPYI  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK  NLFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQMMKDENLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|KHG23756.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=741

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METSSVSKLLIFFFSAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYI
Sbjct  61   DLIKKAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYI  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    GDSASRLILWFCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  124  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  183



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  94   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  273
            L S +   +V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DVIETYV
Sbjct  19   LVSHIIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYV  78

Query  274  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  453
            FWNVHEPSPGN+NFEGRYDLV+F+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  79   FWNVHEPSPGNFNFEGRYDLVKFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPG  138

Query  454  ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            ISFR DNEPFK AM+GFTEKIV +MKS +LFESQGGPIILSQI
Sbjct  139  ISFRTDNEPFKRAMQGFTEKIVGMMKSEHLFESQGGPIILSQI  181



>emb|CDO97013.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            A  KW L  CM+  L++ +  CSV+YDRKA++I+GQRR+LFSGSIHYPRSTP+MWE LI 
Sbjct  6    ASSKWFL-HCMLLILAAQVAHCSVTYDRKALIIDGQRRILFSGSIHYPRSTPDMWEGLIQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+D I+TYVFWN+HEPSPGN+NFEGRYDLVRF+K +QKAGLY HLRIGPY+C EW
Sbjct  65   KAKDGGLDAIDTYVFWNIHEPSPGNFNFEGRYDLVRFIKLVQKAGLYVHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DNEPFKMAM+ FTEKIV +MK   LF+SQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNEPFKMAMQRFTEKIVRMMKYEKLFQSQGGPIILSQI  181



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
              +V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVHE
Sbjct  23   HAAVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIFKAKEGGLDVVETYVFWNVHE  82

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  83   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  142

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQI
Sbjct  143  NEPFKRAMQGFTEKIVGMMKSEQLFESQGGPIILSQI  179



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  282
            G  QCSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GGVDVIETYVFWN
Sbjct  20   GFVQCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  79

Query  283  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  462
            +HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  80   LHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  463  RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            R DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  140  RTDNEPFKRAMKGFTERIVELMKSDNLFESQGGPIILSQI  179



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127  AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S + +  V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFW
Sbjct  20   SHVARAFVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFW  79

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  80   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIS  139

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQI
Sbjct  140  FRTDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQI  180



>ref|XP_007042084.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX97915.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=627

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  49   GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  225
            GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWE L
Sbjct  2    GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  226  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  405
            I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62   IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  406  EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK   LFESQGGPIILSQI
Sbjct  122  EWNFGGFPVWLKYVPGISFRTDNEPFKQAMQKFTQKIVQMMKDEYLFESQGGPIILSQI  180



>ref|XP_009761050.1| PREDICTED: beta-galactosidase 5 [Nicotiana sylvestris]
Length=729

 Score =   295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K+ +V  +   + + L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METSSVSKFFIVYTISLLMVAQLIWCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI+KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLINKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQKFTQKIVEMMKSERLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  225
            G  +R +V  L     L S + QCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP+MWE L
Sbjct  7    GFTVRMFVWFLLGFLLLGSEIVQCSVTYDRKALVINGQRRILFSGSIHYPRSTPDMWEGL  66

Query  226  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  405
            I KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKT+QKAGLYAHLRIGPY+C 
Sbjct  67   IQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTVQKAGLYAHLRIGPYVCA  126

Query  406  EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTEKIV LMKS +LFESQGGPIILSQI
Sbjct  127  EWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTEKIVELMKSESLFESQGGPIILSQI  185



>gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            + +  MV  + S L Q SV+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+G
Sbjct  10   LTIYLMVLLMGSELIQGSVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDG  69

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+D I+TYVFW+VHEPSPGNYNFEGRYDLVRF+KTIQK GLYAHLRIGPY+C EWNFGG+
Sbjct  70   GLDAIDTYVFWDVHEPSPGNYNFEGRYDLVRFIKTIQKVGLYAHLRIGPYVCAEWNFGGY  129

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF SQGGPIILSQI
Sbjct  130  PVWLKYVPGISFRTDNEPFKAAMQGFTEKIVQMMKNEKLFASQGGPIILSQI  181



>ref|XP_011037170.1| PREDICTED: beta-galactosidase 5-like [Populus euphratica]
Length=789

 Score =   296 bits (758),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  31   REKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPE  210
             EK+   +  KW+  L +V      L QC+V+YD+KA++INGQR+VLFSGSIHYPRSTPE
Sbjct  56   EEKMVANSTTKWLFSLSVVLLTGLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPE  115

Query  211  MWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIG  390
            MWE LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIG
Sbjct  116  MWEGLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIG  175

Query  391  PYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPII  570
            PYIC EWNFGGFPVWLK+VPGISFR DN PFK AM+ FT+KIV +MK  NLFESQGGPII
Sbjct  176  PYICAEWNFGGFPVWLKYVPGISFRTDNGPFKSAMQKFTQKIVQMMKDENLFESQGGPII  235

Query  571  LSQI  582
            LSQI
Sbjct  236  LSQI  239



>ref|XP_009603021.1| PREDICTED: beta-galactosidase 5 [Nicotiana tomentosiformis]
Length=729

 Score =   295 bits (755),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K+ +V      + + L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    METSSISKFFIVYAFSLLMVAQLICCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLIKKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS  LFESQGGPIILSQ
Sbjct  121  CAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQKFTQKIVEMMKSEKLFESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  121  VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  300
            V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DVIETYVFWNVHEPSP
Sbjct  26   VTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYVFWNVHEPSP  85

Query  301  GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEP  480
            GNYNFEGR DLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR DNEP
Sbjct  86   GNYNFEGRNDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  145

Query  481  FKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FK AM+GFTEKIV +MKS +L+ESQGGPIILSQI
Sbjct  146  FKKAMQGFTEKIVGMMKSEHLYESQGGPIILSQI  179



>gb|AAF67342.1| beta galactosidase [Vigna radiata]
Length=739

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++ K ++++  + FL S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5    SVSKLLVLVFTILFLGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIR  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK GG+D I+TYVFWNVHEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EW
Sbjct  65   KAKGGGLDAIDTYVFWNVHEPSPGIYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQI  181



>emb|CDX69219.1| BnaC01g02340D [Brassica napus]
Length=824

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+ EGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDLEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGGFPVWLK+VP ISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  124  AEWNFGGFPVWLKYVPRISFRTDNEPFKRAMQGFTERIVELMKSENLYESQGGPIILSQI  183



>gb|KHN12675.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21   SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIGKAKDGGLDVIDTYVFW  80

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            NVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  81   NVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  140

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQI
Sbjct  141  FRTDNGPFKAAMQGFTQKIVEMMKNEKLFQSQGGPIILSQI  181



>gb|KJB32548.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
 gb|KJB32550.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=579

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQI
Sbjct  136  VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQI  181



>gb|KJB63588.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=586

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQI  181



>ref|XP_007042083.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX97914.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=730

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +1

Query  49   GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  225
            GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWE L
Sbjct  2    GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  226  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  405
            I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62   IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  406  EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK   LFESQGGPIILSQI
Sbjct  122  EWNFGGFPVWLKYVPGISFRTDNEPFKQAMQKFTQKIVQMMKDEYLFESQGGPIILSQI  180



>ref|XP_006342225.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=729

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI+K
Sbjct  6    VSKFLKVYTFYLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWEDLINK  65

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66   AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR DNEPFK++M+ FT KIV +MKS NLFESQGGPIILSQI
Sbjct  126  FGGFPVWLKYVPGISFRTDNEPFKVSMQKFTNKIVEMMKSENLFESQGGPIILSQI  181



>gb|KDO84692.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=637

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = +1

Query  46   GGAMRKWV-LVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            G A   W  ++LC+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRSTPEMWE
Sbjct  2    GAASSAWSWVLLCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWE  61

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
             LI KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYI
Sbjct  62   GLIQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYI  121

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQ
Sbjct  122  CSEWNFGGFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQLMKDEKLFESQGGPIILSQ  181

Query  580  I  582
            I
Sbjct  182  I  182



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +L  C+   + S L   SV+YD KA++INGQRR+L SGSIHYPRSTP+MWEDLI KAK  
Sbjct  10   ILFFCIFLVMGSQLISGSVTYDNKAVIINGQRRILLSGSIHYPRSTPDMWEDLILKAKNA  69

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRFVKT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  70   GLDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFVKTVQKLGLYVHLRIGPYVCAEWNFGGF  129

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS NLFESQGGPIILSQI
Sbjct  130  PVWLKYVPGISFRTDNEPFKAAMQQFTQKIVGVMKSENLFESQGGPIILSQI  181



>ref|XP_008236954.1| PREDICTED: beta-galactosidase 3-like [Prunus mume]
Length=844

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = +1

Query  64   WVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            WVL LC+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRSTPEMWE LI KAK
Sbjct  10   WVL-LCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWEGLIQKAK  68

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYIC EWNFG
Sbjct  69   DGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYICSEWNFG  128

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQI
Sbjct  129  GFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQLMKDEKLFESQGGPIILSQI  182



