BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS116G11

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614453.1|  PREDICTED: putative leucine--tRNA ligase, mi...    228   7e-66   Nicotiana tomentosiformis
ref|XP_004232688.1|  PREDICTED: putative leucine--tRNA ligase, mi...    224   2e-64   
ref|XP_010316571.1|  PREDICTED: putative leucine--tRNA ligase, mi...    224   2e-64   
gb|KDO78326.1|  hypothetical protein CISIN_1g002217mg                   219   3e-64   Citrus sinensis [apfelsine]
ref|XP_006348152.1|  PREDICTED: putative leucine--tRNA ligase, mi...    223   8e-64   Solanum tuberosum [potatoes]
ref|XP_010686792.1|  PREDICTED: putative leucine--tRNA ligase, mi...    222   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009800377.1|  PREDICTED: putative leucine--tRNA ligase, mi...    221   2e-63   Nicotiana sylvestris
gb|KDO78323.1|  hypothetical protein CISIN_1g002217mg                   219   7e-63   Citrus sinensis [apfelsine]
ref|XP_006449782.1|  hypothetical protein CICLE_v10014171mg             219   7e-63   Citrus clementina [clementine]
ref|XP_006467397.1|  PREDICTED: putative leucine--tRNA ligase, mi...    219   7e-63   Citrus sinensis [apfelsine]
gb|KDO78324.1|  hypothetical protein CISIN_1g002217mg                   219   8e-63   Citrus sinensis [apfelsine]
ref|XP_006467396.1|  PREDICTED: putative leucine--tRNA ligase, mi...    219   8e-63   Citrus sinensis [apfelsine]
ref|XP_011002586.1|  PREDICTED: putative leucine--tRNA ligase, mi...    219   1e-62   Populus euphratica
gb|EPS64803.1|  hypothetical protein M569_09978                         204   1e-62   Genlisea aurea
ref|XP_004134980.1|  PREDICTED: leucine--tRNA ligase-like               219   2e-62   Cucumis sativus [cucumbers]
ref|XP_004155678.1|  PREDICTED: leucine--tRNA ligase-like               219   2e-62   
ref|XP_008440038.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    218   5e-62   Cucumis melo [Oriental melon]
ref|XP_002264138.1|  PREDICTED: putative leucine--tRNA ligase, mi...    217   7e-62   Vitis vinifera
ref|XP_007026156.1|  TRNA synthetase class I (I, L, M and V) fami...    215   7e-62   
ref|XP_011095981.1|  PREDICTED: putative leucine--tRNA ligase, mi...    216   1e-61   Sesamum indicum [beniseed]
ref|XP_002317141.1|  hypothetical protein POPTR_0011s01420g             216   2e-61   
ref|XP_007026155.1|  TRNA synthetase class I (I, L, M and V) fami...    216   2e-61   
ref|XP_010057899.1|  PREDICTED: putative leucine--tRNA ligase, mi...    214   1e-60   
ref|XP_008384092.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   2e-60   
ref|XP_002518434.1|  leucyl-tRNA synthetase, putative                   213   2e-60   Ricinus communis
emb|CAN74190.1|  hypothetical protein VITISV_036142                     211   1e-59   Vitis vinifera
ref|XP_008224706.1|  PREDICTED: putative leucine--tRNA ligase, mi...    211   1e-59   Prunus mume [ume]
ref|XP_007153983.1|  hypothetical protein PHAVU_003G081300g             209   2e-59   Phaseolus vulgaris [French bean]
ref|XP_007153984.1|  hypothetical protein PHAVU_003G081300g             210   2e-59   Phaseolus vulgaris [French bean]
ref|XP_009357478.1|  PREDICTED: putative leucine--tRNA ligase, mi...    210   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_007213686.1|  hypothetical protein PRUPE_ppa000869mg             210   3e-59   Prunus persica
ref|XP_004295290.1|  PREDICTED: putative leucine--tRNA ligase, mi...    209   4e-59   Fragaria vesca subsp. vesca
gb|KFK30967.1|  hypothetical protein AALP_AA6G050800                    209   4e-59   Arabis alpina [alpine rockcress]
gb|KDP20709.1|  hypothetical protein JCGZ_21180                         209   4e-59   Jatropha curcas
gb|KJB67266.1|  hypothetical protein B456_010G183100                    209   5e-59   Gossypium raimondii
gb|KHG27983.1|  Leucine--tRNA ligase                                    208   9e-59   Gossypium arboreum [tree cotton]
emb|CDP04435.1|  unnamed protein product                                208   1e-58   Coffea canephora [robusta coffee]
ref|XP_010099169.1|  Leucine--tRNA ligase                               208   1e-58   Morus notabilis
ref|XP_010272272.1|  PREDICTED: putative leucine--tRNA ligase, mi...    207   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010422266.1|  PREDICTED: putative leucine--tRNA ligase, mi...    207   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010432889.1|  PREDICTED: putative leucine--tRNA ligase, mi...    207   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002872690.1|  EMB2369                                            207   2e-58   
ref|XP_010422265.1|  PREDICTED: putative leucine--tRNA ligase, mi...    207   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006396696.1|  hypothetical protein EUTSA_v10028396mg             207   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006287002.1|  hypothetical protein CARUB_v10000148mg             207   4e-58   Capsella rubella
ref|XP_009134299.1|  PREDICTED: putative leucine--tRNA ligase, mi...    206   5e-58   Brassica rapa
emb|CDX90858.1|  BnaA03g25380D                                          206   6e-58   
emb|CDY21299.1|  BnaC03g29830D                                          206   6e-58   Brassica napus [oilseed rape]
ref|NP_192344.1|  tRNA synthetase class I (I, L, M and V) family ...    205   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529456.1|  PREDICTED: putative leucine--tRNA ligase, mi...    205   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_003529648.1|  PREDICTED: putative leucine--tRNA ligase, mi...    204   2e-57   Glycine max [soybeans]
gb|AES92665.2|  leucyl-tRNA synthetase                                  204   3e-57   Medicago truncatula
ref|XP_010916288.1|  PREDICTED: putative leucine--tRNA ligase, mi...    204   3e-57   Elaeis guineensis
ref|XP_003619258.1|  Leucyl-tRNA synthetase                             204   4e-57   
ref|XP_003610468.1|  Leucyl-tRNA synthetase                             205   4e-57   
ref|XP_010496176.1|  PREDICTED: putative leucine--tRNA ligase, mi...    204   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010496177.1|  PREDICTED: putative leucine--tRNA ligase, mi...    204   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009358062.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    201   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_009390214.1|  PREDICTED: putative leucine--tRNA ligase, mi...    200   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390213.1|  PREDICTED: putative leucine--tRNA ligase, mi...    200   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776029.1|  PREDICTED: putative leucine--tRNA ligase, mi...    200   7e-56   Phoenix dactylifera
ref|XP_006600301.1|  PREDICTED: LOW QUALITY PROTEIN: leucine--tRN...    199   1e-55   
ref|XP_006838108.1|  hypothetical protein AMTR_s00106p00046740          195   4e-54   Amborella trichopoda
gb|EEC69839.1|  hypothetical protein OsI_00164                          195   5e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_006643717.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    194   1e-53   
gb|EEE53778.1|  hypothetical protein OsJ_00171                          195   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765367.1|  predicted protein                                  192   6e-53   
ref|XP_002455289.1|  hypothetical protein SORBIDRAFT_03g007890          192   9e-53   Sorghum bicolor [broomcorn]
ref|XP_010230387.1|  PREDICTED: putative leucine--tRNA ligase, mi...    191   2e-52   
ref|XP_004968118.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    190   4e-52   
ref|XP_002948892.1|  hypothetical protein VOLCADRAFT_89222              189   5e-52   Volvox carteri f. nagariensis
ref|XP_011398417.1|  Leucine-tRNA ligase                                190   9e-52   Auxenochlorella protothecoides
emb|CBH32645.1|  leucyl-tRNA synthetase, putative, expressed            188   2e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008655584.1|  PREDICTED: putative leucine--tRNA ligase, mi...    187   6e-51   
emb|CDM80420.1|  unnamed protein product                                186   8e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005842216.1|  leucyl-tRNA synthetase                             185   1e-50   Guillardia theta CCMP2712
ref|XP_003079670.1|  Isoleucyl-tRNA synthetase (ISS)                    184   4e-50   Ostreococcus tauri
ref|XP_001418146.1|  predicted protein                                  181   3e-49   Ostreococcus lucimarinus CCE9901
ref|WP_006930182.1|  leucyl-tRNA synthetase                             181   4e-49   Caldithrix abyssi
emb|CCG48000.1|  leucyl-tRNA synthetase, putative, expressed            181   6e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003059586.1|  predicted protein                                  181   2e-48   Micromonas pusilla CCMP1545
ref|WP_038556448.1|  leucyl-tRNA synthetase                             179   3e-48   Draconibacterium orientale
ref|WP_021267760.1|  leucyl-tRNA synthetase                             178   3e-48   Bacteriovorax sp. BAL6_X
ref|XP_005651384.1|  putative leucyl tRNA synthetase                    179   3e-48   Coccomyxa subellipsoidea C-169
gb|KJF44738.1|  leucyl-tRNA synthase                                    178   4e-48   Draconibacterium sediminis
ref|XP_007513267.1|  leucyl-tRNA synthetase                             179   4e-48   Bathycoccus prasinos
ref|XP_005537865.1|  leucine--tRNA ligase                               177   3e-47   Cyanidioschyzon merolae strain 10D
gb|EMS46157.1|  Leucyl-tRNA synthetase                                  175   6e-47   Triticum urartu
ref|WP_021978830.1|  leucyl-tRNA synthetase                             174   8e-47   
dbj|BAD52586.1|  putative leucyl-tRNA synthetase                        175   8e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EMY07084.1|  tRNA ligases class I domain protein                     164   2e-46   Leptospira interrogans str. 2002000626
ref|XP_005851157.1|  hypothetical protein CHLNCDRAFT_55974              173   2e-46   Chlorella variabilis
ref|WP_011403694.1|  leucyl-tRNA synthetase                             173   3e-46   Salinibacter ruber
ref|WP_001199935.1|  hypothetical protein                               164   3e-46   
ref|WP_021270809.1|  leucyl-tRNA synthetase                             172   3e-46   Bacteriovorax sp. BSW11_IV
ref|WP_025704615.1|  leucyl-tRNA synthetase                             168   3e-46   Paenibacillus graminis
ref|WP_027088225.1|  leucyl-tRNA synthetase                             172   3e-46   Cohnella panacarvi
ref|WP_012095876.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus cytotoxicus
ref|WP_000009445.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus cereus
ref|WP_014067706.1|  leucyl-tRNA synthetase                             173   4e-46   Rhodothermus marinus
ref|WP_017153787.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus bingmayongensis
ref|WP_026593769.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus
ref|WP_002173861.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus
ref|XP_005703014.1|  leucyl-tRNA synthetase                             173   5e-46   Galdieria sulphuraria
ref|WP_000009448.1|  MULTISPECIES: leucyl-tRNA synthetase               172   5e-46   Bacillus
ref|WP_000009450.1|  leucyl-tRNA synthetase                             172   5e-46   
ref|WP_000009451.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus
ref|WP_001991042.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus
ref|WP_000009455.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus
ref|WP_000009476.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus
ref|WP_000009452.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus
ref|WP_029440187.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus cereus group
ref|WP_000009454.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus cereus group
ref|WP_000009461.1|  MULTISPECIES: leucyl-tRNA synthetase               171   6e-46   Bacillus
ref|WP_000009459.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus cereus
ref|WP_000009460.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus
ref|WP_000009462.1|  MULTISPECIES: leucyl-tRNA synthetase               171   6e-46   Bacillus
ref|WP_044790847.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus thuringiensis
gb|KGZ89134.1|  leucyl-tRNA synthetase                                  171   6e-46   Bacillus anthracis [anthrax]
ref|WP_000009457.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus
ref|WP_000009465.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus sp. 7_6_55CFAA_CT2
ref|WP_000009449.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus cereus
ref|WP_000009466.1|  MULTISPECIES: leucyl-tRNA synthetase               171   6e-46   Bacillus
ref|WP_000009470.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus cereus group
ref|WP_000009469.1|  MULTISPECIES: leucyl-tRNA synthetase               171   6e-46   Bacillus
ref|WP_000009468.1|  leucyl-tRNA synthetase                             171   6e-46   Bacillus thuringiensis
ref|WP_042980446.1|  leucyl-tRNA synthetase                             171   7e-46   Bacillus
ref|WP_000009473.1|  leucyl-tRNA synthetase                             171   7e-46   Bacillus thuringiensis
ref|WP_000009471.1|  leucyl-tRNA synthetase                             171   7e-46   Bacillus cereus
ref|WP_002123189.1|  leucyl-tRNA synthetase                             171   7e-46   Bacillus cereus
ref|WP_000009472.1|  leucyl-tRNA synthetase                             171   7e-46   Bacillus cereus group
ref|WP_013061526.1|  leucyl-tRNA synthetase                             172   8e-46   Salinibacter ruber
gb|EMF80247.1|  putative leucine--tRNA ligase                           166   9e-46   Leptospira weilii serovar Topaz str. LT2116
ref|WP_016135497.1|  leucyl-tRNA synthetase                             171   9e-46   Bacillus
ref|WP_016085871.1|  leucyl-tRNA synthetase                             171   9e-46   Bacillus
ref|WP_041875508.1|  leucyl-tRNA synthetase                             171   1e-45   Verrucomicrobia bacterium SCGC AAA164-O14
gb|AIM14154.1|  leucyl-tRNA synthetase                                  168   1e-45   Bacillus anthracis [anthrax]
ref|WP_035436072.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus sp. UNC322MFChir4.1
ref|WP_000009439.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_001199936.1|  hypothetical protein                               164   1e-45   
ref|WP_029443454.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus group
ref|WP_016080001.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_020060261.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus sp. 123MFChir2
ref|WP_000009441.1|  MULTISPECIES: leucyl-tRNA synthetase               170   2e-45   Bacillus
ref|WP_038170035.1|  leucyl-tRNA synthetase                             164   2e-45   
ref|WP_016099046.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus cereus
ref|WP_000009442.1|  MULTISPECIES: leucyl-tRNA synthetase               170   2e-45   Bacillus
ref|WP_000009440.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus
ref|WP_041052219.1|  leucyl-tRNA synthetase                             170   2e-45   Paenibacillus sp. VKM B-2647
ref|WP_000009444.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus cereus group
ref|WP_043935252.1|  MULTISPECIES: leucyl-tRNA synthetase               170   2e-45   Bacillus
ref|WP_016116728.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus cereus group
ref|WP_018782090.1|  MULTISPECIES: leucyl-tRNA synthetase               170   2e-45   Bacillus
ref|WP_018764566.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus
ref|WP_006096266.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus pseudomycoides
ref|WP_000009481.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus wiedmannii
ref|WP_000009474.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus cereus
ref|WP_018970100.1|  leucyl-tRNA synthetase                             170   3e-45   Rubritalea marina
ref|WP_000009475.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus cereus
ref|WP_002145290.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus cereus
ref|WP_002067653.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus mycoides
gb|EJS78246.1|  leucyl-tRNA synthetase                                  170   3e-45   Bacillus cereus BAG2X1-3
ref|WP_031213207.1|  leucyl-tRNA synthetase                             167   3e-45   
ref|WP_016095957.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus
ref|WP_000009463.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus group
ref|WP_042875829.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus group
ref|WP_025148915.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus sp. H1a
ref|WP_001971230.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus group
ref|WP_000009453.1|  MULTISPECIES: leucyl-tRNA synthetase               169   3e-45   Bacillus cereus group
ref|WP_000009456.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus
ref|WP_000009467.1|  MULTISPECIES: leucyl-tRNA synthetase               169   3e-45   Bacillus
gb|ABO68087.1|  Leucyl-tRNA synthetase                                  169   3e-45   Geobacillus thermodenitrificans NG80-2
ref|WP_026690741.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus aurantiacus
ref|WP_000009458.1|  MULTISPECIES: leucyl-tRNA synthetase               169   3e-45   Bacillus cereus group
ref|WP_000009480.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus group
ref|WP_000009479.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus cereus group
ref|WP_000009464.1|  leucyl-tRNA synthetase                             169   3e-45   Bacillus
ref|WP_020401766.1|  leucyl-tRNA synthetase                             170   4e-45   Gracilimonas tropica
ref|WP_008880943.1|  MULTISPECIES: leucyl-tRNA synthetase               169   4e-45   Geobacillus
ref|WP_033844368.1|  leucyl-tRNA synthetase                             169   4e-45   Geobacillus
ref|WP_022488782.1|  leucyl-tRNA synthetase                             169   4e-45   
ref|WP_021996080.1|  leucyl-tRNA synthetase                             169   4e-45   
ref|WP_002087212.1|  tRNA ligases class I domain protein                165   4e-45   
ref|WP_022198807.1|  leucyl-tRNA synthetase                             169   4e-45   Akkermansia muciniphila
ref|WP_021278651.1|  leucyl-tRNA synthetase                             169   5e-45   Bacteriovorax sp. DB6_IX
ref|WP_012420688.1|  leucyl-tRNA synthetase                             169   5e-45   Akkermansia muciniphila
ref|WP_033020166.1|  leucyl-tRNA synthetase                             169   5e-45   Geobacillus icigianus
ref|WP_007129371.1|  MULTISPECIES: leucyl-tRNA synthetase               169   5e-45   Bacillales
ref|WP_042216922.1|  leucyl-tRNA synthetase                             169   5e-45   Paenibacillus borealis
ref|WP_022396714.1|  leucyl-tRNA synthetase                             169   5e-45   
ref|WP_000009477.1|  leucyl-tRNA synthetase                             169   5e-45   Bacillus cereus group
ref|WP_041901725.1|  leucyl-tRNA synthetase                             169   5e-45   
ref|WP_042139488.1|  leucyl-tRNA synthetase                             169   5e-45   Paenibacillus sp. FSL P4-0081
gb|EMO76983.1|  leucyl-tRNA synthetase, domain 2                        164   7e-45   Leptospira kirschneri str. 200801925
ref|WP_022840507.1|  MULTISPECIES: leucyl-tRNA synthetase               169   7e-45   
ref|WP_038595513.1|  leucyl-tRNA synthetase                             169   7e-45   Paenibacillus sp. FSL H7-0357
ref|WP_002770420.1|  leucyl-tRNA synthetase                             169   7e-45   Leptonema illini
ref|WP_000009443.1|  leucyl-tRNA synthetase                             168   8e-45   
ref|WP_044730524.1|  leucyl-tRNA synthetase                             168   9e-45   Geobacillus kaustophilus
ref|WP_034640994.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus manliponensis
ref|WP_044736817.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus kaustophilus
ref|WP_022476500.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_002153010.1|  putative leucine--tRNA ligase                      165   1e-44   
ref|WP_013144426.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus sp. C56-T3
ref|WP_012843181.1|  leucyl-tRNA synthetase                             169   1e-44   Rhodothermus marinus
ref|WP_033009813.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_013524386.1|  MULTISPECIES: leucyl-tRNA synthetase               168   1e-44   Geobacillus
ref|WP_000009478.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_002112382.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus group
ref|WP_022226580.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_031407586.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus vulcani
ref|WP_044744755.1|  leucyl-tRNA synthetase                             168   1e-44   Anoxybacillus geothermalis
ref|WP_033014546.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus stearothermophilus
ref|WP_033710716.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_000009438.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_000009446.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_044737514.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_002143462.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_021322703.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus
ref|WP_012261857.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus mycoides
ref|WP_002184798.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus mycoides
ref|WP_016130370.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus
ref|WP_000009447.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus
ref|WP_002015698.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus cereus group
