BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS116A02

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362741.1|  PREDICTED: protein argonaute 4-like                286   2e-87   Solanum tuberosum [potatoes]
ref|XP_009622314.1|  PREDICTED: protein argonaute 4-like                285   7e-87   Nicotiana tomentosiformis
gb|ABC61505.1|  AGO4-2                                                  285   9e-87   Nicotiana benthamiana
ref|XP_009785001.1|  PREDICTED: protein argonaute 4-like                283   3e-86   Nicotiana sylvestris
ref|XP_006347268.1|  PREDICTED: protein argonaute 4-like isoform X1     283   3e-86   Solanum tuberosum [potatoes]
ref|NP_001289847.1|  uncharacterized protein LOC101246148               281   2e-85   Solanum lycopersicum
ref|NP_001266156.1|  uncharacterized protein LOC101256023               280   5e-85   Solanum lycopersicum
ref|XP_011080473.1|  PREDICTED: protein argonaute 4                     273   2e-82   Sesamum indicum [beniseed]
gb|AGS47791.1|  argonaute 4                                             271   7e-82   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009591976.1|  PREDICTED: protein argonaute 4                     269   6e-81   Nicotiana tomentosiformis
ref|XP_011090194.1|  PREDICTED: protein argonaute 4-like                269   8e-81   Sesamum indicum [beniseed]
gb|ABC61504.1|  AGO4-1                                                  267   3e-80   Nicotiana benthamiana
ref|XP_009773871.1|  PREDICTED: protein argonaute 4                     266   5e-80   Nicotiana sylvestris
gb|EYU46161.1|  hypothetical protein MIMGU_mgv1a000944mg                262   4e-78   Erythranthe guttata [common monkey flower]
ref|XP_004149653.1|  PREDICTED: protein argonaute 4-like                257   1e-76   
ref|XP_008449865.1|  PREDICTED: protein argonaute 4                     257   2e-76   Cucumis melo [Oriental melon]
ref|XP_004165479.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...    257   2e-76   
ref|XP_002527764.1|  eukaryotic translation initiation factor 2c,...    256   3e-76   Ricinus communis
ref|XP_002275928.1|  PREDICTED: protein argonaute 4                     255   8e-76   Vitis vinifera
gb|AGS47796.1|  argonaute 9                                             255   9e-76   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010093806.1|  hypothetical protein L484_022518                   237   3e-75   
ref|XP_006369389.1|  hypothetical protein POPTR_0001s22710g             253   5e-75   
ref|XP_007016688.1|  Argonaute family protein isoform 1                 252   8e-75   
ref|XP_006369390.1|  Argonaute 4 family protein                         252   9e-75   Populus trichocarpa [western balsam poplar]
gb|KDP45657.1|  hypothetical protein JCGZ_17264                         252   9e-75   Jatropha curcas
ref|XP_010689361.1|  PREDICTED: protein argonaute 4                     252   1e-74   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP09667.1|  unnamed protein product                                250   5e-74   Coffea canephora [robusta coffee]
ref|XP_011006053.1|  PREDICTED: protein argonaute 4-like                250   6e-74   Populus euphratica
ref|XP_004241389.1|  PREDICTED: protein argonaute 4-like                250   6e-74   
gb|KCW87286.1|  hypothetical protein EUGRSUZ_B03780                     248   2e-73   Eucalyptus grandis [rose gum]
ref|XP_010045128.1|  PREDICTED: protein argonaute 4-like                248   3e-73   Eucalyptus grandis [rose gum]
ref|XP_010031652.1|  PREDICTED: protein argonaute 4-like                244   1e-71   Eucalyptus grandis [rose gum]
gb|KCW51008.1|  hypothetical protein EUGRSUZ_J00634                     243   2e-71   Eucalyptus grandis [rose gum]
gb|KHN37954.1|  Protein argonaute 4                                     243   3e-71   Glycine soja [wild soybean]
ref|XP_003555656.1|  PREDICTED: protein argonaute 4 isoform X1          242   4e-71   Glycine max [soybeans]
ref|XP_006605639.1|  PREDICTED: protein argonaute 4 isoform X2          243   4e-71   Glycine max [soybeans]
gb|KHG16394.1|  Protein argonaute 4 -like protein                       242   4e-71   Gossypium arboreum [tree cotton]
gb|KDO66364.1|  hypothetical protein CISIN_1g0024491mg                  239   6e-71   Citrus sinensis [apfelsine]
gb|KJB26170.1|  hypothetical protein B456_004G228100                    241   1e-70   Gossypium raimondii
gb|KDO66363.1|  hypothetical protein CISIN_1g0024491mg                  239   1e-70   Citrus sinensis [apfelsine]