>ref|XP_004238611.1| PREDICTED: beta-galactosidase 5 [Solanum lycopersicum]
Length=729

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMW+DLI+K
Sbjct  6    VSKFLKVYIFSLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWQDLINK  65

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66   AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR DNEPFK AM+ FT KIV +MKS NLFESQGGPIILSQI
Sbjct  126  FGGFPVWLKYVPGISFRTDNEPFKAAMQKFTNKIVEMMKSENLFESQGGPIILSQI  181



>gb|KJB63586.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=538

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8    KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
             GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68   NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQI  181



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  282
            G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GGVDVIETYVFWN
Sbjct  27   GFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  86

Query  283  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  462
            +HEPSPG Y+F+GR DLVRFVKT+ KAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  87   LHEPSPGKYDFDGRNDLVRFVKTVHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  146

Query  463  RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            R DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  147  RTDNEPFKKAMQGFTERIVELMKSENLYESQGGPIILSQI  186



>gb|KCW64027.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=558

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
              +  KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    AASSSKWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEG  62

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            L+ KAKEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C
Sbjct  63   LVHKAKEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVC  122

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQI
Sbjct  123  AEWNFGGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQI  182



>ref|XP_010552493.1| PREDICTED: beta-galactosidase 5 [Tarenaya hassleriana]
Length=731

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K +  L     +SS + QC V+YD+K+IVING+RR+L SGSIHYPRSTPEMWEDLI+K
Sbjct  6    VSKILTFLLTTILVSSAVIQCGVTYDKKSIVINGRRRILLSGSIHYPRSTPEMWEDLITK  65

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  66   AKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWN  125

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  126  FGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEGLFASQGGPIILSQI  181



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =   292 bits (748),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++ K++ +  MV  + S L  C+V+YD+KAI+I+GQRR+L SGSIHYPRSTP+MWEDL+ 
Sbjct  5    SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGQRRILISGSIHYPRSTPDMWEDLVQ  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKDGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKGGLYVHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK   LF+SQGGPII SQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQI  181



>gb|KHN20946.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21   SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFW  80

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            NVHEPSPGNYNFEGR DLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  81   NVHEPSPGNYNFEGRNDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  140

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQI
Sbjct  141  FRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQI  181



>ref|XP_003589339.1| Beta-galactosidase [Medicago truncatula]
 gb|AES59590.1| beta-like galactosidase [Medicago truncatula]
Length=745

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S +  C+V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  22   SEVIHCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFW  81

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            NVHEPSPGNYNFEGRYDLV+F+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  82   NVHEPSPGNYNFEGRYDLVQFIKTVQKKGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  141

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQI
Sbjct  142  FRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQI  182



>ref|NP_001265904.1| beta-galactosidase 5-like precursor [Cicer arietinum]
 emb|CAA10128.1| beta-galactosidase [Cicer arietinum]
Length=745

 Score =   290 bits (742),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  94   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  273
            + S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYV
Sbjct  19   VCSQLIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKVGGLDVIDTYV  78

Query  274  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  453
            FWNVHEPSP NYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  79   FWNVHEPSPSNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  138

Query  454  ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            ISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQI
Sbjct  139  ISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQI  181



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 153/173 (88%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   VLFLTMTLFIASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DNEPFKMAM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNEPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  183



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  64   WVLVLCMVFFLSS--GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            WVL+ C + + S    +T+C+V YDRKA+VI+GQRR+LFSGSIHYPRSTPEMWE LI KA
Sbjct  10   WVLLCCCIVWSSVYVEVTKCNVVYDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQKA  69

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70   KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLKFVPGISFR DNEPFK AM+ FT+K+V LMK+  LFESQGGPIILSQI
Sbjct  130  GGFPVWLKFVPGISFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQI  184



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            L + +  FL+       V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  12   LFVSLTLFLA---VYSDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  68

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVIETYVFWNVHEPSPGNYNFEGR DLVRF++T+ KAGLYAHLRIGPY+C EWNFGGFP
Sbjct  69   LDVIETYVFWNVHEPSPGNYNFEGRNDLVRFIQTVHKAGLYAHLRIGPYVCAEWNFGGFP  128

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQI
Sbjct  129  VWLKYVPGISFRQDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQI  179



>gb|KJB32549.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=693

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQI
Sbjct  136  VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQI  181



>gb|KDO84691.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=731

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>ref|XP_009107461.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Brassica rapa]
 ref|XP_009107462.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Brassica rapa]
Length=729

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 150/178 (84%), Gaps = 5/178 (3%)
 Frame = +1

Query  64   WVLVLCMVFFLS-----SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  228
            WVL   + FFL+     S + QCSV+YD+KAIV+NG RR+L SGSIHYPRSTPEMWEDLI
Sbjct  5    WVLSKIVTFFLTAMLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLI  64

Query  229  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  408
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C E
Sbjct  65   KKAKDGGLDVIDTYVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAE  124

Query  409  WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WNFGGFPVWLK+VPGISFR DN PFK AM+GFT KIV +MK H  F SQGGPIILSQI
Sbjct  125  WNFGGFPVWLKYVPGISFRTDNGPFKDAMQGFTYKIVQMMKDHQFFASQGGPIILSQI  182



>ref|XP_006393673.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
 gb|ESQ30959.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
Length=726

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K +  L     + S + QCSV+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  3    LSKILSFLLTTMLIGSAMIQCSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  62

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  63   AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  122

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQI
Sbjct  123  FGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDHRFFASQGGPIILSQI  178



>gb|KJB63587.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=732

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8    KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
             GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68   NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQI  181



>gb|KJB63585.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=734

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8    KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
             GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68   NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQI  181



>emb|CDP11590.1| unnamed protein product [Coffea canephora]
 emb|CDP03164.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +L++ +V FLS  + +  VSYD ++ +INGQR++L SGSIHYPRSTPEMW DLI KAK+G
Sbjct  8    LLIIVLVSFLSCTV-RAKVSYDGRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDG  66

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWNVHEPSPG YNFEGR D+VRF+K ++ AGLYAHLRIGPYIC EWNFGGF
Sbjct  67   GLDVIQTYVFWNVHEPSPGKYNFEGRGDIVRFLKLVKAAGLYAHLRIGPYICAEWNFGGF  126

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPG+ FR DN PFK AM+GF  KIVNLMKS NLFE QGGPII+SQ+
Sbjct  127  PVWLKYVPGMEFRTDNGPFKAAMQGFVTKIVNLMKSENLFEPQGGPIIMSQV  178



>ref|XP_009129554.1| PREDICTED: beta-galactosidase 5 [Brassica rapa]
Length=730

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQI
Sbjct  127  FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQI  182



>gb|KDO84689.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=805

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>gb|KJB32547.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=732

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  85   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  264
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  265  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  444
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  445  VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQI
Sbjct  136  VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQI  181



>gb|KDO84690.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=809

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>gb|KHG11061.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=734

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8    KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
             GG+DVI+TY+FWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68   NGGLDVIDTYIFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYVCAEWNFG  127

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQI
Sbjct  128  GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQI  181



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004160975.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            L L      +S L   +V+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI KAK GG
Sbjct  10   LFLIAFLLANSHLIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  70   LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFP  129

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNE FK AM+GFTEKIV LMKS NLFESQGGPIIL+QI
Sbjct  130  VWLKYVPGISFRTDNEAFKNAMQGFTEKIVALMKSENLFESQGGPIILAQI  180



>ref|XP_011092826.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=732

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
            + CSVSYDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+D I+TYVFW++H
Sbjct  25   SHCSVSYDRKALIINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDAIDTYVFWDLH  84

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPG YNFEGRYDLVRFVK +QKAGLY HLRIGPYIC EWNFGGFPVWLK+VPGISFR 
Sbjct  85   EPSPGTYNFEGRYDLVRFVKLVQKAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGISFRT  144

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DN+PFKMAM+ FTEKIV +MK+  LF+SQGGPIILSQI
Sbjct  145  DNQPFKMAMQRFTEKIVQMMKTERLFQSQGGPIILSQI  182



>gb|KHN45883.1| Beta-galactosidase 5 [Glycine soja]
Length=727

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S LT C+V+YDRK+++INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYVFW
Sbjct  23   SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG+S
Sbjct  83   DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGVS  142

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQI
Sbjct  143  FRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQI  183



>ref|XP_003523710.1| PREDICTED: beta-galactosidase 3-like isoform 1 [Glycine max]
Length=736

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  100  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  279
            S LT C+V+YDRK+++INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYVFW
Sbjct  23   SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  280  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  459
            +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG+S
Sbjct  83   DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGVS  142

Query  460  FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQI
Sbjct  143  FRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQI  183



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =   290 bits (741),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score =   290 bits (741),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>gb|KDO49473.1| hypothetical protein CISIN_1g0051602mg, partial [Citrus sinensis]
Length=416

 Score =   278 bits (712),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQI
Sbjct  130  VWLKFVQGISFRTDNKPFKHAMQNFTQKIVLMMKDEKLFKSQGGPIILSQI  180