ref|WP_002034430.1|  MULTISPECIES: leucyl-tRNA synthetase               168   1e-44   Bacillus cereus group
ref|WP_002167530.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus mycoides
ref|WP_002129511.1|  MULTISPECIES: leucyl-tRNA synthetase               168   1e-44   Bacillus
ref|WP_011232314.1|  leucyl-tRNA synthetase                             168   1e-44   Geobacillus thermoleovorans group
ref|WP_016102930.1|  MULTISPECIES: leucyl-tRNA synthetase               168   1e-44   Bacillus
gb|EJQ50297.1|  leucyl-tRNA synthetase                                  168   1e-44   Bacillus cereus BAG5X1-1
ref|WP_002190950.1|  leucyl-tRNA synthetase                             168   1e-44   Bacillus
ref|WP_022029418.1|  leucyl-tRNA synthetase                             167   1e-44   
ref|WP_002136312.1|  putative leucine--tRNA ligase                      165   1e-44   
ref|WP_002089088.1|  leucyl-tRNA synthetase                             167   1e-44   Bacillus cereus
ref|WP_027091186.1|  leucyl-tRNA synthetase                             168   2e-44   Cohnella thermotolerans
ref|WP_039300930.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus sp. IHB B 3415
ref|WP_039876233.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus sp. FSL R7-0273
ref|WP_033674310.1|  leucyl-tRNA synthetase                             167   2e-44   Bacillus gaemokensis
ref|WP_042267319.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus graminis
ref|WP_036732290.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus sp. FSL R7-277
ref|WP_003208770.1|  leucyl-tRNA synthetase                             167   2e-44   Bacillus pseudomycoides
ref|WP_003201345.1|  leucyl-tRNA synthetase                             167   2e-44   Bacillus pseudomycoides
ref|WP_014681197.1|  leucyl-tRNA synthetase                             169   2e-44   Solitalea canadensis
ref|WP_042201037.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus camerounensis
ref|WP_019909144.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus sp. HW567
ref|WP_025949565.1|  leucyl-tRNA synthetase                             167   2e-44   Geobacillus
ref|WP_037290055.1|  leucyl-tRNA synthetase                             167   2e-44   Saccharibacillus sacchari
gb|EZZ18391.1|  leucyl-tRNA synthetase                                  155   2e-44   Staphylococcus aureus Sau 74
gb|EQC75802.1|  Leucyl-tRNA synthetase                                  160   2e-44   Streptococcus sp. HSISS3
ref|WP_042238641.1|  leucyl-tRNA synthetase                             167   2e-44   Paenibacillus sp. FSL R5-0912
ref|WP_029671935.1|  leucyl-tRNA synthase                               159   2e-44   
ref|WP_003100327.1|  leucyl-tRNA synthetase                             167   2e-44   Streptococcus iniae
ref|WP_036597336.1|  leucyl-tRNA synthetase                             163   3e-44   
ref|WP_020960966.1|  leucyl-tRNA synthetase                             167   3e-44   Geobacillus genomosp. 3
gb|EOB29810.1|  leucyl-tRNA ligase                                      157   3e-44   Streptococcus pneumoniae 357
ref|WP_020428093.1|  leucyl-tRNA synthetase                             167   3e-44   Paenibacillus riograndensis
gb|EPR26369.1|  Leucyl-tRNA synthetase                                  167   4e-44   Geobacillus sp. WSUCF1
ref|WP_019536066.1|  leucyl-tRNA synthetase                             167   4e-44   Paenibacillus ginsengihumi
ref|WP_039832771.1|  leucyl-tRNA synthetase                             167   4e-44   Paenibacillus sonchi
ref|WP_018126787.1|  leucyl-tRNA synthetase                             167   4e-44   Balneola vulgaris
ref|WP_042183121.1|  leucyl-tRNA synthetase                             167   4e-44   Paenibacillus sp. FSL R7-0331
gb|KHF29266.1|  Leucine--tRNA ligase                                    159   4e-44   Anoxybacillus sp. BCO1
gb|EQC70103.1|  Leucyl-tRNA synthetase                                  161   4e-44   Streptococcus sp. HSISS1
ref|WP_014801419.1|  leucyl-tRNA synthetase                             167   4e-44   Turneriella parva
gb|EHD52646.1|  leucyl-tRNA synthetase domain protein                   155   4e-44   Streptococcus pneumoniae GA16531
gb|EQA61511.1|  putative leucine--tRNA ligase                           165   5e-44   Leptospira alexanderi serovar Manhao 3 str. L 60
ref|WP_022838854.1|  leucyl-tRNA synthetase                             166   5e-44   
ref|WP_017285139.1|  hypothetical protein                               153   5e-44   
ref|WP_026671701.1|  leucyl-tRNA synthetase                             166   5e-44   Bacillus bogoriensis
ref|WP_031868226.1|  leucyl-tRNA synthetase                             155   5e-44   
ref|WP_016106405.1|  leucyl-tRNA synthetase                             166   5e-44   Bacillus cereus group
ref|WP_022835958.1|  leucyl-tRNA synthetase                             167   5e-44   Salisaeta longa
ref|WP_028544889.1|  leucyl-tRNA synthetase                             166   6e-44   Paenibacillus taiwanensis
ref|WP_036690493.1|  leucyl-tRNA synthetase                             166   6e-44   Paenibacillus sp. FSL R7-269
ref|WP_008408180.1|  MULTISPECIES: leucyl-tRNA synthetase               166   6e-44   Solibacillus
gb|EZW52098.1|  leucyl-tRNA synthetase                                  155   6e-44   Staphylococcus aureus 56824-2
ref|WP_028399751.1|  leucyl-tRNA synthetase                             166   6e-44   Bacillus panaciterrae
ref|WP_018975751.1|  leucyl-tRNA synthetase                             166   7e-44   Saccharibacillus kuerlensis
gb|ERE61641.1|  hypothetical protein N036_46685                         158   7e-44   
gb|EHZ47588.1|  tRNA synthetases class I family protein                 161   7e-44   
ref|WP_031867633.1|  leucyl-tRNA synthetase                             155   7e-44   
gb|EZW49633.1|  leucyl-tRNA synthetase                                  155   7e-44   
ref|WP_022775395.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_028987158.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_008300157.1|  leucyl-tRNA synthetase                             166   8e-44   
gb|EQC45487.1|  leucine--tRNA ligase                                    166   9e-44   
ref|WP_034732278.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_017645788.1|  hypothetical protein                               157   1e-43   
ref|WP_014196589.1|  MULTISPECIES: leucyl-tRNA synthetase               165   1e-43   
ref|WP_014545885.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_006146914.1|  leucyl-tRNA synthetase                             161   1e-43   
ref|WP_015375656.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_033006846.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_020156908.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_022090460.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_025197809.1|  hypothetical protein                               158   1e-43   
gb|EQC76806.1|  Leucyl-tRNA synthetase                                  162   1e-43   
ref|WP_010572741.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_023353925.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_020781670.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_042102996.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_023860252.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_017648229.1|  hypothetical protein                               157   2e-43   
ref|WP_009962914.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_029748725.1|  hypothetical protein                               157   2e-43   
ref|WP_022764265.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004502651.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002722366.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_016758500.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004500935.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002623145.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004496491.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_037594298.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002756838.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002748599.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_034490052.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002758452.1|  MULTISPECIES: leucyl-tRNA synthetase               165   2e-43   
ref|WP_035662994.1|  leucyl-tRNA synthetase                             165   2e-43   
gb|KIC75996.1|  Leucine--tRNA ligase                                    165   2e-43   
ref|WP_009589237.1|  leucyl-tRNA synthetase                             163   2e-43   
ref|WP_025196425.1|  hypothetical protein                               159   2e-43   
ref|WP_022423485.1|  leucyl-tRNA synthetase                             164   2e-43   
gb|EJG57705.1|  leucyl-tRNA synthetase domain protein                   154   2e-43   
ref|WP_010571179.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_010415619.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_011669510.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_035346667.1|  leucyl-tRNA synthetase                             164   2e-43   
ref|WP_022509581.1|  leucyl-tRNA synthetase                             164   2e-43   
ref|WP_028260588.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_012462742.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_016762411.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_002995549.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_016549702.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_019006982.1|  leucyl-tRNA synthetase                             164   2e-43   
gb|ELU55040.1|  putative leucine--tRNA ligase                           158   2e-43   
ref|WP_016754086.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004480091.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_015246480.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004469101.1|  leucyl-tRNA synthetase                             165   2e-43   
ref|WP_004457605.1|  MULTISPECIES: leucyl-tRNA synthetase               165   2e-43   
ref|WP_004465796.1|  leucyl-tRNA synthetase                             165   2e-43   
gb|KIC74007.1|  Leucine--tRNA ligase                                    165   3e-43   
ref|WP_020774950.1|  leucyl-tRNA synthetase                             165   3e-43   
ref|WP_034484721.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_022753316.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004478162.1|  leucyl-tRNA synthetase                             165   3e-43   
ref|WP_015864859.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_002178120.1|  leucyl-tRNA synthetase                             165   3e-43   
ref|WP_017434903.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_022756928.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_000011736.1|  hypothetical protein                               158   3e-43   
gb|EGJ17488.1|  tRNA synthetases class I family protein                 159   3e-43   
ref|WP_028668876.1|  leucyl-tRNA synthetase                             165   3e-43   
ref|WP_031797928.1|  leucyl-tRNA synthetase                             154   3e-43   
gb|EZV38010.1|  leucyl-tRNA synthetase                                  154   3e-43   
ref|WP_017215345.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004451824.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_007893756.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_016559356.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_006146209.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_031863481.1|  leucyl-tRNA synthetase                             154   3e-43   
ref|WP_016560597.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004448798.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_024808714.1|  leucyl-tRNA synthetase                             164   3e-43   
gb|EHD83019.1|  tRNA synthetases class I family protein                 159   3e-43   
gb|EZW77704.1|  leucyl-tRNA synthetase                                  154   3e-43   
ref|WP_020779317.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004782459.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004765275.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_003248538.1|  MULTISPECIES: leucyl-tRNA synthetase               164   3e-43   
ref|WP_025691777.1|  leucyl-tRNA synthetase                             160   3e-43   
ref|WP_017852595.1|  leucyl-tRNA synthetase                             164   3e-43   
ref|WP_004446815.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002886476.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004768294.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004440485.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004433550.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_020763829.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_029509173.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_010001897.1|  leucyl-tRNA synthetase                             164   4e-43   
gb|KFE64538.1|  Leucyl-tRNA synthetase                                  164   4e-43   
ref|WP_012198967.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_029097348.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004754786.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199942.1|  leucyl-tRNA synthetase                             164   4e-43   
gb|EHE05941.1|  tRNA synthetases class I family protein                 159   4e-43   
ref|WP_000011799.1|  hypothetical protein                               155   4e-43   
ref|WP_004763529.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_020767452.1|  leucyl-tRNA synthetase                             164   4e-43   
dbj|GAJ39071.1|  leucyl-tRNA synthetase                                 164   4e-43   
ref|WP_016751470.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004770094.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199943.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_042407714.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199937.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_013102550.1|  MULTISPECIES: leucyl-tRNA synthetase               164   4e-43   
ref|WP_044773647.1|  leucyl-tRNA synthetase                             154   4e-43   
dbj|GAE04151.1|  leucyl-tRNA synthetase                                 159   4e-43   
ref|WP_006154965.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_044645124.1|  leucyl-tRNA synthetase                             164   4e-43   
gb|EGI88017.1|  tRNA synthetases class I family protein                 159   4e-43   
ref|WP_017858440.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_017854639.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199949.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199940.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002128538.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002106551.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199948.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199946.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199945.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004419464.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199944.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199939.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_004455150.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002102197.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199947.1|  leucyl-tRNA synthetase                             164   4e-43   
gb|KEQ42200.1|  leucyl-tRNA synthetase                                  159   4e-43   
gb|ESP69465.1|  leucyl-tRNA ligase                                      159   4e-43   
gb|EHE32505.1|  tRNA synthetases class I family protein                 159   4e-43   
ref|WP_025675594.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_001199941.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002104138.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_003390741.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_022781940.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_002118761.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_043905827.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_039272311.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_013311190.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_029515372.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_035202000.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_007431297.1|  leucyl-tRNA synthetase                             164   4e-43   
ref|WP_013372195.1|  leucyl-tRNA synthetase                             164   4e-43   
gb|EHZ25107.1|  tRNA synthetases class I family protein                 159   5e-43   
ref|WP_011247713.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_025723410.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_025718841.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_023989526.1|  MULTISPECIES: leucyl-tRNA synthetase               164   5e-43   
ref|WP_019688080.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_004183766.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_013990004.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_016821632.1|  MULTISPECIES: leucyl-tRNA synthetase               164   5e-43   
ref|WP_000011798.1|  hypothetical protein                               154   5e-43   
ref|WP_024984589.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_025682013.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_022474865.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_035622459.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_007360290.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_010345310.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_014282541.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_014946079.1|  leucyl-tRNA synthetase                             151   5e-43   
ref|WP_018166419.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_000011804.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_008535773.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_006982645.1|  leucyl-tRNA synthetase                             164   5e-43   
gb|EJG64505.1|  leucyl-tRNA synthetase domain protein                   158   5e-43   
ref|WP_024056244.1|  leucyl-tRNA synthetase                             160   5e-43   
ref|WP_044675805.1|  leucyl-tRNA synthetase                             154   5e-43   
ref|WP_002883627.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_044752085.1|  leucyl-tRNA synthetase                             154   5e-43   
ref|WP_037598938.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_021154341.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_014633638.1|  leucyl-tRNA synthetase                             164   5e-43   
ref|WP_003004499.1|  leucyl-tRNA synthetase                             164   6e-43   
ref|WP_036646564.1|  leucyl-tRNA synthetase                             163   6e-43   
ref|WP_009512047.1|  leucyl-tRNA synthetase                             164   6e-43   
ref|WP_027322101.1|  leucyl-tRNA synthetase                             163   6e-43   
ref|WP_015255273.1|  leucyl-tRNA synthetase                             163   6e-43   
gb|ETE42752.1|  leucyl-tRNA synthase                                    164   6e-43   
ref|WP_019978940.1|  leucyl-tRNA synthetase                             164   6e-43   
ref|WP_002889825.1|  leucyl-tRNA synthetase                             164   6e-43   
gb|ETJ00672.1|  Leucine-tRNA ligase                                     152   6e-43   
ref|WP_031941848.1|  leucyl-tRNA synthetase                             155   6e-43   
ref|WP_025196905.1|  leucyl-tRNA synthetase                             159   6e-43   
gb|EWM58010.1|  leucyl-tRNA synthase                                    164   6e-43   
ref|WP_020152944.1|  leucyl-tRNA synthetase                             164   6e-43   
gb|EZZ18384.1|  leucyl-tRNA synthetase                                  155   6e-43   
ref|WP_000145179.1|  leucyl-tRNA synthetase                             159   6e-43   
ref|WP_000011793.1|  leucyl-tRNA synthetase                             163   6e-43   
ref|WP_044667389.1|  leucyl-tRNA synthetase                             154   6e-43   
gb|EWM61031.1|  leucyl-tRNA synthase                                    163   6e-43   
ref|WP_002947934.1|  MULTISPECIES: leucyl-tRNA synthetase               163   6e-43   
gb|ETW91592.1|  leucyl-tRNA synthase                                    163   6e-43   
ref|WP_014621119.1|  leucyl-tRNA synthetase                             163   6e-43   
ref|WP_044758202.1|  leucyl-tRNA synthetase                             154   6e-43   
ref|WP_037610688.1|  leucyl-tRNA synthetase                             163   6e-43   
ref|WP_023919571.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_009732128.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_004250622.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_006151373.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_022051862.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_018164645.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_022115282.1|  leucyl-tRNA synthetase                             164   7e-43   
ref|WP_044765136.1|  leucyl-tRNA synthetase                             154   7e-43   
ref|WP_031574923.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_016466305.1|  leucyl-tRNA synthetase                             163   7e-43   
gb|EZV37943.1|  leucyl-tRNA synthetase                                  157   7e-43   
ref|WP_039384846.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_031863483.1|  leucyl-tRNA synthetase                             156   7e-43   
ref|WP_036644499.1|  leucyl-tRNA synthetase                             163   7e-43   
ref|WP_042240833.1|  leucyl-tRNA synthetase                             163   7e-43   