ref|XP_004491186.1|  PREDICTED: protein argonaute 4-like isoform X1     240   2e-70   Cicer arietinum [garbanzo]
gb|KDO66362.1|  hypothetical protein CISIN_1g0024491mg                  239   3e-70   Citrus sinensis [apfelsine]
gb|ACZ04920.1|  argonaute 4-like protein                                240   3e-70   Pelargonium x hortorum [bedding geranium]
gb|KDO66360.1|  hypothetical protein CISIN_1g0024491mg                  239   4e-70   Citrus sinensis [apfelsine]
ref|XP_006470434.1|  PREDICTED: protein argonaute 4-like                239   6e-70   Citrus sinensis [apfelsine]
ref|XP_006446389.1|  hypothetical protein CICLE_v10014186mg             239   6e-70   Citrus clementina [clementine]
ref|XP_007146204.1|  hypothetical protein PHAVU_006G021200g             238   1e-69   Phaseolus vulgaris [French bean]
ref|XP_010653696.1|  PREDICTED: protein argonaute 4A-like               236   8e-69   Vitis vinifera
ref|XP_007207224.1|  hypothetical protein PRUPE_ppa000990mg             236   1e-68   Prunus persica
ref|XP_008231109.1|  PREDICTED: protein argonaute 4                     236   1e-68   Prunus mume [ume]
ref|XP_008363553.1|  PREDICTED: protein argonaute 4-like                234   2e-68   
ref|XP_009339636.1|  PREDICTED: protein argonaute 4-like                234   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_002323196.2|  hypothetical protein POPTR_0016s02480g             233   5e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002308843.1|  hypothetical protein POPTR_0006s02680g             233   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006293644.1|  hypothetical protein CARUB_v10022599mg             233   1e-67   Capsella rubella
gb|KJB56072.1|  hypothetical protein B456_009G105600                    229   2e-67   Gossypium raimondii
ref|XP_003617094.1|  Protein argonaute 4                                232   2e-67   
ref|XP_003617096.1|  Protein argonaute 4                                231   3e-67   
ref|XP_003617095.1|  Protein argonaute 4                                231   3e-67   
emb|CBI32885.3|  unnamed protein product                                231   4e-67   Vitis vinifera
gb|KJB56075.1|  hypothetical protein B456_009G105600                    230   7e-67   Gossypium raimondii
ref|XP_010520483.1|  PREDICTED: protein argonaute 4-like                230   7e-67   Tarenaya hassleriana [spider flower]
ref|XP_011041311.1|  PREDICTED: protein argonaute 4A-like               230   8e-67   Populus euphratica
gb|KJB56074.1|  hypothetical protein B456_009G105600                    230   8e-67   Gossypium raimondii
gb|KJB56071.1|  hypothetical protein B456_009G105600                    230   1e-66   Gossypium raimondii
gb|KJB56073.1|  hypothetical protein B456_009G105600                    229   1e-66   Gossypium raimondii
gb|KEH35100.1|  eukaryotic translation initiation factor 2c, puta...    229   2e-66   Medicago truncatula
ref|XP_002880875.1|  hypothetical protein ARALYDRAFT_481584             229   2e-66   
gb|KHN38433.1|  Protein argonaute 4                                     228   3e-66   Glycine soja [wild soybean]
ref|NP_565633.1|  argonaute 4                                           229   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510823.1|  PREDICTED: protein argonaute 4                     228   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009103572.1|  PREDICTED: protein argonaute 4-like                228   6e-66   Brassica rapa
ref|XP_004501969.1|  PREDICTED: protein argonaute 4-like                228   6e-66   Cicer arietinum [garbanzo]
ref|XP_011461779.1|  PREDICTED: protein argonaute 4-like                228   7e-66   Fragaria vesca subsp. vesca
ref|XP_002527383.1|  eukaryotic translation initiation factor 2c,...    227   8e-66   Ricinus communis
emb|CDY56413.1|  BnaC04g54830D                                          227   1e-65   Brassica napus [oilseed rape]
ref|XP_003545462.1|  PREDICTED: protein argonaute 4-like                226   1e-65   Glycine max [soybeans]
ref|XP_010417848.1|  PREDICTED: protein argonaute 4-like                226   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006408675.1|  hypothetical protein EUTSA_v10001902mg             226   2e-65   Eutrema salsugineum [saltwater cress]
emb|CDY04475.1|  BnaA07g13010D                                          226   2e-65   
gb|KHG11406.1|  Protein argonaute 4 -like protein                       226   2e-65   Gossypium arboreum [tree cotton]
ref|XP_011040669.1|  PREDICTED: protein argonaute 4A-like               226   2e-65   Populus euphratica