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
             QC VSYDRKAI+INGQRR+L SGSIHYPRSTP+MWE L+ KAK+GG+DVI+TY FWN H
Sbjct  20   AQCGVSYDRKAIIINGQRRILISGSIHYPRSTPDMWEGLLQKAKDGGLDVIQTYAFWNGH  79

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPGNYNFEGRYDLVRF+KT+ K GLY HLRIGPYICGEWNFGGFPVWLK+ PGISFR 
Sbjct  80   EPSPGNYNFEGRYDLVRFIKTVHKVGLYVHLRIGPYICGEWNFGGFPVWLKYAPGISFRT  139

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFKMAM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  140  DNEPFKMAMQGFTQKIVQMMKSESLFASQGGPIILSQI  177



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMW  216
            +   ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMW
Sbjct  1    METSSVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMW  60

Query  217  EDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY  396
            EDLI KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY
Sbjct  61   EDLIRKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPY  120

Query  397  ICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS  576
            +C EWNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILS
Sbjct  121  VCAEWNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILS  180

Query  577  QI  582
            QI
Sbjct  181  QI  182



>ref|XP_010110010.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC25028.1| Beta-galactosidase 3 [Morus notabilis]
Length=821

 Score =   289 bits (739),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L  C+VSYDRKA++INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFWNV
Sbjct  23   LMNCTVSYDRKALLINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFWNV  82

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPG YNF+GRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83   HEPSPGKYNFDGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DN PFK AM+GFT+KIV LMK   LFE QGGPIILSQI
Sbjct  143  TDNGPFKAAMQGFTQKIVQLMKDEKLFEPQGGPIILSQI  181



>emb|CDY47949.1| BnaA10g28210D [Brassica napus]
Length=730

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQI
Sbjct  127  FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQI  182



>ref|XP_010066194.1| PREDICTED: beta-galactosidase 5-like isoform X3 [Eucalyptus grandis]
Length=699

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
              +  KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    AASSSKWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEG  62

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            L+ KAKEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C
Sbjct  63   LVHKAKEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVC  122

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQI
Sbjct  123  AEWNFGGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQI  182



>gb|ABF94150.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=819

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  144  NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQI  180



>emb|CDY53959.1| BnaCnng25850D [Brassica napus]
Length=730

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  234
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  235  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  414
            AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  415  FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQI
Sbjct  127  FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQI  182



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +1

Query  52   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            ++ K++ +  MV  + S L  C+V+YD+KAI+I+G RR+L SGSIHYPRSTP+MWEDL+ 
Sbjct  5    SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGHRRILISGSIHYPRSTPDMWEDLVR  64

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKHGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKEGLYVHLRIGPYVCAEW  124

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK   LF+SQGGPII SQI
Sbjct  125  NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQI  181



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  144  NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQI  180



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  144  NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQI  180



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            + QC V+YDRKAI+INGQR++L SGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN 
Sbjct  23   VAQCGVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNG  82

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPG YNFEGRYDLVRF+KT+QK GLY HLR+GPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83   HEPSPGTYNFEGRYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFKMAM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  143  TDNEPFKMAMQGFTQKIVEMMKSESLFASQGGPIILSQI  181



>ref|XP_010061261.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5 [Eucalyptus 
grandis]
Length=730

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
            T+CSVSYDRK++ INGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVIETYVFWN H
Sbjct  25   TRCSVSYDRKSLNINGQRRILISGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNGH  84

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPG YNF+ RYDLVRF+KT+QK GLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  85   EPSPGKYNFDERYDLVRFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  144

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK AM+GFT+KIV +MK   LF SQGGPIILSQI
Sbjct  145  DNEPFKAAMQGFTQKIVQMMKDEQLFASQGGPIILSQI  182



>gb|KGN59998.1| hypothetical protein Csa_3G865330 [Cucumis sativus]
Length=756

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  109  TQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            TQC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMW+DL+ KAK+GG+DV++TYVFWNV
Sbjct  24   TQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNV  83

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  84   HEPSPGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  143

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DN PFKMAM+GFT+KIV +MKS  LF SQGGPIILSQI
Sbjct  144  TDNGPFKMAMQGFTQKIVQMMKSEKLFASQGGPIILSQI  182



>ref|XP_007136038.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
 gb|ESW08032.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
Length=738

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  94   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  273
            + S L  C+V+YDRK+++I GQRR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYV
Sbjct  21   VGSQLIHCNVTYDRKSLLIKGQRRILISGSIHYPRSTPDMWEDLIRKAKHGGLDVIDTYV  80

Query  274  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  453
            FW+VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG
Sbjct  81   FWDVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPG  140

Query  454  ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            ISFR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQI
Sbjct  141  ISFRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQI  183



>emb|CDY36028.1| BnaA08g04330D [Brassica napus]
Length=712

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  88   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  267
              + S + QCSV+YD+KAIV+NG RR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  1    MLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  268  YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  447
            YVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  61   YVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPVWLKYV  120

Query  448  PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PGISFR DN PFK AM+GFT KIV +MK H  F SQGGPIILSQI
Sbjct  121  PGISFRTDNGPFKDAMQGFTHKIVQMMKDHQFFASQGGPIILSQI  165



>ref|XP_010066193.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Eucalyptus grandis]
 gb|KCW64026.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=733

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
              +  KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    AASSSKWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEG  62

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            L+ KAKEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C
Sbjct  63   LVHKAKEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVC  122

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQI
Sbjct  123  AEWNFGGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQI  182



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   287 bits (734),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  124  SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  303
            +YD+K++VI+GQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28   TYDKKSVVIDGQRRILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  304  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  483
            NYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88   NYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  484  KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            KMAM+GFTEKIV+LMKS  LF SQGGPIILSQI
Sbjct  148  KMAMQGFTEKIVDLMKSEELFASQGGPIILSQI  180



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            WVL+ C + + S  +  T+C+V +DRKA+VI+GQRR+LFSGSIHYPRSTPEMWE LI  A
Sbjct  10   WVLLCCCIVWSSVYVEQTECNVVFDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQXA  69

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70   KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLKFVPGISFR DNEPFK AM+ FT+K+V LMK+  LFESQGGPIILSQI
Sbjct  130  GGFPVWLKFVPGISFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQI  184



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQ
Sbjct  144  NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQ  179



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  183



>ref|XP_010066191.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
 ref|XP_010066192.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
Length=737

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +1

Query  46   GGAMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
              +  KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4    AASSSKWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEG  62

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            L+ KAKEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C
Sbjct  63   LVHKAKEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVC  122

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             EWNFGG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQI
Sbjct  123  AEWNFGGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQI  182



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =   287 bits (734),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQ
Sbjct  144  NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQ  179



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score =   287 bits (734),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  183



>ref|XP_009614464.1| PREDICTED: beta-galactosidase 3-like [Nicotiana tomentosiformis]
Length=727

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            KW L+  ++    +    CSV+YD+K+++INGQR++LFSGSIHYPRSTP+MWE +I KAK
Sbjct  4    KWFLLCSLLLIFVTEFGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  63

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  64   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  123

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK  M+ FT+KIV +MK+  LF++QGGPIILSQI
Sbjct  124  GFPVWLKYVPGISFRTDNEPFKREMQRFTQKIVQMMKNEKLFQTQGGPIILSQI  177



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score =   287 bits (734),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            L L      +S     +V+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI KAK GG
Sbjct  10   LFLIAFLLANSHFIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQ+AGLYA+LRIGPY+C EWNFGGFP
Sbjct  70   LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQRAGLYANLRIGPYVCAEWNFGGFP  129

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGISFR DNE FK AM+GFTEKIV +MKS NLFESQGGPIIL+QI
Sbjct  130  VWLKYVPGISFRTDNEAFKKAMQGFTEKIVAMMKSENLFESQGGPIILAQI  180



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score =   286 bits (733),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  97   SSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  273
            SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TYV
Sbjct  20   SSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYV  79

Query  274  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  453
            FWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  80   FWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVPG  139

Query  454  ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            ISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  140  ISFRTDNGPFKMAMQGFTQKIVQMMKNEMLFASQGGPIILSQI  182



>ref|XP_002891311.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67570.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
Length=732

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSMIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQI
Sbjct  128  NFGGFPVWLKYVDGISFRTDNGPFKAAMQGFTEKIVQMMKEHRFFASQGGPIILSQI  184



>ref|XP_004291830.1| PREDICTED: beta-galactosidase 5 [Fragaria vesca subsp. vesca]
Length=730

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
             L L    F+ S L QC+ VSYD+KAI+ING+R++L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   ALYLVAFLFVGSELIQCTTVSYDKKAILINGRRKLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRFV+T+QKAGLY HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFVRTVQKAGLYLHLRIGPYVCAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKNERLFASQGGPIILSQI  183



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
             C+V+YD KAI+INGQRR+L SGS+HYPRSTP+MWEDLI KAK GG+DVI+TYVFWN HE
Sbjct  26   NCTVTYDNKAILINGQRRILLSGSVHYPRSTPDMWEDLILKAKNGGLDVIDTYVFWNGHE  85