>ref|XP_009614453.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=972

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 5/170 (3%)
 Frame = +2

Query  104  CRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTNGISCVKVEDEQKENEEQ--QVR  268
            C R L++S H RPLLR +S + +RLR+S+C    SK      VK  D QK NE+Q  QV+
Sbjct  21   CSRTLMLSAHRRPLLRHQSCTHVRLRVSSCTKSSSKNTVTELVKEVDGQKANEQQKQQVK  80

Query  269  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  448
            R+YPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLDMFPYPSGAGLHVGHPLGYTAT
Sbjct  81   RSYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLDMFPYPSGAGLHVGHPLGYTAT  140

Query  449  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            DILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI+RFR
Sbjct  141  DILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNISRFR  190



>ref|XP_004232688.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Solanum lycopersicum]
Length=975

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 147/191 (77%), Gaps = 7/191 (4%)
 Frame = +2

Query  47   FEIHSRLRLLQQP---FSQPPFCRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTN  208
             ++H+  RL   P     +PP  R  LL+    RPLLRR   +  R  +SNC    SK  
Sbjct  3    IQLHTSTRLHHLPSHLLPRPPLLRSALLLPACRRPLLRREFCNHERFGVSNCTKSSSKNT  62

Query  209  GISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLD  385
                V   D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLD
Sbjct  63   VTVLVNAIDGQKINEKHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLD  122

Query  386  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPr  565
            MFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+
Sbjct  123  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPK  182

Query  566  ittirninrFR  598
            ITT+RNI+RFR
Sbjct  183  ITTLRNISRFR  193



>ref|XP_010316571.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Solanum lycopersicum]
Length=994

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 147/191 (77%), Gaps = 7/191 (4%)
 Frame = +2

Query  47   FEIHSRLRLLQQP---FSQPPFCRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTN  208
             ++H+  RL   P     +PP  R  LL+    RPLLRR   +  R  +SNC    SK  
Sbjct  3    IQLHTSTRLHHLPSHLLPRPPLLRSALLLPACRRPLLRREFCNHERFGVSNCTKSSSKNT  62

Query  209  GISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLD  385
                V   D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLD
Sbjct  63   VTVLVNAIDGQKINEKHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLD  122

Query  386  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPr  565
            MFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+
Sbjct  123  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPK  182

Query  566  ittirninrFR  598
            ITT+RNI+RFR
Sbjct  183  ITTLRNISRFR  193



>gb|KDO78326.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=577

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  155  TGTHPKITTLRNINRFR  171



>ref|XP_006348152.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=975

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 4/141 (3%)
 Frame = +2

Query  188  NCV---SKTNGISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEID  355
            NC    SK      VK  D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEID
Sbjct  53   NCTKSSSKNTVTLLVKAIDAQKTNEQHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEID  112

Query  356  TSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  535
            TSKPK+YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQ
Sbjct  113  TSKPKFYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQ  172

Query  536  YAIETGTHPrittirninrFR  598
            YAI+TGTHP+ITT+RNI+RFR
Sbjct  173  YAIDTGTHPKITTLRNISRFR  193



>ref|XP_010686792.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=989

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = +2

Query  194  VSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKY  373
             S+ NG    KVED ++E   QQV+RAYP+HEIEPKWQK+W++ KTFRTPD++DTSKPK+
Sbjct  75   ASEING-ELGKVEDIEEEKNVQQVKRAYPYHEIEPKWQKYWDDNKTFRTPDDVDTSKPKF  133

Query  374  YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETG  553
            YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TG
Sbjct  134  YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTG  193

Query  554  THPrittirninrFR  598
            THP++TT+RNI RFR
Sbjct  194  THPKVTTMRNIGRFR  208



>ref|XP_009800377.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=972

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 146/173 (84%), Gaps = 6/173 (3%)
 Frame = +2

Query  98   PFCRR-ELLISTHfrpllrrrsfsflrlrlsNCV---SKTNGISCVKVEDEQKENEEQQ-  262
            P C R  L+IS H RPLLR +S++ +RLR+S+C    SK      VK  D QK N++QQ 
Sbjct  19   PLCLRISLIISAHRRPLLRHQSYTHIRLRVSSCTKSSSKNTVTELVKAVDGQKANDQQQQ  78

Query  263  -VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
             V+R YPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  79   QVKRPYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  138

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI+RFR
Sbjct  139  TATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNISRFR  191



>gb|KDO78323.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=926

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  155  TGTHPKITTLRNINRFR  171



>ref|XP_006449782.1| hypothetical protein CICLE_v10014171mg [Citrus clementina]
 gb|ESR63022.1| hypothetical protein CICLE_v10014171mg [Citrus clementina]
Length=951

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C S    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +W+  +TFRTPDEIDTSKP
Sbjct  34   SCSSSGGIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWQNNRTFRTPDEIDTSKP  93

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  94   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  153

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  154  TGTHPKITTLRNINRFR  170



>ref|XP_006467397.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=926

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  155  TGTHPKITTLRNINRFR  171



>gb|KDO78324.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=952

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  155  TGTHPKITTLRNINRFR  171



>ref|XP_006467396.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=952

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT+RNINRFR
Sbjct  155  TGTHPKITTLRNINRFR  171



>ref|XP_011002586.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Populus 
euphratica]
 ref|XP_011002587.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Populus 
euphratica]
Length=1006

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = +2

Query  212  ISCVKVE-DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDM  388
            I C   E +EQKE ++Q V+RAYPFHEIEPKWQ +WE+ +TFRTPDE+DTSKPK+YVLDM
Sbjct  96   IRCSNSEVEEQKEKQQQVVKRAYPFHEIEPKWQSYWEKNQTFRTPDEVDTSKPKFYVLDM  155

Query  389  FPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPri  568
            FPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+I
Sbjct  156  FPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKI  215

Query  569  ttirninrFR  598
            TT+RNINRFR
Sbjct  216  TTLRNINRFR  225



>gb|EPS64803.1| hypothetical protein M569_09978, partial [Genlisea aurea]
Length=192

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  254  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            E+QVRRAYPF+EIE KWQ++WE+ KTFRTPDEID SKPK+YVLDMFPYPSGAGLHVGHPL
Sbjct  1    EEQVRRAYPFNEIEAKWQRYWEDDKTFRTPDEIDISKPKFYVLDMFPYPSGAGLHVGHPL  60

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDILAR KRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHPRITT +NI+RFR
Sbjct  61   GYTATDILARLKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPRITTRKNIDRFR  115



>ref|XP_004134980.1| PREDICTED: leucine--tRNA ligase-like [Cucumis sativus]
Length=978

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  236  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  415
            + +E +EQ+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYPSG+GL
Sbjct  78   DVEEQKEQEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYPSGSGL  137

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYT+TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINRF
Sbjct  138  HVGHPLGYTSTDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINRF  197

Query  596  R  598
            R
Sbjct  198  R  198



>ref|XP_004155678.1| PREDICTED: leucine--tRNA ligase-like [Cucumis sativus]
 gb|KGN49082.1| hypothetical protein Csa_6G513460 [Cucumis sativus]
Length=1059

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 3/126 (2%)
 Frame = +2

Query  221  VKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP  400
            VK  +EQKE   Q+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYP
Sbjct  157  VKDVEEQKE---QEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYP  213

Query  401  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  580
            SG+GLHVGHPLGYT+TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+R
Sbjct  214  SGSGLHVGHPLGYTSTDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLR  273

Query  581  ninrFR  598
            NINRFR
Sbjct  274  NINRFR  279



>ref|XP_008440038.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial [Cucumis melo]
Length=978

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  236  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  415
            + +E +EQ+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYPSG+GL
Sbjct  78   DVEEQKEQEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYPSGSGL  137

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINRF
Sbjct  138  HVGHPLGYTATDILARFKRMQGHNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINRF  197

Query  596  R  598
            R
Sbjct  198  R  198



>ref|XP_002264138.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Vitis 
vinifera]
 emb|CBI23202.3| unnamed protein product [Vitis vinifera]
Length=971

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +2

Query  188  NCVSKTNGISCVK-VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSK  364
            N VS++   S  K + + + ++ ++ +RRAYPFHEIEP+WQ+FWEE +TFRTPD++DTSK
Sbjct  53   NGVSRSIRNSATKELSEVEGQDRKEPIRRAYPFHEIEPRWQRFWEENRTFRTPDDVDTSK  112

Query  365  PKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI  544
            PK+YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI
Sbjct  113  PKFYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI  172

Query  545  ETGTHPrittirninrFR  598
            ETGTHP+ITT RNI RFR
Sbjct  173  ETGTHPKITTTRNIARFR  190



>ref|XP_007026156.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28778.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
2 [Theobroma cacao]
Length=687

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = +2

Query  224  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  403
            +VE+EQK+ +   V+RAYPF+EIEPKWQ++WEE +TFRTPD++DTSKPKYYVLDMFPYPS
Sbjct  76   EVEEEQKQ-KSVVVKRAYPFNEIEPKWQRYWEENRTFRTPDDVDTSKPKYYVLDMFPYPS  134

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  135  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  194

Query  584  inrFR  598
            INRFR
Sbjct  195  INRFR  199



>ref|XP_011095981.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Sesamum indicum]
 ref|XP_011095982.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Sesamum indicum]
Length=967

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKE---NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDT  358
            NC++ T         +E +E   + E++VRRAYPFHEIEPKWQ++WE+ KTFRTPDE+DT
Sbjct  47   NCLNATAYDKNTNPSEESEEFTGSLEEEVRRAYPFHEIEPKWQRYWEDNKTFRTPDELDT  106

Query  359  SKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQY  538
            SKPK+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQG+NVLHPMGWDAFGLPAEQY
Sbjct  107  SKPKFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGFNVLHPMGWDAFGLPAEQY  166

Query  539  AIETGTHPrittirninrFR  598
            AIETGTHP+ITT++NI+RFR
Sbjct  167  AIETGTHPKITTMKNIDRFR  186



>ref|XP_002317141.1| hypothetical protein POPTR_0011s01420g [Populus trichocarpa]
 gb|EEE97753.1| hypothetical protein POPTR_0011s01420g [Populus trichocarpa]
Length=974

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  ISCVKVE-DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDM  388
            I C   E +EQKE + Q V+RAYPFHEIEPKWQ +WE+ +TFRTPDE+DTSKPK+YVLDM
Sbjct  63   IRCSVSEVEEQKEKQLQVVKRAYPFHEIEPKWQSYWEKNQTFRTPDEVDTSKPKFYVLDM  122

Query  389  FPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            FPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  123  FPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  180



>ref|XP_007026155.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28777.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
1 [Theobroma cacao]
Length=980

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = +2

Query  224  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  403
            +VE+EQK+ +   V+RAYPF+EIEPKWQ++WEE +TFRTPD++DTSKPKYYVLDMFPYPS
Sbjct  76   EVEEEQKQ-KSVVVKRAYPFNEIEPKWQRYWEENRTFRTPDDVDTSKPKYYVLDMFPYPS  134

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  135  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  194

Query  584  inrFR  598
            INRFR
Sbjct  195  INRFR  199



>ref|XP_010057899.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW75246.1| hypothetical protein EUGRSUZ_E03997 [Eucalyptus grandis]
Length=982

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  239  QKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLH  418
            Q++ +E  V+RAYPFHEIEPKWQ++WE+ KTFRTPDEIDTS+PK+YVLDMFPYPSGAGLH
Sbjct  82   QEQKQEPLVKRAYPFHEIEPKWQEYWEKNKTFRTPDEIDTSRPKFYVLDMFPYPSGAGLH  141

Query  419  VGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            VGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINRFR
Sbjct  142  VGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINRFR  201



>ref|XP_008384092.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=978

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  236  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  415
            EQK  ++  V+R YPFHEIE KWQ +WEE +TFRTPDEIDTSKPKYYVLDMFPYPSGAGL
Sbjct  78   EQKPKQQAVVKRPYPFHEIELKWQCYWEENRTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  137

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT++NI+RF
Sbjct  138  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLKNIDRF  197

Query  596  R  598
            R
Sbjct  198  R  198



>ref|XP_002518434.1| leucyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF43821.1| leucyl-tRNA synthetase, putative [Ricinus communis]
Length=960

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  233  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  412
            +E++E ++  V++AYPFHEIEPKWQ++WE+  TFRTPDEIDTSKPK+YVLDMFPYPSG+G
Sbjct  58   NEEQEQKQPMVKKAYPFHEIEPKWQRYWEDNHTFRTPDEIDTSKPKFYVLDMFPYPSGSG  117

Query  413  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  592
            LHVGHPLGYTATDILARF+RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINR
Sbjct  118  LHVGHPLGYTATDILARFRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINR  177

Query  593  FR  598
            FR
Sbjct  178  FR  179



>emb|CAN74190.1| hypothetical protein VITISV_036142 [Vitis vinifera]
Length=893

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +2

Query  269  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  448
            RAYPFHEIEP+WQ+FWEE +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGYTAT
Sbjct  3    RAYPFHEIEPRWQRFWEENRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGYTAT  62

Query  449  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR
Sbjct  63   DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTTRNIARFR  112



>ref|XP_008224706.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=975

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 138/192 (72%), Gaps = 11/192 (6%)
 Frame = +2

Query  56   HSRLRLLQQPFSQPPFCRRELLISTHfrpllrrrsfsflrlrlsN----CV-SKTNGISC  220
            H++L L  Q    PP     +L  +H     R R+ SF      N    CV  + +G+  
Sbjct  5    HAQLHLQLQALPPPPLRFGSVLFPSHPIQSKRIRNSSFSLRLYHNGSKSCVFGRKSGVIR  64

Query  221  VKVEDEQ------KENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVL  382
              V +E       K  ++  V+R YPFHEIE KWQ++WEE +TFRTPDEIDTSKPKYYVL
Sbjct  65   SSVAEEANGAAEPKPKQQVTVKRPYPFHEIELKWQRYWEENQTFRTPDEIDTSKPKYYVL  124

Query  383  DMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            DMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  125  DMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  184

Query  563  rittirninrFR  598
            +ITT++NI+RFR
Sbjct  185  KITTLKNIDRFR  196



>ref|XP_007153983.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25977.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
Length=824

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPS  403
            V +   E+++Q V RAYPFHEIEPKWQ+FWE  +TFRTPD+ IDT+KPKYYVLDMFPYPS
Sbjct  63   VANGGTEHQKQPVNRAYPFHEIEPKWQRFWEHNRTFRTPDDDIDTTKPKYYVLDMFPYPS  122

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  123  GAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTVRN  182

Query  584  inrFR  598
            INRFR
Sbjct  183  INRFR  187



>ref|XP_007153984.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 ref|XP_007153985.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25978.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25979.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
Length=967