ref|XP_010473093.1|  PREDICTED: protein argonaute 4                     226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008385629.1|  PREDICTED: protein argonaute 4                     226   3e-65   
ref|XP_009345605.1|  PREDICTED: protein argonaute 4-like                226   3e-65   Pyrus x bretschneideri [bai li]
ref|XP_003519489.1|  PREDICTED: protein argonaute 4-like                226   3e-65   Glycine max [soybeans]
ref|XP_010521596.1|  PREDICTED: protein argonaute 4                     225   5e-65   Tarenaya hassleriana [spider flower]
emb|CDY48192.1|  BnaA04g15560D                                          219   1e-62   Brassica napus [oilseed rape]
ref|XP_009140756.1|  PREDICTED: protein argonaute 4                     217   4e-62   Brassica rapa
ref|XP_007141565.1|  hypothetical protein PHAVU_008G206600g             216   1e-61   Phaseolus vulgaris [French bean]
ref|XP_007141564.1|  hypothetical protein PHAVU_008G206600g             216   1e-61   Phaseolus vulgaris [French bean]
emb|CDX77061.1|  BnaC04g38560D                                          214   3e-61   
ref|XP_007141563.1|  hypothetical protein PHAVU_008G206500g             214   6e-61   Phaseolus vulgaris [French bean]
ref|XP_003592510.1|  Protein argonaute 4A                               213   7e-61   
gb|KEH26048.1|  eukaryotic translation initiation factor 2c, puta...    213   7e-61   Medicago truncatula
ref|XP_006400685.1|  hypothetical protein EUTSA_v10012624mg             213   9e-61   Eutrema salsugineum [saltwater cress]
ref|XP_011091875.1|  PREDICTED: protein argonaute 4A-like               212   2e-60   Sesamum indicum [beniseed]
ref|XP_009126507.1|  PREDICTED: protein argonaute 9-like                209   2e-59   Brassica rapa
emb|CDY09103.1|  BnaA02g05290D                                          209   2e-59   Brassica napus [oilseed rape]
emb|CDP19981.1|  unnamed protein product                                208   6e-59   Coffea canephora [robusta coffee]
gb|AGS47795.1|  argonaute 8                                             207   1e-58   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002310956.1|  hypothetical protein POPTR_0008s01100g             207   1e-58   
gb|EYU42905.1|  hypothetical protein MIMGU_mgv1a001084mg                207   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_009120721.1|  PREDICTED: protein argonaute 9-like                207   1e-58   
ref|XP_009801790.1|  PREDICTED: protein argonaute 4A-like               206   3e-58   Nicotiana sylvestris
ref|XP_006347690.1|  PREDICTED: protein argonaute 4-like                205   5e-58   Solanum tuberosum [potatoes]
ref|XP_011032992.1|  PREDICTED: protein argonaute 4A-like               206   5e-58   Populus euphratica
ref|XP_006432529.1|  hypothetical protein CICLE_v10003971mg             204   5e-58   
ref|XP_010493237.1|  PREDICTED: protein argonaute 9-like isoform X3     204   7e-58   
gb|KDO53795.1|  hypothetical protein CISIN_1g0026362mg                  204   8e-58   Citrus sinensis [apfelsine]
ref|XP_010673246.1|  PREDICTED: protein argonaute 4-like                204   8e-58   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAC42876.1|  putative zwille/pinhead                                195   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266010.1|  uncharacterized protein LOC101248049               204   1e-57   Solanum lycopersicum
ref|XP_010323741.1|  PREDICTED: uncharacterized protein LOC101248...    204   1e-57   
emb|CDX92405.1|  BnaA10g14440D                                          204   1e-57   
ref|XP_010493236.1|  PREDICTED: protein argonaute 9-like isoform X2     204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010493235.1|  PREDICTED: protein argonaute 9-like isoform X1     204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007016691.1|  Argonaute family protein isoform 4                 202   2e-57   
ref|XP_007016692.1|  Argonaute family protein isoform 5                 202   3e-57   
ref|XP_006471315.1|  PREDICTED: protein argonaute 4B-like               205   3e-57   
ref|XP_009416373.1|  PREDICTED: protein argonaute 4B-like               202   6e-57   
ref|XP_007016690.1|  Argonaute family protein isoform 3                 201   7e-57   
emb|CDY16595.1|  BnaC09g36780D                                          202   1e-56   Brassica napus [oilseed rape]
ref|XP_007220876.1|  hypothetical protein PRUPE_ppa017623mg             201   1e-56   Prunus persica
ref|XP_008231753.1|  PREDICTED: protein argonaute 4A-like               201   2e-56   Prunus mume [ume]