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPGNYNFEGRYDLVRFVKT+QK GL+ +LRIGPY+C EWN+GGFPVWLK+VPGISFR D
Sbjct  86   PSPGNYNFEGRYDLVRFVKTVQKVGLFVNLRIGPYVCAEWNYGGFPVWLKYVPGISFRTD  145

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFT+KIV +MKS NLFESQGGPIILSQI
Sbjct  146  NEPFKAAMQGFTQKIVGMMKSENLFESQGGPIILSQI  182



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
            +C+V+YD+KA++I+GQRR+LFSGSIHYPRSTPEMWE L  KAK+GG+DVI+TYVFWN HE
Sbjct  24   ECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPEMWEGLFQKAKDGGLDVIQTYVFWNGHE  83

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            P+PGNYNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84   PTPGNYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM+GFTEKIV +MKS  LF SQGGPIILSQI
Sbjct  144  NEPFKTAMQGFTEKIVGMMKSEELFASQGGPIILSQI  180



>gb|KFK36177.1| hypothetical protein AALP_AA4G088200 [Arabis alpina]
Length=713

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  88   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  267
              + SG+ QCSV+YD++AI++NG RR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  1    MLIGSGVIQCSVTYDKRAIIVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  268  YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  447
            YVFWN HEP+PG Y+FEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  61   YVFWNGHEPTPGTYDFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPVWLKYV  120

Query  448  PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PGISFR DN PFK AM+GFT+KIV +MK   LF SQGGPIILSQI
Sbjct  121  PGISFRTDNGPFKAAMQGFTQKIVQMMKDEKLFASQGGPIILSQI  165



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  94   LSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  270
            +SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TY
Sbjct  19   ISSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTY  78

Query  271  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  450
            VFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VP
Sbjct  79   VFWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVP  138

Query  451  GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GISFR +N PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  139  GISFRTNNGPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  182



>ref|XP_009777047.1| PREDICTED: beta-galactosidase 3-like [Nicotiana sylvestris]
Length=726

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 153/174 (88%), Gaps = 1/174 (1%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            KW+L+  ++ F S     CSV+YD+K+++INGQR++LFSGSIHYPRSTP+MWE +I KAK
Sbjct  4    KWLLLFFVLIFASE-FGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  62

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  63   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  122

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK  M+ FT+KIV +MK+  LF++QGGPIILSQI
Sbjct  123  GFPVWLKYVPGISFRTDNEPFKREMQRFTQKIVQMMKNEKLFQTQGGPIILSQI  176



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 4/180 (2%)
 Frame = +1

Query  55   MRKW---VLVLCMVFFLSSGLT-QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  222
            MR+W    L+ C V         +C+V+YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE 
Sbjct  1    MRRWWPAALLGCAVAVSVLVAAVECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEG  60

Query  223  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  402
            LI KAK+GG+DVI+TYVFWN HEP+PGNY FE RYDLVRF+KT+QKAGL+ HLRIGPYIC
Sbjct  61   LIQKAKDGGLDVIQTYVFWNGHEPTPGNYYFEERYDLVRFIKTVQKAGLFVHLRIGPYIC  120

Query  403  GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GEWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  121  GEWNFGGFPVWLKYVPGISFRTDNEPFKTAMQGFTEKIVGMMKSENLFASQGGPIILSQI  180



>emb|CAB64741.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=732

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQI
Sbjct  128  NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQI  184



>ref|NP_175127.1| beta-galactosidase 5 [Arabidopsis thaliana]
 sp|Q9MAJ7.1|BGAL5_ARATH RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF69162.1|AC007915_14 F27F5.20 [Arabidopsis thaliana]
 gb|AAL47461.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AAM16238.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AEE32082.1| beta-galactosidase 5 [Arabidopsis thaliana]
Length=732

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQI
Sbjct  128  NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQI  184



>ref|XP_010315322.1| PREDICTED: beta-galactosidase 3-like [Solanum lycopersicum]
Length=727

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +1

Query  49   GAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  228
            G   KW L+  ++ F  S +  CSVSYD+K+++INGQR++LFSGS+HYPRSTP+MWE +I
Sbjct  2    GINTKWFLIFFVLIF-GSKICYCSVSYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGII  60

Query  229  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  408
             KAK+GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGE
Sbjct  61   QKAKDGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGE  120

Query  409  WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WNFGGFPVWLK+VPGISFR +NEPFK  M+ FT KIV +MK+  LF++QGGPIILSQI
Sbjct  121  WNFGGFPVWLKYVPGISFRTNNEPFKREMQRFTTKIVQMMKNEKLFQTQGGPIILSQI  178



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            +V+YDRKA++INGQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31   AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  91   PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PFK AM+GFTEKIV +MKS  LF SQGGPIILSQI
Sbjct  151  PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQI  185



>gb|AAL24206.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
Length=732

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQI
Sbjct  128  NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQI  184



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            +V+YDRKA++INGQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31   AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  91   PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PFK AM+GFTEKIV +MKS  LF SQGGPIILSQI
Sbjct  151  PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQI  185



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004154857.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=844

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  109  TQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            TQC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMW+DL+ KAK+GG+DV++TYVFWNV
Sbjct  24   TQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNV  83

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  84   HEPSPGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  143

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DN PFKMAM+GFT+KIV +MKS  LF SQGGPIILSQI
Sbjct  144  TDNGPFKMAMQGFTQKIVQMMKSEKLFASQGGPIILSQI  182



>ref|XP_006306871.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
 gb|EOA39769.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
Length=733

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGLTQC-SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + K +  L     L S L QC SV+YD+KAI++NG RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  9    LTKILSFLLTTMLLGSSLIQCTSVTYDKKAIIVNGHRRILLSGSIHYPRSTPEMWEDLIK  68

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  69   KAKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  128

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQI
Sbjct  129  NFGGFPVWLKYVDGISFRTDNGPFKAAMQGFTEKIVQMMKEHRFFASQGGPIILSQI  185



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L  C+V+YD +++VING RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWNV
Sbjct  19   LAHCAVTYDHRSLVINGNRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNV  78

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNY+F GRYDLVRFVKT QK GLY HLRIGPY C EWNFGGFPVWLK+VPGISFR
Sbjct  79   HEPSPGNYDFSGRYDLVRFVKTAQKVGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFR  138

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFK+AM+GFT+KIV LMKS NL+ESQGGPIILSQI
Sbjct  139  TDNEPFKIAMQGFTQKIVELMKSENLYESQGGPIILSQI  177



>emb|CDP07463.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +    +   + + L QCSV+YD++AI+ING RR+L SGSIHYPRSTPEMWEDL+ KAK  
Sbjct  11   IFFFSIALLMGAQLIQCSVTYDKRAIIINGHRRILLSGSIHYPRSTPEMWEDLVIKAKNA  70

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWN+HEP+ GNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  71   GLDVIDTYVFWNIHEPTQGNYNFEGRYDLVRFLKTVQKVGLYVHLRIGPYVCAEWNFGGF  130

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK+AM+ F++KIV  MKS  LFESQGGPIILSQI
Sbjct  131  PVWLKYVPGISFRTDNEPFKVAMQKFSQKIVGTMKSEGLFESQGGPIILSQI  182



>gb|KEH36209.1| beta-galactosidase-like protein [Medicago truncatula]
Length=733

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            +   ++ K +LV+    F+        V+YDRK+++INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1    MNATSVSKLLLVVVTTLFVLFLGCHSKVTYDRKSLLINGQRRILISGSIHYPRSTPEMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
            DLI KAK GG+DVI+TYVFW+VHEPSP NYNFEGRYDLVRF+KT+QKAGLYA+LRIGPY+
Sbjct  61   DLIRKAKHGGLDVIDTYVFWDVHEPSPSNYNFEGRYDLVRFIKTVQKAGLYANLRIGPYV  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            C EWNFGG PVWLK+VPGISFR DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQ
Sbjct  121  CAEWNFGGIPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +1

Query  82   MVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDV  258
            M   L    TQC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDL+ KAK+GG+DV
Sbjct  15   MAALLGFRSTQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWEDLMQKAKDGGLDV  74

Query  259  IETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWL  438
            ++TYVFWNVHEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPVWL
Sbjct  75   VDTYVFWNVHEPSPGNYDFEGRYDLVRFIKTAQRVGLYIHLRIGPYVCAEWNFGGFPVWL  134

Query  439  KFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            K+VPGISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  135  KYVPGISFRTDNGPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  182



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   284 bits (727),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
             QC V+YDRKAI+ING+RR+L SGSIHYPRSTP+MWE L+ KA++GG+DVI+TYVFWN H
Sbjct  20   AQCGVTYDRKAIIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGH  79

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPGNYNFEGRYDLVRF+KT  K G+Y HLRIGPY+CGEWNFGGFPVWLK+VPGISFR 
Sbjct  80   EPSPGNYNFEGRYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPVWLKYVPGISFRT  139

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK+AM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  140  DNEPFKIAMQGFTQKIVQMMKSESLFASQGGPIILSQI  177



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            V  + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   VFFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLV F+KT+QKAGL+ HLRIGPYIC EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVGFIKTVQKAGLFLHLRIGPYICAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK   LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKDEKLFASQGGPIILSQI  183