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +2

Query  227  VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPS  403
            V +   E+++Q V RAYPFHEIEPKWQ+FWE  +TFRTPD+ IDT+KPKYYVLDMFPYPS
Sbjct  63   VANGGTEHQKQPVNRAYPFHEIEPKWQRFWEHNRTFRTPDDDIDTTKPKYYVLDMFPYPS  122

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  123  GAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTVRN  182

Query  584  inrFR  598
            INRFR
Sbjct  183  INRFR  187



>ref|XP_009357478.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Pyrus 
x bretschneideri]
Length=978

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  415
            EQK  ++  V+R YPFHEIE KWQ +WEE +TFRTPDEIDTSKPKYYVLDMFPYPSGAGL
Sbjct  78   EQKPKQQAVVKRPYPFHEIELKWQCYWEENRTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  137

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            HVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  138  HVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  186



>ref|XP_007213686.1| hypothetical protein PRUPE_ppa000869mg [Prunus persica]
 gb|EMJ14885.1| hypothetical protein PRUPE_ppa000869mg [Prunus persica]
Length=976

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 6/137 (4%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            +   K+NG +      E K  ++  V+R YPFHEIE KWQ++WE+ +TFRTPDEIDTSKP
Sbjct  66   SVAEKSNGAA------EPKPKQQVTVKRPYPFHEIELKWQRYWEDNQTFRTPDEIDTSKP  119

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            KYYVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  120  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  179

Query  548  TGTHPrittirninrFR  598
            TGTHP+ITT++NI+RFR
Sbjct  180  TGTHPKITTLKNIDRFR  196



>ref|XP_004295290.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  191  CVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPK  370
            CVS T   S     ++  E++ +Q +RAYPFHEIEPKWQ++WE+ KTFRTPDE+D SKPK
Sbjct  43   CVSIT--ASSANEPNDVVEHKPKQ-KRAYPFHEIEPKWQRYWEKDKTFRTPDEVDMSKPK  99

Query  371  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  550
            +YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIET
Sbjct  100  FYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIET  159

Query  551  GTHPrittirninrFR  598
            GTHP+ITT++NI+RFR
Sbjct  160  GTHPKITTLKNIDRFR  175



>gb|KFK30967.1| hypothetical protein AALP_AA6G050800 [Arabis alpina]
Length=968

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 4/128 (3%)
 Frame = +2

Query  227  VEDEQKENEEQQV----RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFP  394
            V +EQ   +E+ +    +R YPFHEIEPKWQ++WEE +TFRTPD++DTSKPK+YVLDMFP
Sbjct  60   VTEEQSNRKEEALAIESKRVYPFHEIEPKWQRYWEENRTFRTPDDVDTSKPKFYVLDMFP  119

Query  395  YPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPritt  574
            YPSGAGLHVGHPLGYTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT
Sbjct  120  YPSGAGLHVGHPLGYTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTT  179

Query  575  irninrFR  598
            ++NI+RFR
Sbjct  180  LKNIDRFR  187



>gb|KDP20709.1| hypothetical protein JCGZ_21180 [Jatropha curcas]
Length=984

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 1/124 (1%)
 Frame = +2

Query  230  EDEQKENEEQ-QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSG  406
            E E K+ ++Q  V+RAYPFHEIEPKWQ++W++  TFRTPDEIDTSKPK+YVLDMFPYPSG
Sbjct  80   EPELKQTQKQPVVKRAYPFHEIEPKWQRYWDDNYTFRTPDEIDTSKPKFYVLDMFPYPSG  139

Query  407  AGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirni  586
            +GLHVGHPLGYTATDILARF+RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI
Sbjct  140  SGLHVGHPLGYTATDILARFRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNI  199

Query  587  nrFR  598
            NRFR
Sbjct  200  NRFR  203



>gb|KJB67266.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
 gb|KJB67267.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
 gb|KJB67268.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
Length=976

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  224  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  403
            +VE+EQK+ +   V+RAYPF EIEPKWQ++WE+ +TFRTP+++DTSKPK+YVLDMFPYPS
Sbjct  71   EVEEEQKQ-KPVLVKRAYPFDEIEPKWQRYWEQNRTFRTPNDVDTSKPKFYVLDMFPYPS  129

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  130  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  189

Query  584  inrFR  598
            INRFR
Sbjct  190  INRFR  194



>gb|KHG27983.1| Leucine--tRNA ligase [Gossypium arboreum]
Length=976

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  224  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  403
            +VE EQK+ +   V+RAYPF EIEPKWQ++WE+ +TFRTP+++DTSKPK+YVLDMFPYPS
Sbjct  71   EVEAEQKQ-KPLLVKRAYPFDEIEPKWQRYWEQNRTFRTPNDVDTSKPKFYVLDMFPYPS  129

Query  404  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  583
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  130  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  189

Query  584  inrFR  598
            INRFR
Sbjct  190  INRFR  194



>emb|CDP04435.1| unnamed protein product [Coffea canephora]
Length=972

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 7/193 (4%)
 Frame = +2

Query  35   MNTQFEIHSRLRLLQQPFS-QPPFCRRELLISTHfr--pllrrrsfsflrlrlsNCVSKT  205
            M TQF  H+   L   P +  PP  RR +L+ +H       RR +     LR+S+C++ T
Sbjct  1    MYTQF--HTSTLLPTLPLTHSPPLSRRTILLYSHRLPPLHRRRPTSLRFPLRISSCINST  58

Query  206  NGI-SCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTP-DEIDTSKPKYYV  379
              I S +  E+E++     +  +AYPFHEIEPKWQ++WEE KTFRTP D++DT+KPKYYV
Sbjct  59   GTICSSLSTEEEEERPSNNKRVKAYPFHEIEPKWQRYWEEHKTFRTPHDDLDTTKPKYYV  118

Query  380  LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTH  559
            LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTH
Sbjct  119  LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIQTGTH  178

Query  560  PrittirninrFR  598
            P+ITT+RNI RFR
Sbjct  179  PKITTLRNIERFR  191



>ref|XP_010099169.1| Leucine--tRNA ligase [Morus notabilis]
 gb|EXB77041.1| Leucine--tRNA ligase [Morus notabilis]
Length=980

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +2

Query  263  VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYT  442
            VRRAYPFHEIEPKWQ+FW++  TFRTP ++DTSKPK+YVLDMFPYPSGAGLHVGHPLGYT
Sbjct  87   VRRAYPFHEIEPKWQRFWDDNFTFRTPGDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGYT  146

Query  443  ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNINRFR
Sbjct  147  ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNINRFR  198



>ref|XP_010272272.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=968

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 4/141 (3%)
 Frame = +2

Query  188  NCVSKTNGISCVKVEDEQKENEEQQVR----RAYPFHEIEPKWQKFWEEKKTFRTPDEID  355
            N VS ++  S   +++E  + E+Q+++    RAYPFHEIEP+WQ++WEE +TFRTPDE+D
Sbjct  47   NGVSNSSISSQSTLKEEYNKEEQQKLQQPRTRAYPFHEIEPRWQRYWEENRTFRTPDEVD  106

Query  356  TSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  535
            TSKPK+Y+LDMFPYPSGAGLHVGHPLGYTATDILAR+KRM+G+NVLHPMGWDAFGLPAEQ
Sbjct  107  TSKPKFYILDMFPYPSGAGLHVGHPLGYTATDILARYKRMKGFNVLHPMGWDAFGLPAEQ  166

Query  536  YAIETGTHPrittirninrFR  598
            YAIETGTHP+ITT RNI RFR
Sbjct  167  YAIETGTHPKITTARNIERFR  187



>ref|XP_010422266.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=857

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  192



>ref|XP_010432889.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=973

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  192



>ref|XP_002872690.1| EMB2369 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48949.1| EMB2369 [Arabidopsis lyrata subsp. lyrata]
Length=972

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  79   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  138

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  139  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  191



>ref|XP_010422265.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=973

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  192



>ref|XP_006396696.1| hypothetical protein EUTSA_v10028396mg [Eutrema salsugineum]
 gb|ESQ38149.1| hypothetical protein EUTSA_v10028396mg [Eutrema salsugineum]
Length=973

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  191  CVSKTNGISCVKVEDEQKENEEQ-QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
            C +     S V +E +   +E   + +R YPFHEIEPKWQ++WEE +TFRTPD++DTSKP
Sbjct  56   CSATEAPSSNVNLEKKSPVSETAIESKRVYPFHEIEPKWQRYWEENRTFRTPDDVDTSKP  115

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  116  KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIE  175

Query  548  TGTHPrittirninrFR  598
            TGTHP+ TT++NI+RFR
Sbjct  176  TGTHPKTTTLKNIDRFR  192



>ref|XP_006287002.1| hypothetical protein CARUB_v10000148mg [Capsella rubella]
 gb|EOA19900.1| hypothetical protein CARUB_v10000148mg [Capsella rubella]
Length=976

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+  TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  83   ELKRVYPFHEIEPKWQRYWEDNSTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  142

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  143  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKATTLKNIDRFR  195



>ref|XP_009134299.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=956

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  65   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  124

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  125  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  178



>emb|CDX90858.1| BnaA03g25380D [Brassica napus]
Length=956

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  65   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  124

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  125  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  178



>emb|CDY21299.1| BnaC03g29830D [Brassica napus]
Length=957

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  66   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  125

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  126  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  179



>ref|NP_192344.1| tRNA synthetase class I (I, L, M and V) family protein [Arabidopsis 
thaliana]
 gb|AAD36946.1|AF069441_6 putative leucyl tRNA synthetase [Arabidopsis thaliana]
 emb|CAB77903.1| putative leucyl tRNA synthetase [Arabidopsis thaliana]
 gb|AAL84999.1| AT4g04350/T19B17_7 [Arabidopsis thaliana]
 gb|AAN72260.1| At4g04350/T19B17_7 [Arabidopsis thaliana]
 gb|AEE82383.1| tRNA synthetase class I (I, L, M and V) family protein [Arabidopsis 
thaliana]
Length=973

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIEPKWQ++WE+ + FRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRIFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  192



>ref|XP_010529456.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Tarenaya 
hassleriana]
Length=968

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 6/137 (4%)
 Frame = +2

Query  206  NGISCVKVEDEQKENEEQQ------VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  367
             G+     E ++  N ++        +R YPFHEIEPKWQ++WEE +TFRTP+++DT+KP
Sbjct  51   GGVRSSAAETQETGNSKRDSSATVVTKRVYPFHEIEPKWQQYWEENRTFRTPEDVDTAKP  110

Query  368  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  547
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  111  KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  170

Query  548  TGTHPrittirninrFR  598
            TGTHP++TT +NI RFR
Sbjct  171  TGTHPKVTTAKNIERFR  187



>ref|XP_003529648.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
[Glycine max]
 gb|KHN35716.1| Leucine--tRNA ligase [Glycine soja]
Length=972

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = +2

Query  215  SCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMF  391
            S  K    + E+ +Q V RAYPFHEIE KWQ+FW+  +TF+TPD+ IDTSKPKYYVLDMF
Sbjct  64   SAAKGGVSETEHNKQPVTRAYPFHEIELKWQRFWDHNRTFQTPDDDIDTSKPKYYVLDMF  123

Query  392  PYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrit  571
            PYPSGAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++T
Sbjct  124  PYPSGAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLT  183

Query  572  tirninrFR  598
            T+RNINRFR
Sbjct  184  TVRNINRFR  192



>gb|AES92665.2| leucyl-tRNA synthetase [Medicago truncatula]
Length=970

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 102/114 (89%), Gaps = 4/114 (4%)
 Frame = +2

Query  233  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  400
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  401  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHP  177



>ref|XP_010916288.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=950

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            QQ RR+YPF EIEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  60   QQQRRSYPFDEIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHVGHPLG  119

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT +NI RFR
Sbjct  120  YTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTKQNIERFR  173



>ref|XP_003619258.1| Leucyl-tRNA synthetase [Medicago truncatula]
Length=1009

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 102/114 (89%), Gaps = 4/114 (4%)
 Frame = +2

Query  233  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  400
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  401  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHP  177



>ref|XP_003610468.1| Leucyl-tRNA synthetase [Medicago truncatula]
Length=1091

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 102/114 (89%), Gaps = 4/114 (4%)
 Frame = +2

Query  233  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  400
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  401  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHP  177



>ref|XP_010496176.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=967

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIE KWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  74   ELKRVYPFHEIERKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  133

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  134  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  186



>ref|XP_010496177.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=973

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            +++R YPFHEIE KWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIERKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFR
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFR  192



>ref|XP_009358062.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial [Pyrus x bretschneideri]
Length=811

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  236  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  415
            E K  ++  V+R YPFHEIE KWQ++WEE +TFRTP+EIDTSKPKYYVLDMFPYPSGAGL
Sbjct  80   EHKPKQQPAVKRPYPFHEIELKWQRYWEENRTFRTPEEIDTSKPKYYVLDMFPYPSGAGL  139

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYTAT ILAR KRMQGY VLHPMGWDAFGLPAEQYAI+TGTHP+ITT++NI+RF
Sbjct  140  HVGHPLGYTATYILARLKRMQGYTVLHPMGWDAFGLPAEQYAIDTGTHPKITTLKNIDRF  199

Query  596  R  598
            R
Sbjct  200  R  200



>ref|XP_009390214.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=820

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 110/119 (92%), Gaps = 2/119 (2%)
 Frame = +2

Query  248  NEEQQV--RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  421
            N +QQV  R+AYPF  IEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHV
Sbjct  54   NPQQQVQQRKAYPFDAIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHV  113

Query  422  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GHPLGYTATDIL+R+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP++TT RNI RFR
Sbjct  114  GHPLGYTATDILSRYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKVTTKRNIERFR  172



>ref|XP_009390213.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=949

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 110/119 (92%), Gaps = 2/119 (2%)
 Frame = +2

Query  248  NEEQQV--RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  421
            N +QQV  R+AYPF  IEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHV
Sbjct  54   NPQQQVQQRKAYPFDAIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHV  113

Query  422  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GHPLGYTATDIL+R+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP++TT RNI RFR
Sbjct  114  GHPLGYTATDILSRYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKVTTKRNIERFR  172



>ref|XP_008776029.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=960

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            Q+ RR+YPF EIEP+WQ++WEE  TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  60   QKQRRSYPFDEIEPRWQRYWEENCTFRTPDEVDTSKPKCYILDMFPYPSGAGLHVGHPLG  119

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR
Sbjct  120  YTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTKRNIERFR  173



>ref|XP_006600301.1| PREDICTED: LOW QUALITY PROTEIN: leucine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=898

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = +2

Query  239  QKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPSGAGL  415
            + E+ +  V RAYPFHEIEPK Q+FWE  +TFRTPD+ IDTSKPKYYVLDMFPYPSGAGL
Sbjct  64   ETEHSKLPVTRAYPFHEIEPKXQRFWEYNRTFRTPDDDIDTSKPKYYVLDMFPYPSGAGL  123

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYTATDILAR+KRMQGYNVLHPM WDAFGLPAEQYAIETGTHP++ T+RNINRF
Sbjct  124  HVGHPLGYTATDILARYKRMQGYNVLHPMRWDAFGLPAEQYAIETGTHPKLNTVRNINRF  183

Query  596  R  598
            R
Sbjct  184  R  184



>ref|XP_006838108.1| hypothetical protein AMTR_s00106p00046740 [Amborella trichopoda]
 gb|ERN00677.1| hypothetical protein AMTR_s00106p00046740 [Amborella trichopoda]
Length=967

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 120/136 (88%), Gaps = 7/136 (5%)
 Frame = +2

Query  212  ISC-VKVEDEQKENEEQQVR-----RAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPK  370
            ++C V+ ++ QKE EE+  R     +AYPF EIEP+WQ +WEE +TFRTPD+ +DTSKPK
Sbjct  62   VACGVRAQEMQKEEEEEIERGSKKQKAYPFDEIEPRWQGYWEENRTFRTPDDDLDTSKPK  121

Query  371  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  550
            +Y+LDMFPYPSGAGLHVGHPLGYTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  122  FYILDMFPYPSGAGLHVGHPLGYTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIET  181

Query  551  GTHPrittirninrFR  598
            GTHP++TT++NI RFR
Sbjct  182  GTHPKVTTLQNITRFR  197



>gb|EEC69839.1| hypothetical protein OsI_00164 [Oryza sativa Indica Group]
Length=946

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 3/136 (2%)
 Frame = +2

Query  200  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  370
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  40   RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  99

Query  371  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  550
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  100  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIET  159

Query  551  GTHPrittirninrFR  598
            GTHP+ITT RNINRFR
Sbjct  160  GTHPKITTERNINRFR  175



>ref|XP_006643717.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial-like [Oryza brachyantha]
Length=969

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 3/116 (3%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHP  430
            QVRRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHP
Sbjct  51   QVRRAYPYDEIEPRWQRHWEEHRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHP  110

Query  431  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            LGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI+RFR
Sbjct  111  LGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIDRFR  166



>gb|EEE53778.1| hypothetical protein OsJ_00171 [Oryza sativa Japonica Group]
Length=1257

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 111/136 (82%), Gaps = 3/136 (2%)
 Frame = +2