gb|AIO05706.1|  putative argonaute 4                                    199   4e-56   Cocos nucifera
ref|XP_002871971.1|  PAZ domain-containing protein                      199   6e-56   
ref|XP_008231754.1|  PREDICTED: protein argonaute 4A-like               199   6e-56   
ref|XP_010420963.1|  PREDICTED: protein argonaute 9                     199   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009590319.1|  PREDICTED: protein argonaute 4A-like               198   2e-55   Nicotiana tomentosiformis
gb|AET00057.2|  eukaryotic translation initiation factor 2c, puta...    197   6e-55   Medicago truncatula
ref|NP_197613.2|  argonaute 9                                           196   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CAD66636.1|  ARGONAUTE9 protein                                     196   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAO73892.1|  PAZ (Piwi Argonaut and Zwille) family                   196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219668.1|  hypothetical protein PRUPE_ppa025242mg             195   2e-54   
emb|CAH65970.1|  H0820C10.3                                             194   4e-54   Oryza sativa [red rice]
ref|XP_008805346.1|  PREDICTED: protein argonaute 4B-like isoform X2    194   4e-54   
ref|NP_001052115.1|  Os04g0151800                                       194   4e-54   
ref|XP_008375403.1|  PREDICTED: protein argonaute 4A-like               194   7e-54   Malus domestica [apple tree]
ref|XP_008805343.1|  PREDICTED: protein argonaute 4B-like isoform X1    194   8e-54   Phoenix dactylifera
ref|XP_010251689.1|  PREDICTED: protein argonaute 4A                    194   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010943265.1|  PREDICTED: protein argonaute 4B-like               193   2e-53   Elaeis guineensis
ref|XP_008778689.1|  PREDICTED: protein argonaute 4B-like               193   2e-53   Phoenix dactylifera
ref|XP_006287018.1|  hypothetical protein CARUB_v10000166mg             193   2e-53   
ref|XP_002264978.1|  PREDICTED: protein argonaute 4A-like               188   7e-52   
ref|XP_006652094.1|  PREDICTED: protein argonaute 4B-like               188   7e-52   Oryza brachyantha
emb|CDY59516.1|  BnaCnng35060D                                          188   1e-51   Brassica napus [oilseed rape]
ref|NP_001169445.1|  argonaute104                                       184   3e-51   
gb|AFW79428.1|  argonaute104                                            184   8e-51   
ref|XP_009120723.1|  PREDICTED: protein argonaute 9-like                185   1e-50   Brassica rapa
emb|CDX92406.1|  BnaA10g14450D                                          185   1e-50   
ref|XP_008648109.1|  PREDICTED: argonaute104 isoform X5                 184   3e-50   
ref|XP_008648108.1|  PREDICTED: argonaute104 isoform X4                 184   3e-50   
ref|XP_008648107.1|  PREDICTED: argonaute104 isoform X3                 184   3e-50   
ref|XP_008648106.1|  PREDICTED: argonaute104 isoform X2                 184   3e-50   Zea mays [maize]
ref|XP_006644052.1|  PREDICTED: protein argonaute 4A-like               184   4e-50   Oryza brachyantha
ref|XP_008648104.1|  PREDICTED: argonaute104 isoform X1                 184   4e-50   
emb|CBI40895.3|  unnamed protein product                                183   4e-50   Vitis vinifera
ref|NP_001167850.1|  putative argonaute family protein                  183   7e-50   Zea mays [maize]
ref|XP_004967701.1|  PREDICTED: protein argonaute 4A-like               182   1e-49   Setaria italica
emb|CAN61334.1|  hypothetical protein VITISV_044457                     181   2e-49   Vitis vinifera
ref|NP_001042722.1|  Os01g0275600                                       181   2e-49   
ref|XP_010694897.1|  PREDICTED: protein argonaute 4A-like               181   3e-49   
ref|XP_004308183.1|  PREDICTED: protein argonaute 4A-like               181   5e-49   Fragaria vesca subsp. vesca
ref|XP_003617098.1|  Protein argonaute 4A                               181   6e-49   
ref|XP_002440386.1|  hypothetical protein SORBIDRAFT_09g030910          178   3e-48   Sorghum bicolor [broomcorn]
gb|EAZ11412.1|  hypothetical protein OsJ_01273                          167   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960964.1|  PREDICTED: protein argonaute 4B-like isoform X2    177   5e-48   
gb|EMS68540.1|  Protein argonaute 4A                                    178   5e-48   Triticum urartu