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
             QC V+YD KA++INGQRR+L SGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN H
Sbjct  24   AQCGVTYDSKAVIINGQRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGH  83

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPG+YNFEGRYDLVRF+KT+QK GLY HLRIGPYICGEWNFGGFPVWLK+V GISFR 
Sbjct  84   EPSPGSYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRT  143

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK AM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  144  DNEPFKNAMQGFTQKIVQMMKSESLFASQGGPIILSQI  181



>ref|XP_006423393.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
 gb|ESR36633.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
Length=728

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQI
Sbjct  130  VWLKFVQGISFRTDNKPFKHAMQNFTQKIVQMMKDEKLFKSQGGPIILSQI  180



>ref|XP_004500970.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Cicer arietinum]
Length=627

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  282
            G    +VSYDRK+++ING RR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20   GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  283  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  462
            VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPGISF
Sbjct  80   VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGISF  139

Query  463  RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            R DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQI
Sbjct  140  RTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQI  179



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  121  VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  300
            V+YDRKAI+I+GQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEPSP
Sbjct  21   VTYDRKAIIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  80

Query  301  GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEP  480
            G YNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DNEP
Sbjct  81   GTYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  140

Query  481  FKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FKMAM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  141  FKMAMQGFTQKIVQMMKSESLFGSQGGPIILSQI  174



>ref|XP_010049745.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82505.1| hypothetical protein EUGRSUZ_C03897 [Eucalyptus grandis]
Length=722

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LVL ++    +    CSVSYDRKAI+I+G+RR+L SGSIHYPRSTPEMW DLI KAKEGG
Sbjct  6    LVLALILLSWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIRKAKEGG  65

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFP
Sbjct  66   LDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFP  125

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLKFVPGI+FR +N+PF+ AM+ FT+KIVN+MK+  LF+SQGGPIILSQI
Sbjct  126  VWLKFVPGIAFRTNNKPFQDAMQRFTQKIVNMMKAERLFQSQGGPIILSQI  176



>ref|XP_006362025.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=727

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  61   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  240
            KW L+  ++ F  S +  CSV+YD+K+++INGQR++LFSGS+HYPRSTP+MWE +I KAK
Sbjct  6    KWFLIFFVLIF-GSKICYCSVTYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGIIQKAK  64

Query  241  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  420
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGEWNFG
Sbjct  65   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGEWNFG  124

Query  421  GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GFPVWLK+VPGISFR DNEPFK  M+ FT KIV +MK+  LF++QGG IILSQI
Sbjct  125  GFPVWLKYVPGISFRTDNEPFKREMQRFTTKIVQMMKNEKLFQTQGGHIILSQI  178



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
             QC V+YDRKA+VING RR+L SGSIHYPRSTP+MWE LI KAK+GG+DV++TYVFWN H
Sbjct  27   AQCGVTYDRKAVVINGHRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVVQTYVFWNGH  86

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPG+YNF+G YDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPVWLK+V GISFR 
Sbjct  87   EPSPGSYNFKGSYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRT  146

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DNEPFK AM+GFT+KIV +MKS +LF SQGGPIILSQI
Sbjct  147  DNEPFKTAMQGFTQKIVQMMKSESLFASQGGPIILSQI  184



>gb|EYU42595.1| hypothetical protein MIMGU_mgv1a001990mg [Erythranthe guttata]
Length=729

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 149/179 (83%), Gaps = 3/179 (2%)
 Frame = +1

Query  55   MRKWVLVLCMVFFLSSGL---TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  225
            M     VLC+           + CSV+YDRKA+VINGQR++LFSGSIHYPRS+P+MWE L
Sbjct  1    MEAKCFVLCVTLLNLLLFLQLSHCSVTYDRKALVINGQRKILFSGSIHYPRSSPDMWEGL  60

Query  226  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  405
            I KAK+GG+D I+TYVFW++HEPSPGNYNFEGR DL+RF+K + +AGLY HLRIGPYIC 
Sbjct  61   IQKAKDGGLDAIDTYVFWDLHEPSPGNYNFEGRCDLIRFIKLVHEAGLYLHLRIGPYICA  120

Query  406  EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EWNFGGFPVWLK+VPGISFR DNEPFKMAM+ FTEKIV +MK+  LF+SQGGPIILSQI
Sbjct  121  EWNFGGFPVWLKYVPGISFRTDNEPFKMAMQRFTEKIVGMMKNERLFQSQGGPIILSQI  179



>ref|XP_006487343.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=719

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDNKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQI
Sbjct  130  VWLKFVQGISFRTDNKPFKHAMQNFTQKIVLMMKDEKLFKSQGGPIILSQI  180



>gb|KJB65165.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65168.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=634

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQI
Sbjct  134  FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQI  186



>gb|EYU45189.1| hypothetical protein MIMGU_mgv1a003101mg [Erythranthe guttata]
Length=608

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LV+ ++  ++    + +VSYD KA +INGQR++L SGSIHYPRSTPEMW DLI KAK+GG
Sbjct  7    LVVTVLLAIACSSVRATVSYDDKAFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGG  66

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWN HEPSPGNYNFEGR+DLV+F+K   +AGLY HLRIGPY+CGEWNFGGFP
Sbjct  67   LDVIQTYVFWNGHEPSPGNYNFEGRFDLVKFIKLAHQAGLYVHLRIGPYVCGEWNFGGFP  126

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGI FR DN+PFK+AM+ F EKIVNLMKS NLFE +GGPII+SQI
Sbjct  127  VWLKYVPGIEFRTDNQPFKVAMQRFVEKIVNLMKSENLFEPRGGPIIMSQI  177



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
             LVL ++F L+    + +VSYD KA +ING+RR+L SGSIHYPRSTPEMW DLI KAK+G
Sbjct  12   TLVLVVLFSLACSSVRATVSYDDKAFIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDG  71

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWN HE SPG YNFEGR+DLV+F+K +Q+AGLY HLRIGPY+C EWNFGGF
Sbjct  72   GLDVIQTYVFWNGHEASPGKYNFEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGF  131

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGI FR DN+PFK+AM+GF EKIVN+MKS  LFESQGGPII+SQI
Sbjct  132  PVWLKYVPGIEFRTDNQPFKVAMQGFVEKIVNMMKSEKLFESQGGPIIMSQI  183



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W   L +   L+ G  +C V+YD KA+VING+RR+L SGSIHYPRST EMW DL  KAK+
Sbjct  6    WFAFLVLSVMLAVGGVECGVTYDHKALVINGERRILISGSIHYPRSTAEMWPDLFRKAKD  65

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN+HEPSPGNYNFEGR+DLV+FVK  Q+AGLY HLRIGPY+C EWNFGG
Sbjct  66   GGLDVIQTYVFWNMHEPSPGNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFGG  125

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DNEPFK AM+GFT+K+V+LMKS  LFESQGGPIIL+Q+
Sbjct  126  FPVWLKYVPGISFRTDNEPFKNAMEGFTKKVVDLMKSEGLFESQGGPIILAQV  178



>ref|XP_011457728.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=843

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            L Q +VSYDRKA+VINGQR++LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN+
Sbjct  23   LIQSNVSYDRKALVINGQRKILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIDTYVFWNL  82

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPGNYNFEGR DLVRF+K +Q+A LY HLRIGPYIC EWNFGGFPVWLK+VPGISFR
Sbjct  83   HEPSPGNYNFEGRNDLVRFIKMVQEARLYVHLRIGPYICSEWNFGGFPVWLKYVPGISFR  142

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQI
Sbjct  143  TDNEPFKSAMQKFTKKIVQLMKHEKLFESQGGPIILSQI  181



>ref|XP_002512959.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF49462.1| beta-galactosidase, putative [Ricinus communis]
Length=732

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  40   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  219
            + G +  KW+ +  ++  LSS + +C+V+YD+KA++INGQ+R+LFSGSIHYPRSTP+MWE
Sbjct  1    MEGNSATKWLSLCVVLLSLSSQIIECNVTYDKKALIINGQKRILFSGSIHYPRSTPQMWE  60

Query  220  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  399
             LI KAK+GG+DVI+TYVFWN+HEPSPGNYNFEGR DLV+F+K + KAGLY HLRIGPYI
Sbjct  61   GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFEGRNDLVQFIKLVHKAGLYVHLRIGPYI  120

Query  400  CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            CGEWNFGGFPVWLK++PG+ FR DNEPFK+ M+ FT+KIV +MK   L+ESQGGPIILSQ
Sbjct  121  CGEWNFGGFPVWLKYIPGMIFRTDNEPFKLQMQKFTQKIVQMMKDEQLYESQGGPIILSQ  180

Query  580  I  582
            I
Sbjct  181  I  181



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            +V+YDRKA++I+G+RR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  32   AVTYDRKAVLISGERRILFSGSIHYPRSTQEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  91

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PGNYNFEGRYDLVRF+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  92   PGNYNFEGRYDLVRFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  151

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            PFK AM+GFTEKIV +MKS  LF SQGGPIILSQ
Sbjct  152  PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQ  185