Query  200  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  370
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  351  RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  410

Query  371  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  550
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  411  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIET  470

Query  551  GTHPrittirninrFR  598
            GTHP+ITT RNINRFR
Sbjct  471  GTHPKITTERNINRFR  486



>ref|XP_001765367.1| predicted protein [Physcomitrella patens]
 gb|EDQ69830.1| predicted protein [Physcomitrella patens]
Length=906

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  233  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  412
            D++K  E  Q  R YPF EIE +WQ++WE+ +TFRTPD +DT+KPKYYVLDMFPYPSGAG
Sbjct  16   DQEKGLETPQKIRGYPFPEIEARWQQYWEDNQTFRTPDVVDTTKPKYYVLDMFPYPSGAG  75

Query  413  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  592
            LHVGHP GYTATDI+AR+KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHPR TT++NI+R
Sbjct  76   LHVGHPEGYTATDIMARYKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPRETTLKNIDR  135

Query  593  FR  598
            FR
Sbjct  136  FR  137



>ref|XP_002455289.1| hypothetical protein SORBIDRAFT_03g007890 [Sorghum bicolor]
 gb|EES00409.1| hypothetical protein SORBIDRAFT_03g007890 [Sorghum bicolor]
Length=958

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +2

Query  254  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +   RRAYPF EIEP+WQ+ WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGLHVG
Sbjct  64   QAAARRAYPFDEIEPRWQRHWEEHRTFRTPDIGDGLDTSKPKCYILDMFPYPSGAGLHVG  123

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HPLGYTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR
Sbjct  124  HPLGYTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIGRFR  181



>ref|XP_010230387.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=936

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 3/121 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGL  415
            + +  + RRAYP+ EIEP+WQ  WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGL
Sbjct  39   DADAGKARRAYPYDEIEPRWQAHWEEHRTFRTPDLGDGLDTSKPKCYILDMFPYPSGAGL  98

Query  416  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  595
            HVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT +NI+RF
Sbjct  99   HVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIQTGTHPKFTTAQNIDRF  158

Query  596  R  598
            R
Sbjct  159  R  159



>ref|XP_004968118.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial-like [Setaria italica]
Length=984

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 3/114 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  65   RRAYPYDEIEPRWQRHWEEHRTFRTPDIGEGLDTSKPKCYILDMFPYPSGAGLHVGHPLG  124

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR
Sbjct  125  YTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIERFR  178



>ref|XP_002948892.1| hypothetical protein VOLCADRAFT_89222 [Volvox carteri f. nagariensis]
 gb|EFJ50272.1| hypothetical protein VOLCADRAFT_89222 [Volvox carteri f. nagariensis]
Length=938

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  242  KENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  421
            + + +    +AYPF EIE KWQ +WE+ +TF TPD++DTSKPKYYVLDMFPYPSGAGLHV
Sbjct  82   QADAKSAASQAYPFTEIEAKWQAYWEQNQTFHTPDQVDTSKPKYYVLDMFPYPSGAGLHV  141

Query  422  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GHP GYTATDILAR+KRM+G+NVLHPMGWDAFGLPAEQYA++TGTHP +TT RN+ RFR
Sbjct  142  GHPEGYTATDILARYKRMRGFNVLHPMGWDAFGLPAEQYALQTGTHPAVTTQRNVTRFR  200



>ref|XP_011398417.1| Leucine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM25521.1| Leucine-tRNA ligase [Auxenochlorella protothecoides]
Length=1317

 Score =   190 bits (483),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  445
            AYPF E+EPKWQ++WEE +TFRTP+  ++DTSKPK+YVLDMFPYPSG+GLHVGHP GYTA
Sbjct  82   AYPFAELEPKWQRYWEENQTFRTPEFKDLDTSKPKFYVLDMFPYPSGSGLHVGHPEGYTA  141

Query  446  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TDILAR+KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP  TT  NI RFR
Sbjct  142  TDILARYKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPAATTATNITRFR  192



>emb|CBH32645.1| leucyl-tRNA synthetase, putative, expressed [Triticum aestivum]
Length=965

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 3/114 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            RRAYP+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  52   RRAYPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLG  111

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+ FR
Sbjct  112  YTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDHFR  165



>ref|XP_008655584.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Zea 
mays]
Length=954

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 3/118 (3%)
 Frame = +2

Query  254  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +   RRAYPF EIEP+WQ+ WEE +TFRT D    +DTSKPK Y+LDMFPYPSGAGLHVG
Sbjct  60   QTAARRAYPFDEIEPRWQRHWEEHRTFRTLDIGEGLDTSKPKCYILDMFPYPSGAGLHVG  119

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HPLGYTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ITT RNI RFR
Sbjct  120  HPLGYTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKITTERNIERFR  177



>emb|CDM80420.1| unnamed protein product [Triticum aestivum]
Length=968

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 3/113 (3%)
 Frame = +2

Query  269  RAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            RAYP+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGY
Sbjct  56   RAYPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGY  115

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+ FR
Sbjct  116  TATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDHFR  168



>ref|XP_005842216.1| leucyl-tRNA synthetase [Guillardia theta CCMP2712]
 gb|EKX55236.1| leucyl-tRNA synthetase [Guillardia theta CCMP2712]
Length=888

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  251  EEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHP  430
            +E     AYPF EIE KWQ FW+E+ TFRTP+++D SKPKYYVLDMFPYPSGAGLHVGHP
Sbjct  4    KESSTSSAYPFQEIERKWQGFWKEQDTFRTPEKVDMSKPKYYVLDMFPYPSGAGLHVGHP  63

Query  431  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
             GYTATDIL+R+K+M  YNV+HPMGWDAFGLPAEQYAI+TGTHP +TT +NI+RFR
Sbjct  64   EGYTATDILSRYKKMNDYNVMHPMGWDAFGLPAEQYAIQTGTHPSVTTKKNIDRFR  119



>ref|XP_003079670.1| Isoleucyl-tRNA synthetase (ISS) [Ostreococcus tauri]
 emb|CAL53315.1| Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I,anticodon-binding 
[Ostreococcus tauri]
Length=880

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  233  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  412
            D  ++         YPF  IE KWQKFW + KTF+TP EID SKPK+Y LDMFPYPSGAG
Sbjct  9    DASRDASTTTNEGGYPFGAIEGKWQKFWSDDKTFKTPREIDASKPKFYALDMFPYPSGAG  68

Query  413  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  592
            LHVGHP GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHP  TT++N+ R
Sbjct  69   LHVGHPEGYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHPSQTTVKNVGR  128

Query  593  FR  598
            FR
Sbjct  129  FR  130



>ref|XP_001418146.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96439.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=879

 Score =   181 bits (460),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  254  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            E+     Y F ++E KWQKFW E+KTF TP  ID +KPK+Y LDMFPYPSGAGLHVGHP 
Sbjct  49   ERTTSAGYAFGDVEAKWQKFWREEKTFATPRAIDATKPKFYALDMFPYPSGAGLHVGHPE  108

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  109  GYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHP  151



>ref|WP_006930182.1| leucyl-tRNA synthetase [Caldithrix abyssi]
 gb|EHO42830.1| leucyl-tRNA synthetase [Caldithrix abyssi DSM 13497]
Length=877

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AYPF +IE KWQKFWEE+KTF+T D+ D  +PKYYVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    AYPFGKIEKKWQKFWEEQKTFKTEDKFD--QPKYYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I+AR+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHPRITT RNI RFR
Sbjct  60   IMARYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPRITTERNIERFR  108



>emb|CCG48000.1| leucyl-tRNA synthetase, putative, expressed [Triticum aestivum]
Length=916

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 101/111 (91%), Gaps = 3/111 (3%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  445
            +P+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGYTA
Sbjct  6    HPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGYTA  65

Query  446  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+RFR
Sbjct  66   TDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDRFR  116



>ref|XP_003059586.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56718.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1061

 Score =   181 bits (458),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 88/128 (69%), Positives = 102/128 (80%), Gaps = 7/128 (5%)
 Frame = +2

Query  236  EQKENEEQQVRRA--YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP---  400
            E   + E    R+  YPF +IE +WQK W E KTF+TPD+IDT+KPK+Y LDMFPYP   
Sbjct  94   ETSSDAESTAARSGGYPFADIEARWQKHWAENKTFKTPDQIDTTKPKFYALDMFPYPRRV  153

Query  401  --SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPritt  574
              +GAGLHVGHP GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHPR TT
Sbjct  154  VAAGAGLHVGHPEGYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHPRDTT  213

Query  575  irninrFR  598
            + N+ RFR
Sbjct  214  VANVARFR  221



>ref|WP_038556448.1| leucyl-tRNA synthetase [Draconibacterium orientale]
 gb|AHW59211.1| leucyl-tRNA synthetase [Draconibacterium orientale]
Length=883

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIEPKWQK+WEE KTF+T D  D SKPKYY+LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YKFAEIEPKWQKYWEENKTFKTND--DYSKPKYYILDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+R+KRM+G+NVLHPMG+DAFGLPAEQYA++TGTHP ITT +N + FR
Sbjct  61   LSRYKRMKGFNVLHPMGYDAFGLPAEQYAMQTGTHPAITTQKNCDNFR  108



>ref|WP_021267760.1| leucyl-tRNA synthetase [Bacteriovorax sp. BAL6_X]
 gb|EPZ49213.1| leucine--tRNA ligase [Bacteriovorax sp. BAL6_X]
Length=802

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/96 (83%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIEPKWQKFW++ KTFRT D  D SKPKYYVLDMFPYPSGAGLHVGH  GYTATDI
Sbjct  3    YNFGEIEPKWQKFWDDNKTFRT-DSTDKSKPKYYVLDMFPYPSGAGLHVGHVEGYTATDI  61

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            LARFKRM G+NVLHPMGWD+FGLPAE YAI+TGTHP
Sbjct  62   LARFKRMNGHNVLHPMGWDSFGLPAENYAIKTGTHP  97



>ref|XP_005651384.1| putative leucyl tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26840.1| putative leucyl tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=891

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  445
            +YPF E+E KWQ FW   KTFRTPD  E+DTSKPK Y+LDMFPYPSGAGLHVGHP GYTA
Sbjct  37   SYPFTELEAKWQDFWLRNKTFRTPDIGELDTSKPKAYILDMFPYPSGAGLHVGHPAGYTA  96

Query  446  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TDILAR KRMQG NVLHP+GWDAFGLPAEQYA++TGTHPR+TT RN+NRFR
Sbjct  97   TDILARLKRMQGANVLHPIGWDAFGLPAEQYALQTGTHPRVTTERNVNRFR  147



>gb|KJF44738.1| leucyl-tRNA synthase [Draconibacterium sp. JN14CK-3]
Length=883

 Score =   178 bits (452),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIEPKWQK+WEE KTF+T D  D SKPKYY+LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YKFAEIEPKWQKYWEENKTFKTND--DYSKPKYYILDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+R+KRM+G+NVLHPMG+DAFGLPAEQYA++TGTHP ITT +N + FR
Sbjct  61   LSRYKRMKGFNVLHPMGYDAFGLPAEQYAMQTGTHPAITTQKNCDNFR  108



>ref|XP_007513267.1| leucyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO16825.1| leucyl-tRNA synthetase [Bathycoccus prasinos]
Length=941

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 3/111 (3%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  445
            YPF EIE KWQK W+E KTF+TP     +D SKPK+Y LDMFPYPSGAGLHVGHP GYTA
Sbjct  72   YPFAEIEQKWQKNWQENKTFQTPSLNSGLDQSKPKFYALDMFPYPSGAGLHVGHPEGYTA  131

Query  446  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TDI+AR+KRM+GYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT +N+NRFR
Sbjct  132  TDIMARYKRMKGYNVLHPMGWDAFGLPAEQYAIETGTHPKETTAKNVNRFR  182



>ref|XP_005537865.1| leucine--tRNA ligase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81829.1| leucine--tRNA ligase [Cyanidioschyzon merolae strain 10D]
Length=1048

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AY F  +E +WQ+FWE ++ FRTPDE+D ++PKYY+LDMFPYPSGAGLHVGHP GYTATD
Sbjct  147  AYDFLAVERRWQEFWEREQIFRTPDEVDWNRPKYYILDMFPYPSGAGLHVGHPEGYTATD  206

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR+KRM+GYNVLHPMGWDAFGLPAEQ+A++TG HP + T RNI RFR
Sbjct  207  ILARYKRMRGYNVLHPMGWDAFGLPAEQFALDTGIHPAVATERNITRFR  255



>gb|EMS46157.1| Leucyl-tRNA synthetase [Triticum urartu]
Length=919

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 3/106 (3%)
 Frame = +2

Query  290  IEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILA  460
            IEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGYTATDIL+
Sbjct  25   IEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGYTATDILS  84

Query  461  RFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+RFR
Sbjct  85   RFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDRFR  130



>ref|WP_021978830.1| leucyl-tRNA synthetase [Clostridium sp. CAG:793]
 emb|CCY99660.1| leucine--tRNA ligase [Clostridium sp. CAG:793]
Length=798

 Score =   174 bits (441),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 78/96 (81%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIEPKWQK+W+E KTF+T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATDI
Sbjct  2    YNFKEIEPKWQKYWDENKTFKT-DSWDFSKPKYYALDMFPYPSGQGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            + R KRMQGYNVLHPMGWDAFGLPAEQYAI+TG HP
Sbjct  61   ICRMKRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHP  96



>dbj|BAD52586.1| putative leucyl-tRNA synthetase [Oryza sativa Japonica Group]
Length=910

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +2

Query  200  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  370
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  40   RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  99

Query  371  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  535
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQ
Sbjct  100  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQ  154



>gb|EMY07084.1| tRNA ligases class I domain protein [Leptospira interrogans str. 
2002000626]
Length=240

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFR  108



>ref|XP_005851157.1| hypothetical protein CHLNCDRAFT_55974 [Chlorella variabilis]
 gb|EFN59055.1| hypothetical protein CHLNCDRAFT_55974 [Chlorella variabilis]
Length=873

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = +2

Query  290  IEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILAR  463
            IE KWQ FWEE +TFRTP+  E+DTSKPK+Y LDMFPYPSGAGLHVGHP GYTATDI+AR
Sbjct  8    IEAKWQAFWEEHQTFRTPEFHELDTSKPKFYALDMFPYPSGAGLHVGHPEGYTATDIMAR  67

Query  464  FKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            +KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP +TT +NI RFR
Sbjct  68   YKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPAVTTDKNIARFR  112



>ref|WP_011403694.1| leucyl-tRNA synthetase [Salinibacter ruber]
 ref|YP_445066.1| leucyl-tRNA synthetase [Salinibacter ruber DSM 13855]
 sp|Q2S415.1|SYL_SALRD RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Salinibacter ruber DSM 13855]
 gb|ABC46207.1| leucyl-tRNA synthetase [Salinibacter ruber DSM 13855]
Length=863

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AYPFH+IE KWQ++WEE +TFRTPDE+   + ++YVLDMFPYPSG+GLHVGHP GYTATD
Sbjct  2    AYPFHDIETKWQQYWEEHQTFRTPDEVPDDQEEFYVLDMFPYPSGSGLHVGHPEGYTATD  61

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I+AR+KR QG+NVLHPMGWDAFGLPAEQYA++T THPR TT +NI +F+
Sbjct  62   IVARYKRKQGFNVLHPMGWDAFGLPAEQYALKTNTHPRETTEKNIAQFK  110



>ref|WP_001199935.1| hypothetical protein, partial [Leptospira interrogans]
Length=245

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFR  108



>ref|WP_021270809.1| leucyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC48585.1| leucine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=801

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F +IE KWQ +W+E KTF+T + +D SKPKYYVLDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YNFQDIEKKWQDYWDENKTFKT-EALDKSKPKYYVLDMFPYPSGAGLHVGHPEGYTATDI  61

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            LAR+KRM G+NVLHPMGWD+FGLPAE YAI+TGTHP
Sbjct  62   LARYKRMTGHNVLHPMGWDSFGLPAENYAIKTGTHP  97



>ref|WP_025704615.1| leucyl-tRNA synthetase, partial [Paenibacillus graminis]
Length=420

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +N        Y    IEPKWQKFW+E KTF+T +  D  KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNNTTSTASGYRAQTIEPKWQKFWDENKTFKTGE--DAGKPKFYALDMFPYPSGAGLHVG  60

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   HPEGYTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPREITFKNIDNFR  118



>ref|WP_027088225.1| leucyl-tRNA synthetase [Cohnella panacarvi]
Length=811

 Score =   172 bits (436),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            Q  ++ Y    IEPKWQK+W+E KTFRT +  D +KPK+Y LDMFPYPSGAGLHVGHP G
Sbjct  3    QDNQQGYRPQTIEPKWQKYWDENKTFRTTE--DAAKPKFYALDMFPYPSGAGLHVGHPEG  60

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDI++RFKRM+G+NVLHPMGWDAFGLPAEQYA++TG HPR  T+ NIN FR
Sbjct  61   YTATDIVSRFKRMKGFNVLHPMGWDAFGLPAEQYALQTGRHPREITVENINNFR  114