gb|AGB34311.1|  Argonaute                                               178   5e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004960963.1|  PREDICTED: protein argonaute 4B-like isoform X1    177   7e-48   Setaria italica
gb|AGO99010.1|  argonaute 4                                             178   7e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010252577.1|  PREDICTED: protein argonaute 16 isoform X2         176   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010252575.1|  PREDICTED: protein argonaute 16 isoform X1         176   2e-47   Nelumbo nucifera [Indian lotus]
gb|EEC70394.1|  hypothetical protein OsI_01365                          175   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008347021.1|  PREDICTED: protein argonaute 4B-like               169   2e-47   
ref|XP_010230772.1|  PREDICTED: protein argonaute 4A                    176   4e-47   Brachypodium distachyon [annual false brome]
ref|XP_008803511.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...    173   2e-46   
ref|XP_002874028.1|  PAZ domain-containing protein                      172   4e-46   
ref|XP_010943243.1|  PREDICTED: protein argonaute 16-like               171   9e-46   Elaeis guineensis
dbj|BAC84805.1|  putative ARGONAUTE9 protein                            168   1e-44   Oryza sativa Japonica Group [Japonica rice]
sp|Q6YSJ5.2|AGO16_ORYSJ  RecName: Full=Protein argonaute 16; Shor...    168   1e-44   Oryza sativa Japonica Group [Japonica rice]
emb|CDY16587.1|  BnaC09g36860D                                          168   1e-44   Brassica napus [oilseed rape]
ref|XP_004298218.1|  PREDICTED: protein argonaute 4A-like               166   1e-43   Fragaria vesca subsp. vesca
ref|XP_008375508.1|  PREDICTED: protein argonaute 4A-like               166   2e-43   
gb|EAZ11413.1|  hypothetical protein OsJ_01274                          165   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289242.1|  hypothetical protein CARUB_v10002706mg             164   2e-43   
ref|XP_008449486.1|  PREDICTED: protein argonaute 16                    165   3e-43   Cucumis melo [Oriental melon]
ref|XP_010657243.1|  PREDICTED: protein argonaute 16                    164   3e-43   Vitis vinifera
ref|XP_010497367.1|  PREDICTED: protein argonaute 8-like                155   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009418523.1|  PREDICTED: protein argonaute 16-like               164   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD81109.1|  zwille protein -like                                   163   6e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003598353.1|  Protein argonaute 4A                               163   6e-43   Medicago truncatula
sp|Q5NBN9.2|AGO15_ORYSJ  RecName: Full=Protein argonaute 15; Shor...    163   7e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002320489.2|  PAZ domain-containing family protein               163   8e-43   
gb|EMT20780.1|  Protein argonaute 4A                                    164   1e-42   
ref|XP_003576965.2|  PREDICTED: protein argonaute 16                    163   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_010035502.1|  PREDICTED: protein argonaute 16-like               162   1e-42   Eucalyptus grandis [rose gum]
gb|EEC70395.1|  hypothetical protein OsI_01366                          162   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_004956340.1|  PREDICTED: protein argonaute 16-like isoform X1    161   4e-42   Setaria italica
gb|KDP30816.1|  hypothetical protein JCGZ_13759                         161   6e-42   Jatropha curcas
ref|XP_011007758.1|  PREDICTED: protein argonaute 16                    160   8e-42   Populus euphratica
gb|KDO59555.1|  hypothetical protein CISIN_1g002661mg                   160   9e-42   Citrus sinensis [apfelsine]
ref|XP_004156089.1|  PREDICTED: protein argonaute 16-like               160   1e-41   
ref|XP_004140126.1|  PREDICTED: protein argonaute 16-like               160   1e-41   Cucumis sativus [cucumbers]
emb|CBI28870.3|  unnamed protein product                                160   1e-41   Vitis vinifera
gb|KDO59554.1|  hypothetical protein CISIN_1g002661mg                   160   1e-41   Citrus sinensis [apfelsine]
gb|EMS52455.1|  Protein argonaute 4B                                    160   2e-41   Triticum urartu
ref|XP_007049194.1|  Eukaryotic translation initiation factor 2c,...    159   2e-41   
ref|XP_007049195.1|  Eukaryotic translation initiation factor 2c,...    159   2e-41   
gb|AGO99012.1|  argonaute 4                                             158   6e-41   Triticum aestivum [Canadian hard winter wheat]