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            + QC V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21   VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  81   HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  140

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFKMAM+GFT+KIV ++KS +LF SQGGPIILSQI
Sbjct  141  TDNEPFKMAMQGFTQKIVQMLKSESLFASQGGPIILSQI  179



>ref|XP_004500969.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Cicer arietinum]
Length=732

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  103  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  282
            G    +VSYDRK+++ING RR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20   GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  283  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  462
            VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPGISF
Sbjct  80   VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGISF  139

Query  463  RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            R DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQI
Sbjct  140  RTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQI  179



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            VL + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11   VLFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLV F+KT++KAGL  HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEERYDLVGFIKTVEKAGLLLHLRIGPYVCAEWNFGG  130

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK   LF SQGGPIILSQI
Sbjct  131  FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKDEKLFASQGGPIILSQI  183



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  106  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  285
            + QC V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21   VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  286  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  465
            HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  81   HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  140

Query  466  ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
             DNEPFKMAM+GFT+KIV ++KS +LF SQGGPIILSQI
Sbjct  141  TDNEPFKMAMQGFTQKIVQMLKSESLFASQGGPIILSQI  179



>ref|XP_008643999.1| PREDICTED: uncharacterized protein LOC100382452 isoform X1 [Zea 
mays]
 tpg|DAA43552.1| TPA: hypothetical protein ZEAMMB73_935084 [Zea mays]
Length=845

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  124  SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  303
            +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  30   TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  89

Query  304  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  483
            NY FE RYDLVRFVKT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  90   NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  149

Query  484  KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            K AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  150  KTAMQGFTEKIVGMMKSENLFASQGGPIILSQI  182



>gb|KJB65166.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=697

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQI
Sbjct  134  FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQI  186



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  124  SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  303
            +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE+LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28   TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEELIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  304  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  483
            NY FE RYDLVRFVKT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88   NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  484  KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            K AM+GFTEKIV +MKS  LF SQGGPIILSQI
Sbjct  148  KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQI  180



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 2/169 (1%)
 Frame = +1

Query  76   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  255
            +C + F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+D
Sbjct  14   ICSLDFFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLD  71

Query  256  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  435
            VIETYVFWN HEPSPG YNFEGRYDLVRF+K  Q+AGLY +LRIGPYIC EWNFGGFPVW
Sbjct  72   VIETYVFWNAHEPSPGKYNFEGRYDLVRFIKLAQRAGLYVNLRIGPYICAEWNFGGFPVW  131

Query  436  LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            LK+VPG+ FR DN+PFK+AM+GF +KIVN+MKS NLFE QGGPII++QI
Sbjct  132  LKYVPGMEFRTDNQPFKVAMQGFVQKIVNMMKSENLFEPQGGPIIMAQI  180



>emb|CDX88594.1| BnaA03g10550D [Brassica napus]
Length=325

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + W+   +LC    + S   + +VSYDRKA++INGQRR+L SGSIHYPRSTPEMW  LI 
Sbjct  8    KAWIFLAILCYSSLICS--VKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DVIETYVFWN HEPSPGNY F  RYDLV+F+K + +AGLY +LRIGPY+C EW
Sbjct  66   KAKEGGLDVIETYVFWNGHEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLKFVPG++FR DNEPFK AMK FTEKIV +MK+  LF++QGGPIIL+QI
Sbjct  126  NFGGFPVWLKFVPGMAFRTDNEPFKAAMKKFTEKIVWMMKAEKLFQTQGGPIILAQI  182



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
            + SVSYD+KAI+INGQRR+LFSGSIHYPRSTPEMW DLI KAK+GG+D I+TYVFWN HE
Sbjct  38   KASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYVFWNGHE  97

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGI FR D
Sbjct  98   PSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  157

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK+ M+GFT+KIV++MK+ NLFE QGGPII+SQI
Sbjct  158  NEPFKVTMQGFTKKIVDMMKAENLFEPQGGPIIMSQI  194



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  124  SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  303
            +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28   TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  304  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  483
            NY FE RYDLVRF+KT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88   NYYFEERYDLVRFIKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  484  KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            K AM+GFTEKIV +MKS  LF SQGGPIILSQI
Sbjct  148  KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQI  180



>ref|NP_194344.2| beta-galactosidase 12 [Arabidopsis thaliana]
 gb|AAM20463.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN15586.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85163.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=636

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRSTPEMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPG+ FR DNEPFK AM+ FTEKIV +MK   LFE+QGGPIILSQI
Sbjct  126  NFGGFPVWLKYVPGMVFRTDNEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQI  182



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LVL ++    +    CSVSYDRKAI+I+G+RR+L SGSIHYPRSTPEMW DLI KAK+GG
Sbjct  6    LVLALILLSWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIWKAKQGG  65

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWN HEPSPGNY F+ RYDLV+F+K +Q+AGLY HLRIGPY+C EWNFGGFP
Sbjct  66   LDVIQTYVFWNGHEPSPGNYYFQDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFP  125

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGI+FR +N+PF+ AM+ FT+KIVN+MK+  LF+SQGGPIILSQI
Sbjct  126  VWLKYVPGIAFRTNNKPFEDAMQKFTQKIVNMMKAERLFQSQGGPIILSQI  176



>gb|KGN53283.1| hypothetical protein Csa_4G044980 [Cucumis sativus]
Length=180

 Score =   258 bits (658),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 139/170 (82%), Gaps = 11/170 (6%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            L L      +S L   +V+YDRKAI+INGQRR+LFSGSIHYPRSTPE+            
Sbjct  10   LFLIAFLLANSHLIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEV-----------C  58

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  59   LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFP  118

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            VWLK+VPGISFR DNE FK AM+GFTEKIV LMKS NLFESQGGPIIL+Q
Sbjct  119  VWLKYVPGISFRTDNEAFKNAMQGFTEKIVALMKSENLFESQGGPIILAQ  168



>gb|KJB65169.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=811

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQI
Sbjct  134  FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQI  186



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = +1

Query  58   RKWVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            RK+ +V+ +V FL   +     SV+YD KAIVINGQRR+L SGSIHYPRSTP+MW DLI 
Sbjct  8    RKFYMVIGLVLFLCLFVFSVTASVTYDHKAIVINGQRRILISGSIHYPRSTPQMWPDLIQ  67

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GGVDVI+TYVFWN HEPSPGNY FE R+DLV+FVK +Q+AGLY +LRIGPY+C EW
Sbjct  68   KAKDGGVDVIQTYVFWNGHEPSPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYVCAEW  127

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPG++FR DNEPFK AM+ FT KIV++MK+ NLFESQGGPII+SQI
Sbjct  128  NFGGFPVWLKYVPGVAFRTDNEPFKAAMQKFTAKIVSMMKAENLFESQGGPIIMSQI  184



>gb|KCW69753.1| hypothetical protein EUGRSUZ_F031302, partial [Eucalyptus grandis]
Length=518

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  5    LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65   KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK++PGI+FR DNEPFK  M+ F  KIVN+MK+  LFESQGGPIILSQI
Sbjct  125  GGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFESQGGPIILSQI  179



>ref|XP_007017651.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
 gb|EOY14876.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
Length=760

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 5/165 (3%)
 Frame = +1

Query  88   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  267
              + S L QCS++YD+KAIV     R+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  54   LLVCSKLIQCSITYDKKAIV-----RILISGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  108

Query  268  YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  447
            YVFWN HE SPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  109  YVFWNGHELSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYVCAEWNFGGFPVWLKYV  168

Query  448  PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  169  PGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQI  213



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVSA----TVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQI
Sbjct  134  FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQI  186



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 4/173 (2%)
 Frame = +1

Query  64   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  243
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVSA----TVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  244  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  423
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  424  FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQI
Sbjct  134  FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQI  186



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            ++++C+ F L       SV YD+K IV+NGQR++L SGSIHYPRSTP+MWEDLI+KAK G
Sbjct  11   IILVCVSFVLG---VHSSVIYDKKGIVVNGQRKILISGSIHYPRSTPDMWEDLITKAKHG  67

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+KT+Q+ GLY +LRIGPY+C EWNFGGF
Sbjct  68   GLDVIDTYVFWNGHEPSPGKYYFEGRYDLVRFIKTVQRVGLYVNLRIGPYVCAEWNFGGF  127

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQI
Sbjct  128  PVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNERLFASQGGPIILSQI  179



>gb|AAC25984.1| beta-galactosidase [Solanum lycopersicum]
Length=724

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +1

Query  91   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  270
            F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17   FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  271  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  450
            VFWN HEPSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75   VFWNGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  451  GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QI
Sbjct  135  GMEFRTNNQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQI  178



>gb|ADO34789.1| beta-galactosidase STBG4 [Solanum lycopersicum]
Length=724

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +1

Query  91   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  270
            F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17   FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  271  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  450
            VFWN HEPSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75   VFWNGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  451  GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QI
Sbjct  135  GMEFRTNNQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQI  178



>ref|XP_010051543.1| PREDICTED: beta-galactosidase [Eucalyptus grandis]
Length=790