>ref|WP_012095876.1| leucyl-tRNA synthetase [Bacillus cytotoxicus]
 sp|A7GU19.1|SYL_BACCN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cytotoxicus NVH 391-98]
 gb|ABS23627.1| leucyl-tRNA synthetase [Bacillus cytotoxicus NVH 391-98]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_000009445.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL48836.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-44]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_014067706.1| leucyl-tRNA synthetase [Rhodothermus marinus]
 gb|AEN74111.1| leucyl-tRNA synthetase [Rhodothermus marinus SG0.5JP17-172]
Length=906

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
             YPF EIE KWQ++W+E KTFRT  P E   D +KPKYYVLDMFPYPSGAGLHVGHP GY
Sbjct  3    GYPFKEIEKKWQRYWDEHKTFRTAGPKEPGFDPNKPKYYVLDMFPYPSGAGLHVGHPEGY  62

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDI+AR++RM+GYNVLHPMGWDAFGLPAEQYAIET THPRITT RNI RFR
Sbjct  63   TATDIMARYRRMKGYNVLHPMGWDAFGLPAEQYAIETNTHPRITTERNIARFR  115



>ref|WP_017153787.1| leucyl-tRNA synthetase [Bacillus sp. FJAT-13831]
Length=802

 Score =   172 bits (435),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_026593769.1| leucyl-tRNA synthetase [Bacillus sp. UNC437CL72CviS29]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQSYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_002173861.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR49997.1| leucyl-tRNA synthetase [Bacillus cereus VD107]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFSHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|XP_005703014.1| leucyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME26494.1| leucyl-tRNA synthetase [Galdieria sulphuraria]
Length=986

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  230  EDEQKENEEQQV-RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSG  406
            ED     ++QQ+    Y F  +E KWQ +WE+ KTF+ P  +DTSKPKYYVLDMFPYPSG
Sbjct  85   EDSNVNFDKQQLPLDTYDFTRVESKWQHYWEKNKTFQVPIHVDTSKPKYYVLDMFPYPSG  144

Query  407  AGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirni  586
            AGLHVGHP GYTATDI+ARFKRMQGY VLHP+G+DAFGLPAEQYA++TGTHP ITT RN 
Sbjct  145  AGLHVGHPEGYTATDIIARFKRMQGYQVLHPIGFDAFGLPAEQYAMQTGTHPAITTERNK  204

Query  587  nrFR  598
             RFR
Sbjct  205  ERFR  208



>ref|WP_000009448.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 ref|NP_847185.1| leucine--tRNA ligase [Bacillus anthracis str. Ames]
 ref|YP_030881.1| leucyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 sp|Q81KK6.1|SYL_BACAN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis]
 sp|Q632V2.1|SYL_BACCZ RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus E33L]
 sp|A0RJX2.1|SYL_BACAH RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus thuringiensis str. Al Hakam]
 sp|B7JT07.1|SYL_BACC0 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus AH820]
 sp|C3PBK0.1|SYL_BACAA RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis str. A0248]
 sp|C3LAX2.1|SYL_BACAC RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis str. CDC 684]
 sp|C1EW09.1|SYL_BACC3 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus 03BB102]
 gb|AAP28671.1| leucine--tRNA ligase [Bacillus anthracis str. Ames]
 gb|AAT34117.1| leucyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gb|AAT56931.1| leucyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gb|AAU15783.1| leucine--tRNA ligase (leucyl-tRNA synthetase) [Bacillus cereus 
E33L]
 gb|ABK87515.1| leucyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
 gb|EDR20118.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0488]
 gb|EDR89191.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0193]
 gb|EDR93330.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0442]
 gb|EDS98330.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0389]
 gb|EDT21209.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0465]
 gb|EDT68163.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0174]
 gb|EDV14563.1| leucyl-tRNA synthetase [Bacillus anthracis str. Tsiankovskii-I]
 gb|EDX58512.1| leucyl-tRNA synthetase [Bacillus cereus W]
 gb|EDX64049.1| leucyl-tRNA synthetase [Bacillus cereus 03BB108]
 gb|ACK89591.1| leucyl-tRNA synthetase [Bacillus cereus AH820]
 gb|ACO27953.1| leucine--tRNA ligase [Bacillus cereus 03BB102]
 gb|ACP13417.1| leucine--tRNA ligase [Bacillus anthracis str. CDC 684]
 gb|EEK54119.1| Leucyl-tRNA synthetase [Bacillus cereus BGSC 6E1]
 gb|EEL14783.1| Leucyl-tRNA synthetase [Bacillus cereus 95/8201]
 gb|EEM57511.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey 
BGSC 4AJ1]
 gb|EEM69422.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar andalousiensis 
BGSC 4AW1]
 gb|EEM75473.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pondicheriensis 
BGSC 4BA1]
 gb|EEM87332.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pulsiensis 
BGSC 4CC1]
 gb|ACQ46248.1| leucine--tRNA ligase [Bacillus anthracis str. A0248]
 gb|AEW57875.1| Leucyl-tRNA synthetase [Bacillus cereus F837/76]
 gb|AFH86155.1| Leucyl-tRNA synthetase [Bacillus anthracis str. H9401]
 gb|AHE86389.1| Leucyl-tRNA synthetase [Bacillus anthracis str. A16R]
 gb|AHE92245.1| Leucyl-tRNA synthetase [Bacillus anthracis str. A16]
 dbj|GAF00343.1| leucyl-tRNA synthetase [Bacillus anthracis CZC5]
 gb|EVT89693.1| leucyl-tRNA synthetase [Bacillus anthracis 8903-G]
 gb|EVT96032.1| leucyl-tRNA synthetase [Bacillus anthracis 9080-G]
 gb|EVU02324.1| leucyl-tRNA synthetase [Bacillus anthracis 52-G]
 gb|AHK40918.1| leucyl-tRNA synthetase [Bacillus anthracis str. SVA11]
 gb|EXJ18395.1| leucyl-tRNA synthetase [Bacillus anthracis str. 95014]
 gb|AIF58895.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KEY93311.1| leucyl-tRNA synthetase [Bacillus anthracis str. Carbosap]
 gb|KFJ80317.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK35078.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK59215.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK66133.1| leucine--tRNA ligase [Bacillus anthracis str. Vollum]
 gb|AIK53583.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|KFL65730.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|KFL68892.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIM08659.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ41936.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ49179.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ55199.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ61091.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ64512.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ65724.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ76789.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ80349.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ90846.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ96850.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA02086.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA11740.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA13096.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA17516.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA26417.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA31367.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA31941.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA38852.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG47252.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG47573.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG58428.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJA88935.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJF92307.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJG31425.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJG48967.1| leucine--tRNA ligase [Bacillus anthracis str. Turkey32]
 gb|AJG52039.1| leucine--tRNA ligase [Bacillus cereus 03BB102]
 gb|AJG61622.1| leucine--tRNA ligase [Bacillus cereus D17]
 gb|AJG63119.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG70363.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG75313.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJG83326.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG85841.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH28670.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH36945.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH39394.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH44967.1| leucine--tRNA ligase [Bacillus anthracis str. Sterne]
 gb|AJH53872.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH57776.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH63463.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJH97443.1| leucine--tRNA ligase [Bacillus anthracis str. V770-NP-1R]
 gb|AJH70568.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJI12472.1| leucine--tRNA ligase [Bacillus cereus 03BB108]
 gb|AJH82758.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJH90542.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJI28543.1| leucine--tRNA ligase [Bacillus cereus E33L]
 gb|AJH96755.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJI38951.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJK34779.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJM83232.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009450.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009451.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR09795.1| leucyl-tRNA synthetase [Bacillus cereus MSX-A12]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_001991042.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EDX66939.1| leucine--tRNA ligase [Bacillus cereus NVH0597-99]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009455.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 ref|YP_038784.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 sp|Q6HCE2.1|SYL_BACHK RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 gb|AAT63896.1| leucine--tRNA ligase (leucyl-tRNA synthetase) [Bacillus thuringiensis 
serovar konkukian str. 97-27]
 gb|AJI36623.1| leucine--tRNA ligase [Bacillus thuringiensis]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009476.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ98283.1| leucyl-tRNA synthetase [Bacillus cereus ISP3191]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TKKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009452.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK81861.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gb|KFM86849.1| leucine--tRNA ligase [Bacillus cereus ATCC 4342]
 gb|AJH75982.1| leucine--tRNA ligase [Bacillus cereus ATCC 4342]
Length=802

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_029440187.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009454.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|AFQ10198.1| leucyl-tRNA ligase [Bacillus cereus FRI-35]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009461.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 ref|NP_834441.1| leucyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 sp|Q816T0.1|SYL_BACCR RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus ATCC 14579]
 gb|AAP11642.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gb|EEK92621.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gb|EEL09336.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
 gb|EEL26491.1| Leucyl-tRNA synthetase [Bacillus cereus Rock1-15]
 gb|EEL74282.1| Leucyl-tRNA synthetase [Bacillus cereus AH676]
 gb|ADH09186.1| leucyl-tRNA synthetase [Bacillus thuringiensis BMB171]
 gb|EJR87221.1| leucyl-tRNA synthetase [Bacillus cereus VD169]
 gb|EJR94595.1| leucyl-tRNA synthetase [Bacillus cereus VD200]
 emb|CCW07383.1| Leucyl-tRNA synthetase [Bacillus sp. GeD10]
 gb|EOO63201.1| leucyl-tRNA synthetase [Bacillus cereus VD196]
 gb|ETT85474.1| leucyl-tRNA ligase [Bacillus weihenstephanensis FSL R5-860]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009459.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR87500.1| leucyl-tRNA synthetase [Bacillus cereus VD166]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009460.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|EEM26536.1| Leucyl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gb|EEM32870.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis 
str. T01001]
 gb|EEM63832.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar berliner 
ATCC 10792]
 gb|AEA18419.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar chinensis 
CT-43]
 gb|AFV20572.1| leucine--tRNA ligase LeuS [Bacillus thuringiensis Bt407]
 gb|AGG03548.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis 
str. IS5056]
 gb|ERI02957.1| Leucine--tRNA ligase [Bacillus thuringiensis T01-328]
 gb|AHA74363.1| leucyl-tRNA ligase [Bacillus thuringiensis YBT-1518]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009462.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 sp|B7H798.1|SYL_BACC4 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus B4264]
 gb|ACK59437.1| leucine--tRNA ligase [Bacillus cereus B4264]
 gb|EEK87198.1| Leucyl-tRNA synthetase [Bacillus cereus m1550]
 gb|EOQ05509.1| leucyl-tRNA synthetase [Bacillus cereus VD184]
 gb|KIZ29283.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_044790847.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>gb|KGZ89134.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009457.1| leucyl-tRNA synthetase [Bacillus cereus]
 sp|Q72YY8.1|SYL_BACC1 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus ATCC 10987]
 sp|B7HSS7.1|SYL_BACC7 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus AH187]
 sp|B9J1E1.1|SYL_BACCQ RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus Q1]
 gb|AAS43783.1| leucyl-tRNA synthetase [Bacillus cereus ATCC 10987]
 gb|EDZ55842.1| leucyl-tRNA synthetase [Bacillus cereus H3081.97]
 gb|ACJ79239.1| leucyl-tRNA synthetase [Bacillus cereus AH187]
 gb|ACM14979.1| leucyl-tRNA synthetase [Bacillus cereus Q1]
 gb|EEK42734.1| Leucyl-tRNA synthetase [Bacillus cereus m1293]
 gb|EEK98256.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST26]
 dbj|BAL20440.1| leucyl-tRNA synthetase [Bacillus cereus NC7401]
 gb|EJP92589.1| leucyl-tRNA synthetase [Bacillus cereus IS075]
 gb|EJQ04837.1| leucyl-tRNA synthetase [Bacillus cereus AND1407]
 gb|EJR21407.1| leucyl-tRNA synthetase [Bacillus cereus MSX-D12]
 gb|EJR53892.1| leucyl-tRNA synthetase [Bacillus cereus VD102]
 gb|EOO93147.1| leucyl-tRNA synthetase [Bacillus cereus IS845/00]
 gb|EOO98748.1| leucyl-tRNA synthetase [Bacillus cereus IS195]
 gb|KFK73327.1| leucine--tRNA ligase [Bacillus cereus]
 gb|KFL84219.1| leucine--tRNA ligase [Bacillus cereus]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009465.1| leucyl-tRNA synthetase [Bacillus sp. 7_6_55CFAA_CT2]
 gb|EHL77718.1| leucyl-tRNA synthetase [Bacillus sp. 7_6_55CFAA_CT2]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009449.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|ADK07321.1| leucyl-tRNA synthetase [Bacillus cereus biovar anthracis str. 
CI]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009466.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|EDZ52483.1| leucyl-tRNA synthetase [Bacillus cereus AH1134]
 gb|EEK59874.1| Leucyl-tRNA synthetase [Bacillus cereus 172560W]
 gb|EEL53793.1| Leucyl-tRNA synthetase [Bacillus cereus Rock4-2]
 gb|EEL62822.1| Leucyl-tRNA synthetase [Bacillus cereus F65185]
 gb|EJQ15199.1| leucyl-tRNA synthetase [Bacillus cereus BAG3O-2]
 gb|EJQ22068.1| leucyl-tRNA synthetase [Bacillus cereus BAG4O-1]
 gb|EJQ26395.1| leucyl-tRNA synthetase [Bacillus cereus BAG4X12-1]
 gb|EOO33442.1| leucyl-tRNA synthetase [Bacillus cereus VD133]
 gb|EOP86985.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X12-1]
 gb|EOP91573.1| leucyl-tRNA synthetase [Bacillus cereus VD140]
 emb|CDN38300.1| unnamed protein product [Bacillus thuringiensis DB27]
 gb|AHX20735.1| leucyl-tRNA synthetase [Bacillus bombysepticus str. Wang]
 gb|KGT42253.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009470.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ83896.1| leucyl-tRNA synthetase [Bacillus cereus HuB5-5]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009469.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL20690.1| Leucyl-tRNA synthetase [Bacillus cereus Rock1-3]
 gb|EEL32263.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-28]
 gb|EEL38146.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-29]
 gb|EJQ35918.1| leucyl-tRNA synthetase [Bacillus cereus BAG5O-1]
 gb|EJQ76866.1| leucyl-tRNA synthetase [Bacillus cereus HuB4-10]
 gb|EJR68415.1| leucyl-tRNA synthetase [Bacillus cereus VD148]
 gb|EJS56958.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-2]
 gb|EJV51940.1| leucyl-tRNA synthetase [Bacillus cereus BAG4X2-1]
 gb|EJV54031.1| leucyl-tRNA synthetase [Bacillus cereus BAG6O-1]
 gb|EJV96346.1| leucyl-tRNA synthetase [Bacillus cereus HuB2-9]
 gb|EOP20424.1| leucyl-tRNA synthetase [Bacillus cereus VD131]
 gb|EOP21689.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-3]
 gb|EOP36884.1| leucyl-tRNA synthetase [Bacillus cereus VD214]
 gb|EPF03637.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-2]
 gb|AHA07982.1| Leucyl-tRNA synthetase [Bacillus toyonensis BCT-7112]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009468.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|ADY23895.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar finitimus 
YBT-020]
Length=802

 Score =   171 bits (434),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_042980446.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|KFM98685.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   171 bits (434),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_000009473.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|AFU15441.1| Leucyl-tRNA synthetase [Bacillus thuringiensis MC28]
Length=802

 Score =   171 bits (434),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009471.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR68660.1| leucyl-tRNA synthetase [Bacillus cereus VD115]
Length=802

 Score =   171 bits (434),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002123189.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ46041.1| leucyl-tRNA synthetase [Bacillus cereus BAG6X1-2]
Length=802

 Score =   171 bits (434),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009472.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL59104.1| Leucyl-tRNA synthetase [Bacillus cereus Rock4-18]
Length=802

 Score =   171 bits (434),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_013061526.1| leucyl-tRNA synthetase [Salinibacter ruber]
 emb|CBH24047.1| leucyl-tRNA synthetase [Salinibacter ruber M8]
Length=863

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AYPFH+IE KWQ+ WEE +TFRTPDE+   + ++YVLDMFPYPSG+GLHVGHP GYTATD
Sbjct  2    AYPFHDIETKWQQHWEEHQTFRTPDEVPDDQEEFYVLDMFPYPSGSGLHVGHPEGYTATD  61

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I+AR+KR QG+NVLHPMGWDAFGLPAEQYA++T THPR TT +NI +F+
Sbjct  62   IVARYKRKQGFNVLHPMGWDAFGLPAEQYALKTNTHPRETTEKNIAQFK  110



>gb|EMF80247.1| putative leucine--tRNA ligase [Leptospira weilii serovar Topaz 
str. LT2116]
Length=360

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEENKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFR  108



>ref|WP_016135497.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOQ24186.1| leucyl-tRNA synthetase [Bacillus cereus BAG3O-1]
Length=802