gb|EMT11809.1|  Protein argonaute 4B                                    158   1e-40   
ref|XP_006447659.1|  hypothetical protein CICLE_v10014201mg             157   1e-40   
tpg|DAA60814.1|  TPA: putative argonaute family protein                 156   1e-40   
ref|XP_006447661.1|  hypothetical protein CICLE_v10014201mg             157   1e-40   
ref|XP_006447660.1|  hypothetical protein CICLE_v10014201mg             157   1e-40   
ref|XP_008651670.1|  PREDICTED: uncharacterized protein LOC100382...    157   1e-40   Zea mays [maize]
ref|XP_008651669.1|  PREDICTED: uncharacterized protein LOC100382...    157   1e-40   Zea mays [maize]
ref|XP_008651671.1|  PREDICTED: uncharacterized protein LOC100382...    157   2e-40   Zea mays [maize]
ref|XP_006661042.1|  PREDICTED: protein argonaute 16-like               156   2e-40   
gb|EEE66926.1|  hypothetical protein OsJ_23783                          155   5e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81834.1|  hypothetical protein OsI_25587                          155   6e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003567769.1|  PREDICTED: protein argonaute 4B-like               155   8e-40   Brachypodium distachyon [annual false brome]
gb|AHC30882.1|  argonaute 6 protein                                     154   2e-39   Dimocarpus longan [longan]
ref|XP_010035500.1|  PREDICTED: protein argonaute 16-like               153   3e-39   
gb|KCW46921.1|  hypothetical protein EUGRSUZ_K00736                     153   3e-39   Eucalyptus grandis [rose gum]
gb|EYU42875.1|  hypothetical protein MIMGU_mgv1a001065mg                153   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_011100483.1|  PREDICTED: protein argonaute 16 isoform X2         152   6e-39   
gb|EMS52406.1|  Protein argonaute 4B                                    152   1e-38   Triticum urartu
ref|XP_004304078.2|  PREDICTED: protein argonaute 16-like               150   2e-38   Fragaria vesca subsp. vesca
ref|XP_004296440.2|  PREDICTED: protein argonaute 16-like               150   2e-38   Fragaria vesca subsp. vesca
gb|KJB10319.1|  hypothetical protein B456_001G195700                    150   3e-38   Gossypium raimondii
gb|KJB10321.1|  hypothetical protein B456_001G195700                    150   3e-38   Gossypium raimondii
gb|KJB10320.1|  hypothetical protein B456_001G195700                    150   3e-38   Gossypium raimondii
ref|NP_197602.2|  protein argonaute 8                                   150   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229810.1|  PREDICTED: protein argonaute 16                    149   1e-37   Prunus mume [ume]
ref|XP_008379693.1|  PREDICTED: protein argonaute 16                    148   2e-37   
gb|KHG12030.1|  hypothetical protein F383_20383                         148   2e-37   Gossypium arboreum [tree cotton]
ref|XP_002534129.1|  eukaryotic translation initiation factor 2c,...    148   2e-37   
ref|XP_007217062.1|  hypothetical protein PRUPE_ppa001137mg             147   3e-37   Prunus persica
ref|XP_003526363.1|  PREDICTED: protein argonaute 4B-like               147   5e-37   
ref|XP_006400673.1|  hypothetical protein EUTSA_v10015501mg             147   6e-37   
ref|XP_011100478.1|  PREDICTED: protein argonaute 16 isoform X1         146   8e-37   Sesamum indicum [beniseed]
ref|XP_009769203.1|  PREDICTED: protein argonaute 16                    146   1e-36   Nicotiana sylvestris
ref|XP_010110219.1|  Protein argonaute 16                               145   2e-36   Morus notabilis
emb|CDP05690.1|  unnamed protein product                                145   2e-36   Coffea canephora [robusta coffee]
tpg|DAA54155.1|  TPA: hypothetical protein ZEAMMB73_367489              135   2e-36   
ref|XP_007133316.1|  hypothetical protein PHAVU_011G169400g             144   3e-36   Phaseolus vulgaris [French bean]
ref|XP_006594374.1|  PREDICTED: protein argonaute 16-like isoform X5    144   5e-36   Glycine max [soybeans]
gb|KHN37722.1|  Protein argonaute 16                                    144   5e-36   Glycine soja [wild soybean]
ref|XP_006594373.1|  PREDICTED: protein argonaute 16-like isoform X4    144   6e-36   Glycine max [soybeans]
ref|XP_006594371.1|  PREDICTED: protein argonaute 16-like isoform X2    144   6e-36   Glycine max [soybeans]
ref|XP_004968863.1|  PREDICTED: protein argonaute 16-like               144   6e-36   
ref|XP_006594372.1|  PREDICTED: protein argonaute 16-like isoform X3    144   7e-36   Glycine max [soybeans]
ref|XP_004296439.1|  PREDICTED: protein argonaute 16-like isoform X2    143   1e-35   Fragaria vesca subsp. vesca