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +1

Query  67   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            +LVL +V    S    CSVSYDRKAIVI+GQRR+L SGSIHYPRSTPEMW DL+ KAK G
Sbjct  42   ILVLALVLISWSRSVSCSVSYDRKAIVIDGQRRILISGSIHYPRSTPEMWPDLLQKAKAG  101

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVI+TYVFWN HEPS G Y FE R+DLVRF+K +Q AGLY HLRIGPY+C EWNFGGF
Sbjct  102  GLDVIQTYVFWNGHEPSRGKYYFEDRFDLVRFIKLVQHAGLYVHLRIGPYVCAEWNFGGF  161

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPGI+FR DN+PFK AM+GFT+KIV++MK+  LF+ QGGPIILSQI
Sbjct  162  PVWLKYVPGIAFRTDNQPFKDAMQGFTQKIVDMMKAEKLFQPQGGPIILSQI  213



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  294
            CSVSYD KAI+INGQRR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HEP
Sbjct  37   CSVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  96

Query  295  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  474
            SPG Y FEGRYDLV+F+K +++AGLY HLRIGPY C EWNFGGFPVWLK++PGISFR DN
Sbjct  97   SPGEYYFEGRYDLVKFIKLVKEAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTDN  156

Query  475  EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EPFK AM GFT+KIV++MK   LFE+QGGPIILSQI
Sbjct  157  EPFKTAMAGFTKKIVDMMKEEELFETQGGPIILSQI  192



>gb|KCW69752.1| hypothetical protein EUGRSUZ_F031302 [Eucalyptus grandis]
Length=546

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +1

Query  70   LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  5    LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65   KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK++PGI+FR DNEPFK  M+ F  KIVN+MK+  LFESQGGPIILSQI
Sbjct  125  GGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFESQGGPIILSQI  179



>ref|XP_010545349.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Tarenaya hassleriana]
Length=588

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  58   RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            + W+L++ +     S + + +VSYD KA++INGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  8    KGWILLVILCCSSISSV-KGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKA  66

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            K+GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF++ +QKAGLY HLRIGPY+C EWNF
Sbjct  67   KDGGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNF  126

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK+VPGI+FR +N PFK AM+ FT+KIV +MK+  LFE+QGGPIILSQI
Sbjct  127  GGFPVWLKYVPGIAFRTNNGPFKAAMQKFTQKIVGMMKAEKLFETQGGPIILSQI  181



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            SV+YD+KAIVING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HEPS
Sbjct  31   SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DN+
Sbjct  91   PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PFK AM+GFT+KIV++MK+  LF+SQGGPIILSQI
Sbjct  151  PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQI  185



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  70   LVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  246
            L+L +VFF       + SV+YD +AIVING+RR+L SGSIHYPRSTPEMW DLI KAK+G
Sbjct  8    LLLFIVFFSFIYSSVRASVTYDDRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDG  67

Query  247  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  426
            G+DVIETYVFWN HEPSPG +NFEGRYDLV+F+K +Q+AGLY +LRIGPY+C EWNFGGF
Sbjct  68   GLDVIETYVFWNGHEPSPGKFNFEGRYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGF  127

Query  427  PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PVWLK+VPG+ FRADN+PFK+AM+GF EKIVN+MKS NLFE QGGPII++QI
Sbjct  128  PVWLKYVPGMEFRADNQPFKVAMQGFVEKIVNMMKSGNLFEPQGGPIIMAQI  179



>ref|XP_004174126.1| PREDICTED: beta-galactosidase-like, partial [Cucumis sativus]
Length=154

 Score =   255 bits (651),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            SV+YD KAI+INGQRR+L SGSIHYPRSTP+MW DLI KAK+GG+D+IETYVFWN HEPS
Sbjct  1    SVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFWNGHEPS  60

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            P  Y FE RYDLVRF+K +Q+AGLY HLRIGPY+C EWN+GGFP+WLKFVPGI+FR DN 
Sbjct  61   PDKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPLWLKFVPGIAFRTDNA  120

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  579
            PFK AM+ F  KIV++MK   LF +QGGPIILSQ
Sbjct  121  PFKAAMQKFVYKIVDMMKWEKLFHTQGGPIILSQ  154



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            SV+YD+KAIVING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HEPS
Sbjct  31   SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DN+
Sbjct  91   PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PFK AM+GFT+KIV++MK+  LF+SQGGPIILSQI
Sbjct  151  PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQI  185



>gb|KCW79522.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=615

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  294
             SV+YD +A+++NG+RR+L SGSIHYPRSTP MW DLI KAK+GG+DVI+TYVFWN HEP
Sbjct  42   ASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGHEP  101

Query  295  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  474
            SPG Y FE RYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLKFVPGI FR DN
Sbjct  102  SPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRTDN  161

Query  475  EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EPFK AM+ FTEKIVN+MK+ NLFESQGGPIILSQ+
Sbjct  162  EPFKAAMQRFTEKIVNMMKAENLFESQGGPIILSQV  197



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MRKWVLVLC--MVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  228
            +R  VL +C  + F L       SV+YD KAI INGQRR+LFSGSIHYPRSTPEMW  LI
Sbjct  5    LRIKVLFVCVGLFFLLCCCSVTASVTYDGKAIKINGQRRILFSGSIHYPRSTPEMWPGLI  64

Query  229  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  408
             KAKEGG+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+K  Q+AGLY HLRIG Y+C E
Sbjct  65   QKAKEGGLDVIQTYVFWNGHEPSPGQYYFEGRYDLVRFIKLAQQAGLYVHLRIGLYVCAE  124

Query  409  WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WNFGGFPVWLK+VPGI+FR DN PFK AM+ FTEKIVNLMKS  LFESQGGPII+SQI
Sbjct  125  WNFGGFPVWLKYVPGIAFRTDNGPFKAAMQKFTEKIVNLMKSEKLFESQGGPIIMSQI  182



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  109  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  288
            TQC+V YDRKA+VIN QR++ FSGSIHYPRSTP+MW  L+ KAK+GG+DVI+TYVFWN+H
Sbjct  25   TQCNVGYDRKALVINAQRKLFFSGSIHYPRSTPQMWAGLVQKAKDGGLDVIDTYVFWNLH  84

Query  289  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  468
            EPSPGNYNFEGR DLV F+KT+Q+AGLY HLRIGPYIC EWNFGGFPVWLK+VPGISFR 
Sbjct  85   EPSPGNYNFEGRNDLVGFIKTVQRAGLYVHLRIGPYICSEWNFGGFPVWLKYVPGISFRT  144

Query  469  DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            DN PFK AM+ FT+KIV +MK   LF+SQGGPIILSQI
Sbjct  145  DNGPFKSAMQKFTQKIVQMMKDEKLFQSQGGPIILSQI  182



>gb|KCW82245.1| hypothetical protein EUGRSUZ_C03662 [Eucalyptus grandis]
Length=763

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  249
            LVL +V    S    CSVSYDRKAIVI+GQRR+L SGSIHYPRSTPEMW DL+ KAK GG
Sbjct  16   LVLALVLISWSRSVSCSVSYDRKAIVIDGQRRILISGSIHYPRSTPEMWPDLLQKAKAGG  75

Query  250  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  429
            +DVI+TYVFWN HEPS G Y FE R+DLVRF+K +Q AGLY HLRIGPY+C EWNFGGFP
Sbjct  76   LDVIQTYVFWNGHEPSRGKYYFEDRFDLVRFIKLVQHAGLYVHLRIGPYVCAEWNFGGFP  135

Query  430  VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            VWLK+VPGI+FR DN+PFK AM+GFT+KIV++MK+  LF+ QGGPIILSQI
Sbjct  136  VWLKYVPGIAFRTDNQPFKDAMQGFTQKIVDMMKAEKLFQPQGGPIILSQI  186



>pdb|3W5F|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5F|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5G|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
 pdb|3W5G|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
Length=718

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  118  SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  297
            SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETYVFWN HEPS
Sbjct  7    SVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEPS  66

Query  298  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  477
            PG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VPG+ FR +N+
Sbjct  67   PGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTNNQ  126

Query  478  PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            PFK+AM+GF +KIVN+MKS NLFESQGGPII++QI
Sbjct  127  PFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQI  161



>ref|NP_849553.1| beta-galactosidase 12 [Arabidopsis thaliana]
 sp|Q9SCV0.1|BGA12_ARATH RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64748.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85162.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=728

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRSTPEMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPG+ FR DNEPFK AM+ FTEKIV +MK   LFE+QGGPIILSQI
Sbjct  126  NFGGFPVWLKYVPGMVFRTDNEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQI  182



>emb|CAB39679.1| putative beta-galactosidase [Arabidopsis thaliana]
 emb|CAB79469.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=729

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRSTPEMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLK+VPG+ FR DNEPFK AM+ FTEKIV +MK   LFE+QGGPIILSQI
Sbjct  126  NFGGFPVWLKYVPGMVFRTDNEPFKAAMQKFTEKIVRMMKEEKLFETQGGPIILSQI  182