 Score =   171 bits (433),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_016085871.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP14509.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-3]
 gb|EOQ07985.1| leucyl-tRNA synthetase [Bacillus cereus B5-2]
Length=802

 Score =   171 bits (433),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_041875508.1| leucyl-tRNA synthetase [Verrucomicrobia bacterium SCGC AAA164-O14]
Length=843

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRTP----DEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            R+ YPF + EPKWQ  W E KT+ TP    +  D SKPKYY+LDMFPYPSGAGLHVGHP 
Sbjct  5    RKPYPFDQFEPKWQSHWSENKTYGTPSPGEEGFDASKPKYYILDMFPYPSGAGLHVGHPE  64

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDI+ R+KRM GYNVLHPMGWDAFGLPAEQYAI+TG HP +TT  NIN FR
Sbjct  65   GYTATDIVGRYKRMNGYNVLHPMGWDAFGLPAEQYAIKTGQHPSVTTEANINNFR  119



>gb|AIM14154.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=512

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_035436072.1| leucyl-tRNA synthetase [Bacillus sp. UNC322MFChir4.1]
Length=802

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_000009439.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL43337.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-42]
Length=802

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_001199936.1| hypothetical protein, partial [Leptospira interrogans]
Length=305

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFR  108



>ref|WP_029443454.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
Length=802

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFR  108



>ref|WP_016080001.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOO30967.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-1]
 gb|EOO45845.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-1]
 gb|EOO55371.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-2]
 gb|EOO57475.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-3]
 gb|EOP02795.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-1]
Length=802

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFR  108



>ref|WP_020060261.1| leucyl-tRNA synthetase [Bacillus sp. 123MFChir2]
Length=802

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEQNINTFR  108



>ref|WP_000009441.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EAO52566.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis 
ATCC 35646]
 gb|EEM39401.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar sotto 
str. T04001]
 gb|EEN00889.1| Leucyl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
 gb|EJP94884.1| leucyl-tRNA synthetase [Bacillus cereus VD022]
 gb|EJR10124.1| leucyl-tRNA synthetase [Bacillus cereus MSX-A1]
 gb|AFQ18437.1| leucyl-tRNA ligase [Bacillus thuringiensis HD-771]
 gb|AFQ28617.1| leucyl-tRNA ligase [Bacillus thuringiensis HD-789]
 gb|EOO10966.1| leucyl-tRNA synthetase [Bacillus cereus str. Schrouff]
 gb|EOO90379.1| leucyl-tRNA synthetase [Bacillus cereus K-5975c]
 gb|EOQ60094.1| leucyl-tRNA synthetase [Bacillus cereus TIAC219]
 gb|EXL35499.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis]
 gb|KIP24036.1| leucine--tRNA ligase [Bacillus thuringiensis serovar morrisoni]
 gb|AJH05621.1| leucine--tRNA ligase [Bacillus thuringiensis HD1002]
 gb|AJQ61470.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar morrisoni]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_038170035.1| leucyl-tRNA synthetase, partial [Verrucomicrobium sp. BvORR106]
Length=322

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRT----PDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            R+ YPF E EP+WQ  W+  K+FRT     +  D SKPKY+VLDMFPYPSG GLHVGHP 
Sbjct  6    RKQYPFDEFEPQWQSHWDANKSFRTLGPGDEGFDASKPKYFVLDMFPYPSGQGLHVGHPE  65

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAI+TG HPR TT +N+  FR
Sbjct  66   GYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIKTGQHPRTTTEKNVENFR  120



>ref|WP_016099046.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP82313.1| leucyl-tRNA synthetase [Bacillus cereus HuB4-4]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009442.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|EJS51461.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-2]
 gb|EJV84892.1| leucyl-tRNA synthetase [Bacillus cereus HuB1-1]
 gb|EPF15520.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-3]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009440.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|EEM93847.1| Leucyl-tRNA synthetase [Bacillus thuringiensis IBL 200]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_041052219.1| leucyl-tRNA synthetase [Paenibacillus sp. VKM B-2647]
 gb|KIL37926.1| leucyl-tRNA synthetase [Paenibacillus sp. VKM B-2647]
Length=818

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 98/118 (83%), Gaps = 2/118 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +N+E +  + Y    +EPKWQ++W+E KTF+TPD  D+ KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNKETRDSQGYNPQALEPKWQRYWDEHKTFKTPD--DSDKPKFYALDMFPYPSGAGLHVG  60

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T  NI+ FR
Sbjct  61   HPEGYTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYALQTGRHPRDITKENIDNFR  118



>ref|WP_000009444.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL79905.1| Leucyl-tRNA synthetase [Bacillus cereus AH1271]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_043935252.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|KIQ91613.1| leucyl-tRNA synthetase [Bacillus sp. L_1B0_5]
 gb|KIQ92963.1| leucyl-tRNA synthetase [Bacillus sp. L_1B0_8]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFR  108



>ref|WP_016116728.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP49380.1| leucyl-tRNA synthetase [Bacillus cereus VD136]
 gb|EOP64492.1| leucyl-tRNA synthetase [Bacillus cereus VDM006]
 gb|EOQ01727.1| leucyl-tRNA synthetase [Bacillus cereus VDM021]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_018782090.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|AIK40237.1| leucine--tRNA ligase [Bacillus mycoides]
 gb|AJI15204.1| leucine--tRNA ligase [Bacillus cereus]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_018764566.1| leucyl-tRNA synthetase [Bacillus sp. 105MF]
Length=802

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_006096266.1| leucyl-tRNA synthetase [Bacillus pseudomycoides]
 gb|EEM14852.1| Leucyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
Length=802

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_000009481.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJV58548.1| leucyl-tRNA synthetase [Bacillus cereus BAG6X1-1]
Length=802

 Score =   170 bits (430),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009474.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS73646.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-1]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_018970100.1| leucyl-tRNA synthetase [Rubritalea marina]
Length=872

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  269  RAYPFHEIEPKWQKFWEEKKTFRTPD----EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            + +PF   EPKWQ+ W++ KTFRT +    + D SKPKY+VLDMFPYPSGAGLHVGHP G
Sbjct  2    KPFPFDAFEPKWQQIWDDNKTFRTANPGDADFDASKPKYFVLDMFPYPSGAGLHVGHPEG  61

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDIL R+KRM G+NVLHPMGWDAFGLPAEQYAI+TG HPRITT +N+N FR
Sbjct  62   YTATDILGRYKRMNGFNVLHPMGWDAFGLPAEQYAIKTGQHPRITTEQNVNNFR  115



>ref|WP_000009475.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002145290.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ85759.1| leucyl-tRNA synthetase [Bacillus cereus HuA4-10]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002067653.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL68583.1| Leucyl-tRNA synthetase [Bacillus cereus AH603]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>gb|EJS78246.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-3]
Length=810

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  10   SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  67

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  68   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  116



>ref|WP_031213207.1| leucyl-tRNA synthetase, partial [Geobacillus sp. MAS1]
Length=475

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = +2

Query  287  EIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARF  466
            EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATDILAR 
Sbjct  7    EIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATDILARM  64

Query  467  KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  65   KRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_016095957.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOO17955.1| leucyl-tRNA synthetase [Bacillus cereus HuA3-9]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009463.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR42425.1| leucyl-tRNA synthetase [Bacillus cereus VD045]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_042875829.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|AIE81296.1| Leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_025148915.1| leucyl-tRNA synthetase [Bacillus sp. H1a]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_001971230.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EAL16276.1| leucyl-tRNA synthetase [Bacillus cereus G9241]
 gb|KDB42703.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|AIY73897.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJG92908.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJI06211.1| leucine--tRNA ligase [Bacillus cereus G9241]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009453.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM45626.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pakistani 
str. T13001]
 gb|EJR69723.1| leucyl-tRNA synthetase [Bacillus cereus VD154]
 gb|KIU76685.1| leucyl-tRNA ligase [Bacillus thuringiensis Sbt003]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009456.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|EEM20202.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar tochigiensis 
BGSC 4Y1]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009467.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM81494.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar huazhongensis 
BGSC 4BD1]
 gb|EJR17011.1| leucyl-tRNA synthetase [Bacillus cereus VD014]
 gb|EJR87069.1| leucyl-tRNA synthetase [Bacillus cereus VD156]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>gb|ABO68087.1| Leucyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
Length=811

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  8    SFNHREIEKKWQDYWEQHKTFRTPDESD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  65

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  66   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  114



>ref|WP_026690741.1| leucyl-tRNA synthetase [Bacillus aurantiacus]
Length=806

 Score =   169 bits (429),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            A+   +IEPKWQK+W+++KTF+T DEI   K K+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    AFNHKDIEPKWQKYWDQEKTFKTEDEI--GKEKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG HPR  T+ NI+ FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNHPRDFTLANIDTFR  108



>ref|WP_000009458.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM51249.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. T03a001]
 gb|EJQ17711.1| leucyl-tRNA synthetase [Bacillus cereus BAG3X2-2]
 gb|EJV92134.1| leucyl-tRNA synthetase [Bacillus cereus HD73]
 gb|AGE80626.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. HD73]
 gb|EOP17511.1| leucyl-tRNA synthetase [Bacillus cereus HuB13-1]
 gb|EOP57236.1| leucyl-tRNA synthetase [Bacillus cereus ISP2954]
 gb|EOP99438.1| leucyl-tRNA synthetase [Bacillus cereus BMG1.7]
 gb|ETE92899.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar aizawai 
str. Leapi01]
 gb|ETE96706.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar aizawai 
str. Hu4-2]
 gb|EXY09651.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|AHZ53583.1| leucyl-tRNA ligase [Bacillus thuringiensis serovar kurstaki str. 
YBT-1520]
 gb|KEH50727.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. HD-1]
 gb|AIE36011.1| leucyl-tRNA ligase [Bacillus thuringiensis serovar kurstaki str. 
HD-1]
 gb|AIM29596.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. YBT-1520]
 gb|AJA21928.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar galleriae]
 gb|AJK39544.1| leucine--tRNA ligase [Bacillus thuringiensis serovar kurstaki]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009480.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS73287.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-2]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009479.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK65298.1| Leucyl-tRNA synthetase [Bacillus cereus MM3]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009464.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK48336.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 10876]
 gb|KFL77693.1| leucine--tRNA ligase [Bacillus cereus ATCC 10876]
Length=802

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_020401766.1| leucyl-tRNA synthetase [Gracilimonas tropica]
Length=843

 Score =   170 bits (430),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 83/110 (75%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +2

Query  269  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  448
            ++Y   +IE KWQ++W E KTF+TP   DTSKPKYYVLDMFPYPSGAGLHVGHP GYTAT
Sbjct  2    QSYNPDKIESKWQQYWLENKTFKTP--TDTSKPKYYVLDMFPYPSGAGLHVGHPEGYTAT  59

Query  449  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            DI+AR+KRM G+NVLHP+GWDAFGLPAEQYA++TGTHPRITT +N+N+FR
Sbjct  60   DIIARYKRMNGFNVLHPIGWDAFGLPAEQYAVKTGTHPRITTEKNVNKFR  109



>ref|WP_008880943.1| MULTISPECIES: leucyl-tRNA synthetase [Geobacillus]
 sp|A4IRY3.2|SYL_GEOTN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Geobacillus thermodenitrificans NG80-2]
 gb|EDY05284.1| leucyl-tRNA synthetase [Geobacillus sp. G11MC16]
Length=805

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEQHKTFRTPDESD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_033844368.1| leucyl-tRNA synthetase [Geobacillus subterraneus]
Length=805

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPDEDD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_022488782.1| leucyl-tRNA synthetase [Clostridium sp. CAG:914]
 emb|CDE95292.1| leucine--tRNA ligase [Clostridium sp. CAG:914]
Length=796

 Score =   169 bits (428),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y + +IE KWQK+WEE KTF+T D  D S+PKYYVLDMFPYPSG GLH GHP GYTATDI
Sbjct  2    YNYTKIEKKWQKYWEENKTFKT-DIYDFSRPKYYVLDMFPYPSGVGLHAGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            +AR KRMQGYNVLHPMG+D+FGLPAEQYAI+TG HP+  T +NI  FR
Sbjct  61   MARMKRMQGYNVLHPMGYDSFGLPAEQYAIQTGNHPKEFTEKNIAHFR  108



>ref|WP_021996080.1| leucyl-tRNA synthetase [Clostridium sp. CAG:780]
 emb|CCZ17272.1| leucine--tRNA ligase [Clostridium sp. CAG:780]
Length=795

 Score =   169 bits (428),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            +Y F EIE KWQ +W+E KTF T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATD
Sbjct  2    SYNFREIEQKWQDYWDENKTFYT-DVWDFSKPKYYALDMFPYPSGQGLHVGHPEGYTATD  60

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I++R +RMQGYNVLHPMGWDAFGLPAEQYAI+TG HP   T +NI  F+
Sbjct  61   IVSRMRRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHPATFTQKNIETFK  109



>ref|WP_002087212.1| tRNA ligases class I domain protein [Leptospira interrogans]
 gb|EMG12808.1| tRNA ligases class I domain protein [Leptospira interrogans serovar 
Grippotyphosa str. LT2186]
Length=408

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFR  108



>ref|WP_022198807.1| leucyl-tRNA synthetase [Akkermansia muciniphila CAG:154]
 emb|CDB55961.1| leucine--tRNA ligase [Akkermansia muciniphila CAG:154]
Length=857

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVNNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT RNI+ FR
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFRNIDNFR  119



>ref|WP_021278651.1| leucyl-tRNA synthetase [Bacteriovorax sp. DB6_IX]
 gb|EQC49771.1| putative leucine--tRNA ligase [Bacteriovorax sp. DB6_IX]
Length=802

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIE KWQ +WEE +TF+T D  D SKPKYY LDMFP+PSGAGLHVGHP GYTATDI
Sbjct  3    YNFGEIEKKWQAYWEENETFKT-DSSDRSKPKYYALDMFPFPSGAGLHVGHPEGYTATDI  61

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            ++R+KRM GYNVLHPMGWD+FGLPAE YAI+TGTHP
Sbjct  62   MSRYKRMNGYNVLHPMGWDSFGLPAENYAIKTGTHP  97



>ref|WP_012420688.1| leucyl-tRNA synthetase [Akkermansia muciniphila]
 gb|ACD05473.1| leucyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835]
Length=857

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVNNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT RNI+ FR
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFRNIDNFR  119



>ref|WP_033020166.1| leucyl-tRNA synthetase [Geobacillus sp. G1w1]
 gb|KFX33470.1| leucyl-tRNA synthetase [Geobacillus sp. G1w1]
Length=805

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPDEDD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTRKNIDNFR  108



>ref|WP_007129371.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillales]
 gb|EHB65057.1| leucyl-tRNA synthetase [Paenibacillus lactis 154]
Length=813

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  251  EEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHP  430
            ++Q     Y    IEPKWQK+WEE KTF+T D  ++SKPK+Y LDMFPYPSGAGLHVGHP
Sbjct  3    DQQSAGHGYKPQVIEPKWQKYWEENKTFKTED--NSSKPKFYALDMFPYPSGAGLHVGHP  60

Query  431  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
             GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  TI+NIN FR
Sbjct  61   EGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGKHPREFTIQNINNFR  116



>ref|WP_042216922.1| leucyl-tRNA synthetase [Paenibacillus borealis]
 gb|AIQ60345.1| leucyl-tRNA synthetase [Paenibacillus borealis]
Length=815

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +N   Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNTFTQAHTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVG  60

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HP GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   HPEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  118



>ref|WP_022396714.1| leucyl-tRNA synthetase [Akkermansia sp. CAG:344]
 emb|CDD97137.1| leucine--tRNA ligase [Akkermansia sp. CAG:344]
Length=857

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  266  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  433
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVSNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  434  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT +NI+ FR
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFQNIDNFR  119



>ref|WP_000009477.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ56700.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X2-1]
Length=802

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_041901725.1| leucyl-tRNA synthetase [Marinimicrobia bacterium SCGC AAA160-B08]
Length=813

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AY    IEPKWQK+W + +TF+T    D+ KPKYYVLDMFPYPSG+GLHVGH LGY ATD
Sbjct  2    AYNHKAIEPKWQKYWSDNETFKT--GTDSEKPKYYVLDMFPYPSGSGLHVGHALGYVATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            I+ARFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP
Sbjct  60   IVARFKRMKGFNVLHPMGWDAFGLPAEQYAIKTGTHP  96



>ref|WP_042139488.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL P4-0081]
 gb|AIQ31815.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL P4-0081]
Length=815

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +N   Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNTFTQAHTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVG  60

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HP GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   HPEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  118



>gb|EMO76983.1| leucyl-tRNA synthetase, domain 2 [Leptospira kirschneri str. 
200801925]
Length=408

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFR  108



>ref|WP_022840507.1| MULTISPECIES: leucyl-tRNA synthetase [Marinimicrobia]
Length=813