ref|XP_003541581.2|  PREDICTED: protein argonaute 16-like isoform X1    142   2e-35   Glycine max [soybeans]
gb|KHN26437.1|  Protein argonaute 4A                                    142   3e-35   Glycine soja [wild soybean]
ref|XP_009365125.1|  PREDICTED: protein argonaute 16 isoform X1         141   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_009365127.1|  PREDICTED: protein argonaute 16 isoform X2         141   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_009365128.1|  PREDICTED: protein argonaute 16 isoform X3         141   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_011462334.1|  PREDICTED: protein argonaute 16-like isoform X1    140   7e-35   Fragaria vesca subsp. vesca
ref|NP_001266273.1|  uncharacterized protein LOC101264839               140   1e-34   Solanum lycopersicum
gb|AES71838.2|  eukaryotic translation initiation factor 2c, puta...    137   2e-33   Medicago truncatula
ref|XP_006357979.1|  PREDICTED: protein argonaute 16-like               137   2e-33   Solanum tuberosum [potatoes]
gb|EMT09812.1|  Protein argonaute 16                                    136   3e-33   
gb|AGS47793.1|  argonaute 6                                             136   3e-33   Salvia miltiorrhiza [Chinese salvia]
emb|CDP15091.1|  unnamed protein product                                131   1e-32   Coffea canephora [robusta coffee]
ref|XP_002881254.1|  PAZ domain-containing protein                      134   1e-32   Arabidopsis lyrata subsp. lyrata
emb|CDX79495.1|  BnaC03g18310D                                          132   6e-32   
ref|XP_010509947.1|  PREDICTED: protein argonaute 6-like                129   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006410431.1|  hypothetical protein EUTSA_v10016224mg             128   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010469531.1|  PREDICTED: protein argonaute 6-like                127   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004956341.1|  PREDICTED: protein argonaute 16-like isoform X2    127   4e-30   
ref|XP_010413926.1|  PREDICTED: protein argonaute 6                     127   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010556972.1|  PREDICTED: protein argonaute 6                     125   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_002457641.1|  hypothetical protein SORBIDRAFT_03g010990          122   2e-29   
ref|XP_009630855.1|  PREDICTED: protein argonaute 16                    122   2e-28   Nicotiana tomentosiformis
ref|XP_006293657.1|  hypothetical protein CARUB_v10022614mg             122   3e-28   
gb|EYU22224.1|  hypothetical protein MIMGU_mgv1a001217mg                122   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_009132895.1|  PREDICTED: protein argonaute 6                     119   3e-27   
emb|CDX84712.1|  BnaA03g15180D                                          119   3e-27   
ref|NP_180853.2|  argonaute 6                                           119   4e-27   
gb|AAB91987.1|  Argonaute (AGO1)-like protein                           119   4e-27   
gb|EMT25923.1|  Protein argonaute 4B                                    117   8e-27   
ref|XP_009419463.1|  PREDICTED: protein argonaute 16-like               117   2e-26   
ref|XP_009763100.1|  PREDICTED: protein argonaute 4B-like isoform X2    116   2e-26   
ref|XP_009763095.1|  PREDICTED: protein argonaute 4B-like isoform X1    116   3e-26   
ref|XP_003601587.1|  Protein argonaute                                  116   3e-26   
ref|XP_009594593.1|  PREDICTED: protein argonaute 4B-like               115   4e-26   
gb|KHM99307.1|  Protein argonaute 4                                     103   7e-25   
gb|AJA90771.1|  Argonaute 4                                             107   5e-23   
ref|XP_010688916.1|  PREDICTED: protein argonaute 16 isoform X1         105   2e-22   
ref|XP_010688917.1|  PREDICTED: protein argonaute 16 isoform X2         105   2e-22   
ref|XP_006351552.1|  PREDICTED: protein argonaute 4B-like               104   3e-22   
gb|EPS71209.1|  hypothetical protein M569_03550                         101   5e-22   
ref|XP_004236549.1|  PREDICTED: protein argonaute 4A-like               102   1e-21   
gb|AJA90779.1|  Argonaute 4                                             102   2e-21   
gb|AJA90755.1|  Argonaute 4                                           99.8    2e-20   
gb|AAY67884.1|  argonaute/Zwille-like protein                         97.1    2e-19   
gb|KDO57345.1|  hypothetical protein CISIN_1g0361692mg                88.2    8e-17   