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  73   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  252
            VL ++FF   G+T  SV+YD KAIVI+G+RR+L SGSIHYPRSTP+MW DLI KAK+GG+
Sbjct  10   VLMLLFFWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGL  68

Query  253  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  432
            DVI+TYVFWN HEPSPG Y FE RYDLVRFVK  Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69   DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKLAQQAGLYVHLRIGPYICAEWNFGGFPV  128

Query  433  WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WLK+VPGI+FR DNEPFK AM+ FT KIV+LMK   LF+SQGGPIILSQI
Sbjct  129  WLKYVPGIAFRTDNEPFKAAMQKFTAKIVSLMKEERLFQSQGGPIILSQI  178



>gb|KEH39519.1| beta-galactosidase [Medicago truncatula]
Length=590

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +1

Query  115  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  294
             SVSYD KAI INGQ R+L SGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  26   ASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  85

Query  295  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  474
            SPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK++PGISFR DN
Sbjct  86   SPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  475  EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            EPFK  M+ FTEKIV++MK+  LFESQGGPII+SQI
Sbjct  146  EPFKFQMQKFTEKIVDMMKADRLFESQGGPIIMSQI  181



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  73   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  252
            VL ++F    G+T  SV+YD KAIVI+G+RR+L SGSIHYPRSTP+MW DLI KAK+GGV
Sbjct  10   VLMLLFLWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGV  68

Query  253  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  432
            DVI+TYVFWN HEPSPG Y FE RYDLVRFVK +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69   DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKVVQQAGLYVHLRIGPYICAEWNFGGFPV  128

Query  433  WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WLK+VPG++FR DNEPFK AM+ FT KIV+LMK   LF+SQGGPII+SQI
Sbjct  129  WLKYVPGMAFRTDNEPFKAAMQKFTAKIVSLMKEERLFQSQGGPIIMSQI  178



>gb|KDO57768.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
 gb|KDO57769.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=605

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = +1

Query  16   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  195
            +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4    KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  196  RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  375
            RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64   RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  376  HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  555
            HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124  HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  556  GGPIILSQI  582
            GGPIILSQI
Sbjct  184  GGPIILSQI  192



>gb|KCW82506.1| hypothetical protein EUGRSUZ_C03898, partial [Eucalyptus grandis]
Length=700

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +1

Query  73   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  252
            +L ++    +    CSVSYDRKAIVI+G+RR+L SGSIHYPRSTPEMW DLI KAK GGV
Sbjct  1    MLALILLSWASSVSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGV  60

Query  253  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  432
            DVI++YVFWN HEPSPG Y FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  61   DVIQSYVFWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPV  120

Query  433  WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WLKFVPGISFR DN+ FK AM+ FT KIV++MK+  LF+SQGGPIILSQI
Sbjct  121  WLKFVPGISFRTDNKAFKDAMQRFTYKIVDIMKAERLFQSQGGPIILSQI  170



>ref|XP_009402923.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=733

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
              SVSYDRKA++ING RR+LFSGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  34   DASVSYDRKAVIINGHRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  93

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPG Y F G YDLVRFVK +++AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  94   PSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  153

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            N PFK AM  FTEKIV++MKS  LFESQGGPIILSQI
Sbjct  154  NGPFKAAMAKFTEKIVSMMKSQGLFESQGGPIILSQI  190



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +1

Query  76   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  255
            + +VF         SV+YD KAI+ING+RR+L SGSIHYPRSTP+MW DLI KAK+GG+D
Sbjct  7    IMVVFLWVCSSVMASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLD  66

Query  256  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  435
            VI+TYVFWN HEPSPG+YNFE RYDLVRFVK +Q+AGLY HLRIGPY+C EWNFGGFPVW
Sbjct  67   VIDTYVFWNGHEPSPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVW  126

Query  436  LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            LK+VPGI+FR DN PFK AM+ FTEKIV +MK   L+ESQGGPIILSQI
Sbjct  127  LKYVPGIAFRTDNGPFKAAMQKFTEKIVGVMKGEKLYESQGGPIILSQI  175



>ref|XP_010049744.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
Length=703

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +1

Query  73   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  252
            +L ++    +    CSVSYDRKAIVI+G+RR+L SGSIHYPRSTPEMW DLI KAK GGV
Sbjct  1    MLALILLSWASSVSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRGGV  60

Query  253  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  432
            DVI++YVFWN HEPSPG Y FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  61   DVIQSYVFWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGFPV  120

Query  433  WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            WLKFVPGISFR DN+ FK AM+ FT KIV++MK+  LF+SQGGPIILSQI
Sbjct  121  WLKFVPGISFRTDNKAFKDAMQRFTYKIVDIMKAERLFQSQGGPIILSQI  170



>ref|NP_001234842.1| ss-galactosidase precursor [Solanum lycopersicum]
 emb|CAA10175.1| ss-galactosidase [Solanum lycopersicum]
Length=724

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +1

Query  91   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  270
            F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17   FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  271  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  450
            VFWN H PSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75   VFWNGHGPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  451  GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QI
Sbjct  135  GMEFRTNNQPFKVAMRGFVQKIVNMMKSENLFESQGGPIIMAQI  178



>ref|XP_003595163.1| Beta-galactosidase [Medicago truncatula]
 gb|KEH37472.1| beta-like galactosidase [Medicago truncatula]
Length=607

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +1

Query  58   RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            R+   +L + FF+       SV+YD KAIVING+RR+L SGSIHYPRSTP+MW DLI KA
Sbjct  9    RRNCYILFLCFFVC--YVTASVTYDHKAIVINGKRRILISGSIHYPRSTPQMWPDLIQKA  66

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            K+GGVDVIETYVFWN HEPS G Y FE R+DLV+F+K +Q+AGLY HLRIGPY+C EWNF
Sbjct  67   KDGGVDVIETYVFWNGHEPSQGKYYFEDRFDLVKFIKVVQQAGLYVHLRIGPYVCAEWNF  126

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK+VPG++FR DNEPFK AM+ FT KIV++MKS NLF+SQGGPIILSQI
Sbjct  127  GGFPVWLKYVPGVAFRTDNEPFKAAMQKFTTKIVSIMKSENLFQSQGGPIILSQI  181



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  291
              SVSYDRKA++ING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  39   DASVSYDRKALIINGRRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  98

Query  292  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  471
            PSPG Y F G YDLVRFVK +++AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  99   PSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  158

Query  472  NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NEPFK AM  FTEKIV++MKS  LFESQGGPIILSQI
Sbjct  159  NEPFKAAMSKFTEKIVSVMKSEGLFESQGGPIILSQI  195



>ref|XP_009137581.1| PREDICTED: beta-galactosidase 12-like [Brassica rapa]
Length=729

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + WV   VLC    + S   + +V+YD KA++INGQRR+L SGSIHYPRSTPEMW DLI 
Sbjct  8    KAWVFLWVLCCSSLICS--VKATVTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKEGGLDVIQTYVFWNGHEPSPGQYYFEERYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFPVWLKFVP ++FR DNEPFK AM+ FTEKIV +MK   LFE+QGGPIILSQI
Sbjct  126  NFGGFPVWLKFVPDMAFRTDNEPFKAAMQKFTEKIVGMMKQEKLFETQGGPIILSQI  182



>ref|XP_006413222.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
 gb|ESQ54675.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
Length=737

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  58   RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  231
            + W+   +LC    + S   +  VSYD KA++INGQRR+L SGSIHYPRSTPEMW DLI 
Sbjct  8    KAWIFLGILCCSSLICS--VKAMVSYDHKAVIINGQRRILVSGSIHYPRSTPEMWPDLIQ  65

Query  232  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  411
            KAKEGG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKEGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  412  NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            NFGGFP+WLK+VPG++FR DNEPFK AM+ FTEKIV +MK   LFE+QGGPIILSQI
Sbjct  126  NFGGFPIWLKYVPGMAFRTDNEPFKAAMQTFTEKIVGMMKEEKLFETQGGPIILSQI  182



>gb|KDO57766.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=649

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = +1

Query  16   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  195
            +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4    KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  196  RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  375
            RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64   RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  376  HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  555
            HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124  HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  556  GGPIILSQI  582
            GGPIILSQI
Sbjct  184  GGPIILSQI  192



>gb|AAN60229.1| unknown [Arabidopsis thaliana]
Length=569

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +1

Query  58   RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  237
            + W+ +  + F      T+  V+YD KA++INGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  8    KAWIFLAILCFSSLIHSTEAVVTYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIKKA  67

Query  238  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  417
            KEGG+DVI+TYVFWN HEPSPGNY F+ RYDLV+F K + +AGLY  LRIGPY+C EWNF
Sbjct  68   KEGGLDVIQTYVFWNGHEPSPGNYYFQDRYDLVKFTKLVHQAGLYLDLRIGPYVCAEWNF  127

Query  418  GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  582
            GGFPVWLK+VPG+ FR DNEPFK+AM+ FT+KIV++MK   LFE+QGGPIILSQI
Sbjct  128  GGFPVWLKYVPGMVFRTDNEPFKIAMQKFTKKIVDMMKEEKLFETQGGPIILSQI  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455