 Score =   169 bits (427),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AY    IEPKWQK+W E +TF+T    D+ KPKYYVLDMFPYPSG+GLHVGH LGY ATD
Sbjct  2    AYNHKAIEPKWQKYWSENETFKT--GTDSEKPKYYVLDMFPYPSGSGLHVGHALGYVATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            I+AR+KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP
Sbjct  60   IVARYKRMKGFNVLHPMGWDAFGLPAEQYAIKTGTHP  96



>ref|WP_038595513.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL H7-0357]
 gb|AIQ19985.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL H7-0357]
Length=816

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
             Y    IEPKWQKFW+E KTF+T +  D+SKPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  13   GYRAQSIEPKWQKFWDENKTFKTGE--DSSKPKFYALDMFPYPSGAGLHVGHPEGYTATD  70

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  71   IVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  119



>ref|WP_002770420.1| leucyl-tRNA synthetase [Leptonema illini]
 gb|EHQ05616.1| leucyl-tRNA synthetase [Leptonema illini DSM 21528]
Length=888

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            +YPF  IE KWQ++WE++KTFRTP E D S+PKYYVLDMFPYPSG GLHVGHP GYTATD
Sbjct  2    SYPFSSIEKKWQEYWEKEKTFRTPPE-DPSRPKYYVLDMFPYPSGQGLHVGHPEGYTATD  60

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I+AR+KR +G+NVLHPMGWDAFGLPAE+YA++TG HP  TT +NI+ FR
Sbjct  61   IMARYKRQKGFNVLHPMGWDAFGLPAERYAMQTGIHPAETTKKNIDNFR  109



>ref|WP_000009443.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK76584.1| Leucyl-tRNA synthetase [Bacillus cereus R309803]
Length=802

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_044730524.1| leucyl-tRNA synthetase [Geobacillus kaustophilus]
 gb|KJE27545.1| leucine--tRNA ligase [Geobacillus kaustophilus]
Length=805

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_034640994.1| leucyl-tRNA synthetase [Bacillus manliponensis]
 gb|KEK18467.1| leucyl-tRNA synthetase [Bacillus manliponensis]
Length=802

 Score =   168 bits (426),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WE  KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQAYWEGNKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEQNINTFR  108



>ref|WP_044736817.1| leucyl-tRNA synthetase [Geobacillus kaustophilus]
Length=805

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_022476500.1| leucyl-tRNA synthetase [Clostridium sp. CAG:273]
 emb|CDE84625.1| leucine--tRNA ligase [Clostridium sp. CAG:273]
Length=798

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            AY F EIE KWQ  W+E+KTF+T D  D SKPK+Y LDMFPYPSG GLHVGHP GYTATD
Sbjct  2    AYNFKEIEKKWQDKWDEEKTFKT-DAWDFSKPKFYALDMFPYPSGQGLHVGHPEGYTATD  60

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I++R +RMQGYNVLHPMGWDAFGLPAEQYAI+TG HP   T +NI  F+
Sbjct  61   IISRMRRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHPETFTKKNIETFK  109



>ref|WP_002153010.1| putative leucine--tRNA ligase [Leptospira interrogans]
 gb|EMO27254.1| putative leucine--tRNA ligase [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=470

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFR  108



>ref|WP_013144426.1| leucyl-tRNA synthetase [Geobacillus sp. C56-T3]
 gb|ADI25698.1| leucyl-tRNA synthetase [Geobacillus sp. C56-T3]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_012843181.1| leucyl-tRNA synthetase [Rhodothermus marinus]
 gb|ACY47569.1| leucyl-tRNA synthetase [Rhodothermus marinus DSM 4252]
Length=906

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
             YPF E E KWQ++W+E K FRT  P E   D +KPKYYVLDMFPYPSGAGLHVGHP GY
Sbjct  3    GYPFKETEKKWQRYWDEHKIFRTAGPKEPGFDPNKPKYYVLDMFPYPSGAGLHVGHPEGY  62

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDI+AR++RM+GYNVLHPMGWDAFGLPAEQYAIET THPRITT RNI RFR
Sbjct  63   TATDIMARYRRMKGYNVLHPMGWDAFGLPAEQYAIETNTHPRITTERNITRFR  115



>ref|WP_033009813.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
 gb|KFL16260.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
 gb|KFX34249.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_013524386.1| MULTISPECIES: leucyl-tRNA synthetase [Geobacillus]
 gb|ACX77342.1| leucyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gb|ADU95256.1| leucyl-tRNA synthetase [Geobacillus sp. Y412MC52]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_000009478.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ16002.1| leucyl-tRNA synthetase [Bacillus cereus BAG3X2-1]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002112382.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJV65964.1| leucyl-tRNA synthetase [Bacillus cereus BAG6O-2]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_022226580.1| leucyl-tRNA synthetase [Clostridium sp. CAG:302]
 emb|CDB91880.1| leucine--tRNA ligase [Clostridium sp. CAG:302]
Length=796

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 74/96 (77%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F + E KWQ +WEE KTF+T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATDI
Sbjct  2    YNFRKTEKKWQDYWEENKTFKT-DTKDFSKPKYYALDMFPYPSGVGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            ++R KRMQGYNVLHPMGWDAFGLPAEQYA++TG HP
Sbjct  61   VSRMKRMQGYNVLHPMGWDAFGLPAEQYAVKTGNHP  96



>ref|WP_031407586.1| leucyl-tRNA synthetase [Geobacillus vulcani]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_044744755.1| leucyl-tRNA synthetase [Anoxybacillus sp. ATCC BAA-2555]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_033014546.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_033710716.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009438.1| leucyl-tRNA synthetase [Bacillus cereus]
 sp|B7IL05.1|SYL_BACC2 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus G9842]
 gb|ACK97313.1| leucyl-tRNA synthetase [Bacillus cereus G9842]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 80/109 (73%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGY VLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYKVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFR  108



>ref|WP_000009446.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS60728.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-3]
 gb|EOO71381.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-1]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_044737514.1| leucyl-tRNA synthetase [Bacillus mycoides]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002143462.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ65840.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-4]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_021322703.1| leucyl-tRNA synthetase [Geobacillus sp. A8]
 gb|EQB94236.1| leucyl-tRNA synthetase [Geobacillus sp. A8]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_012261857.1| leucyl-tRNA synthetase [Bacillus weihenstephanensis]
 sp|A9VLA2.1|SYL_BACWK RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus weihenstephanensis KBAB4]
 gb|ABY45726.1| leucyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002184798.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS08645.1| leucyl-tRNA synthetase [Bacillus cereus VDM022]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_016130370.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP49726.1| leucyl-tRNA synthetase [Bacillus cereus VDM053]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_000009447.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL85725.1| Leucyl-tRNA synthetase [Bacillus cereus AH1272]
 gb|EEL91530.1| Leucyl-tRNA synthetase [Bacillus cereus AH1273]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002015698.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK71094.1| Leucyl-tRNA synthetase [Bacillus cereus AH621]
 gb|EJR39917.1| leucyl-tRNA synthetase [Bacillus cereus VD048]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002034430.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL03911.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 dbj|GAE40279.1| leucine--tRNA ligase [Bacillus weihenstephanensis NBRC 101238 
= DSM 11821]
 gb|AIW82827.1| leucine--tRNA ligase [Bacillus weihenstephanensis]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002167530.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR44606.1| leucyl-tRNA synthetase [Bacillus cereus VD078]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_002129511.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL97199.1| Leucyl-tRNA synthetase [Bacillus mycoides DSM 2048]
 gb|EJQ57590.1| leucyl-tRNA synthetase [Bacillus cereus CER057]
 gb|EJQ69858.1| leucyl-tRNA synthetase [Bacillus cereus CER074]
 gb|EJV62308.1| leucyl-tRNA synthetase [Bacillus cereus BtB2-4]
 gb|EJV79211.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-1]
 gb|EOO17698.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-9]
 gb|EOO36188.1| leucyl-tRNA synthetase [Bacillus cereus VDM019]
 gb|EOP34014.1| leucyl-tRNA synthetase [Bacillus cereus VD146]
 gb|ETT70065.1| leucyl-tRNA ligase [Bacillus weihenstephanensis FSL H7-687]
 gb|KEZ81287.1| leucyl-tRNA synthetase [Bacillus weihenstephanensis]
 gb|AJH22129.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_011232314.1| leucyl-tRNA synthetase [Geobacillus kaustophilus]
 sp|Q5KW09.1|SYL_GEOKA RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Geobacillus kaustophilus HTA426]
 dbj|BAD77127.1| leucyl-tRNA synthetase [Geobacillus kaustophilus HTA426]
Length=805

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_016102930.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EOO69552.1| leucyl-tRNA synthetase [Bacillus cereus VD021]
 gb|KIV67767.1| Leucyl-tRNA synthetase [Bacillus mycoides]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>gb|EJQ50297.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X1-1]
 gb|EJQ99708.1| leucyl-tRNA synthetase [Bacillus cereus MC67]
 gb|EOP04772.1| leucyl-tRNA synthetase [Bacillus cereus MC118]
Length=810

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  10   SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  67

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  68   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  116



>ref|WP_002190950.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS02860.1| leucyl-tRNA synthetase [Bacillus cereus VDM034]
 gb|EJS15977.1| leucyl-tRNA synthetase [Bacillus cereus VDM062]
Length=802

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_022029418.1| leucyl-tRNA synthetase [Clostridium sp. CAG:762]
 emb|CCZ57092.1| leucine--tRNA ligase [Clostridium sp. CAG:762]
Length=796

 Score =   167 bits (424),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F ++E KW K+W+E +TF+T D  D SKPKYYVLDMFPYPSG GLH GHP GYTATDI
Sbjct  2    YNFRKVEKKWIKYWDEHETFKT-DIHDFSKPKYYVLDMFPYPSGVGLHAGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            +AR KRMQGYNVLHPMGWDAFGLPAEQYAI TG HP   T  NI  F+
Sbjct  61   IARMKRMQGYNVLHPMGWDAFGLPAEQYAITTGNHPSSFTSENIKTFK  108



>ref|WP_002136312.1| putative leucine--tRNA ligase [Leptospira interrogans]
 gb|EMY25325.1| putative leucine--tRNA ligase [Leptospira interrogans serovar 
Australis str. 200703203]
Length=471

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFR  108



>ref|WP_002089088.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJP87997.1| leucyl-tRNA synthetase [Bacillus cereus VD142]
Length=802

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFR  108



>ref|WP_027091186.1| leucyl-tRNA synthetase [Cohnella thermotolerans]
Length=810

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +2

Query  257  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  436
            Q     Y    +EPKWQK+WEE KTFRT D  D  KPK+Y LDMFPYPSGAGLHVGHP G
Sbjct  3    QDNEHGYKPQTLEPKWQKYWEENKTFRTRD--DEGKPKFYALDMFPYPSGAGLHVGHPEG  60

Query  437  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            YTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYAI+TG HPR  T  NI+ FR
Sbjct  61   YTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAIQTGKHPRDFTQLNIDNFR  114



>ref|WP_039300930.1| leucyl-tRNA synthetase [Paenibacillus sp. IHB B 3415]
 gb|KHL94606.1| leucyl-tRNA synthetase [Paenibacillus sp. IHB B 3415]
Length=813

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  248  NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGH  427
            ++  Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVGH
Sbjct  2    SDNTQAPTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVGH  59

Query  428  PLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            P GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  60   PEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  116



>ref|WP_039876233.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0273]
 gb|AIQ48846.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0273]
Length=816

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  245  ENEEQQVRRA-YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  421
            EN+   V  A Y    IEPKWQKFW+E KTF+T ++ D  KPK+Y LDMFPYPSGAGLHV
Sbjct  3    ENQTSTVAGAGYRAQTIEPKWQKFWDENKTFKTGEDAD--KPKFYALDMFPYPSGAGLHV  60

Query  422  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GHP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   GHPEGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  119



>ref|WP_033674310.1| leucyl-tRNA synthetase [Bacillus gaemokensis]
 gb|KEK24543.1| leucyl-tRNA synthetase [Bacillus gaemokensis]
Length=802

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KR QGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRAQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_042267319.1| leucyl-tRNA synthetase [Paenibacillus graminis]
 gb|AIQ70571.1| leucyl-tRNA synthetase [Paenibacillus graminis]
Length=815

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +2

Query  245  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  424
            +N        Y    IEPKWQKFW+E KTF+T +  D  KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNNTTSTASGYRAQTIEPKWQKFWDENKTFKTGE--DAGKPKFYALDMFPYPSGAGLHVG  60

Query  425  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            HP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   HPEGYTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPREITFKNIDNFR  118



>ref|WP_036732290.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-277]
 gb|ETT58964.1| leucyl-tRNA ligase [Paenibacillus sp. FSL R7-277]
Length=809

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
             Y    IEPKWQKFW+E KTF+T +E  + KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  6    GYRAQTIEPKWQKFWDENKTFKTSEE--SGKPKFYALDMFPYPSGAGLHVGHPEGYTATD  63

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  64   IVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  112



>ref|WP_003208770.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|EEM09208.1| Leucyl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gb|KFN13831.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE  KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEGNKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_003201345.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|EEM03550.1| Leucyl-tRNA synthetase [Bacillus mycoides Rock1-4]
Length=802

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE  KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEGNKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFR  108



>ref|WP_014681197.1| leucyl-tRNA synthetase [Solitalea canadensis]
 gb|AFD07970.1| leucyl-tRNA synthetase [Solitalea canadensis DSM 3403]
Length=947

 Score =   169 bits (427),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y F EIE KWQKFW + KTF+   +ID++KPKYYVLDMFPYPSGAGLHVGHPLGY A+DI
Sbjct  3    YSFREIEKKWQKFWADNKTFKV--DIDSNKPKYYVLDMFPYPSGAGLHVGHPLGYIASDI  60

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
              RFK+++G+NVLHPMG+DAFGLPAEQYAI+TG HP ITT +N  R+R
Sbjct  61   FTRFKKLKGFNVLHPMGYDAFGLPAEQYAIQTGQHPAITTDQNTKRYR  108



>ref|WP_042201037.1| leucyl-tRNA synthetase [Paenibacillus sp. G4]
Length=816

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  245  ENEEQQVRRA-YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  421
            EN+   V  A Y    IEPKWQKFW+E KTF+T ++ D  KPK+Y LDMFPYPSGAGLHV
Sbjct  3    ENQTTTVAGAGYRAQTIEPKWQKFWDENKTFKTGEDAD--KPKFYALDMFPYPSGAGLHV  60

Query  422  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            GHP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  61   GHPEGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  119



>ref|WP_019909144.1| leucyl-tRNA synthetase [Paenibacillus sp. HW567]
Length=816

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  260  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  439
            + +  Y    IEPKWQKFW+E KTF+T +  D  KPK+Y LDMFPYPSGAGLHVGHP GY
Sbjct  9    EAQAGYRAQTIEPKWQKFWDENKTFKTGE--DAGKPKFYALDMFPYPSGAGLHVGHPEGY  66

Query  440  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            TATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T++NIN FR
Sbjct  67   TATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITVKNINNFR  119



>ref|WP_025949565.1| leucyl-tRNA synthetase [Geobacillus thermocatenulatus]
Length=805

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKHKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFR  108



>ref|WP_037290055.1| leucyl-tRNA synthetase [Saccharibacillus sacchari]
Length=817

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = +2

Query  248  NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGH  427
            NE+      Y    IEPKWQ+ W+E+KTF+T D++D SKPK+Y +DMFPYPSGAGLHVGH
Sbjct  5    NEQGAAASGYRAQTIEPKWQQKWDEEKTFKT-DDMDHSKPKFYAMDMFPYPSGAGLHVGH  63

Query  428  PLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            P GYTATDI++R+KRMQG+NV+HPMGWDAFGLPAEQYAI+ G HPR  T++NIN FR
Sbjct  64   PEGYTATDIVSRYKRMQGFNVMHPMGWDAFGLPAEQYAIDNGGHPREFTLKNINTFR  120



>gb|EZZ18391.1| leucyl-tRNA synthetase, partial [Staphylococcus aureus Sau 74]
Length=124

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y  ++IE KWQ +W+E KTF+T D +   + K+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  4    YNHNQIEKKWQDYWDENKTFKTNDNL--GQKKFYALDMFPYPSGAGLHVGHPEGYTATDI  61

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  562
            ++R+KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P
Sbjct  62   ISRYKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDP  97



>gb|EQC75802.1| Leucyl-tRNA synthetase [Streptococcus sp. HSISS3]
Length=311

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  275  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  454
            Y   EIEPKWQK+W +  TF+T    D SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  4    YNHKEIEPKWQKYWADNHTFKTG--TDASKPKFYALDMFPYPSGAGLHVGHPEGYTATDI  61

Query  455  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            L+RFKR QGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NI  F+
Sbjct  62   LSRFKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFK  109



>ref|WP_042238641.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R5-0912]
 gb|AIQ43116.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R5-0912]
Length=815

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +2

Query  272  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  451
             Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  12   GYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVGHPEGYTATD  69

Query  452  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  598
            I++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR
Sbjct  70   IVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFR  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510