emb|CDX78332.1|  BnaA03g02440D                                        87.8    1e-16   
gb|EYU42876.1|  hypothetical protein MIMGU_mgv1a001669mg              84.7    2e-15   
gb|AJA90764.1|  Argonaute 4                                           82.8    1e-14   
ref|XP_001769106.1|  argonaute family member                          77.8    4e-13   
ref|XP_001784983.1|  argonaute family member                          76.6    9e-13   
gb|KDO38589.1|  hypothetical protein CISIN_1g048669mg                 75.9    1e-12   
ref|XP_006482371.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...  75.5    2e-12   
gb|KDP43930.1|  hypothetical protein JCGZ_05397                       73.6    1e-11   
gb|EEC76346.1|  hypothetical protein OsI_13926                        72.4    3e-11   
sp|Q851R2.1|MEL1_ORYSJ  RecName: Full=Protein argonaute MEL1; Alt...  72.4    3e-11   
gb|EAZ28935.1|  hypothetical protein OsJ_12979                        71.6    4e-11   
dbj|BAK05938.1|  predicted protein                                    71.6    5e-11   
ref|XP_010435959.1|  PREDICTED: protein argonaute 5-like              70.9    7e-11   
gb|KDO44722.1|  hypothetical protein CISIN_1g0356952mg                68.2    8e-11   
ref|XP_011010386.1|  PREDICTED: protein argonaute 5-like              70.5    1e-10   
ref|XP_002314317.1|  argonaute family protein                         70.1    1e-10   
ref|XP_001755804.1|  argonaute family member                          69.3    2e-10   
ref|XP_004173728.1|  PREDICTED: protein argonaute 5-like              68.2    3e-10   
ref|XP_010417939.1|  PREDICTED: protein argonaute 5-like              68.9    3e-10   
ref|XP_010510717.1|  PREDICTED: protein argonaute 5-like              68.9    3e-10   
gb|KHN38687.1|  Protein argonaute 5                                   68.9    3e-10   
ref|XP_002323195.1|  hypothetical protein POPTR_0016s02470g           63.5    4e-10   
ref|XP_006592296.1|  PREDICTED: protein argonaute 5-like              68.6    4e-10   
ref|XP_006424393.1|  hypothetical protein CICLE_v10027755mg           68.2    5e-10   
ref|XP_010473185.1|  PREDICTED: protein argonaute 5-like              68.2    6e-10   
ref|XP_006424394.1|  hypothetical protein CICLE_v10027760mg           68.2    6e-10   
ref|XP_002298162.2|  argonaute family protein                         68.2    6e-10   
ref|XP_002880962.1|  hypothetical protein ARALYDRAFT_481718           68.2    6e-10   
ref|XP_008462248.1|  PREDICTED: protein argonaute 5                   68.2    7e-10   
ref|XP_006485142.1|  PREDICTED: protein argonaute 5-like              67.4    7e-10   
ref|XP_004167325.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...  67.8    7e-10   
ref|XP_004139565.1|  PREDICTED: protein argonaute 5-like              67.8    8e-10   
ref|XP_008360082.1|  PREDICTED: protein argonaute 5-like              67.8    9e-10   
ref|XP_010521702.1|  PREDICTED: protein argonaute 5                   67.8    9e-10   
gb|AAD21514.1|  Argonaute (AGO1)-like protein                         67.4    9e-10   
gb|KDO37148.1|  hypothetical protein CISIN_1g026337mg                 65.1    1e-09   
ref|NP_850110.1|  argonaute 5                                         67.4    1e-09   
ref|XP_006485143.1|  PREDICTED: protein argonaute 5-like              67.4    1e-09   
gb|EYU37000.1|  hypothetical protein MIMGU_mgv1a000822mg              67.4    1e-09   
ref|XP_011037293.1|  PREDICTED: protein argonaute 5-like              67.0    1e-09   
ref|XP_010689967.1|  PREDICTED: protein argonaute 5                   67.0    2e-09   
gb|KEH29935.1|  eukaryotic translation initiation factor 2c           67.0    2e-09   
ref|XP_010490899.1|  PREDICTED: protein argonaute 5-like              66.6    2e-09   
emb|CDY04517.1|  BnaA07g13430D                                        65.9    3e-09   
ref|XP_009103628.1|  PREDICTED: protein argonaute 5                   65.9    3e-09   
ref|XP_006485141.1|  PREDICTED: protein argonaute MEL1-like           65.9    4e-09   
ref|XP_010100146.1|  Protein argonaute 5                              65.5    4e-09   
ref|XP_009787109.1|  PREDICTED: protein argonaute 5                   65.5    4e-09   
ref|XP_006409803.1|  hypothetical protein EUTSA_v10016181mg           65.5    4e-09   
ref|XP_006296291.1|  hypothetical protein CARUB_v10025461mg           65.5    5e-09   
ref|XP_009608773.1|  PREDICTED: protein argonaute 5                   65.1    6e-09   
gb|KFK44936.1|  hypothetical protein AALP_AA1G322100                  65.1    6e-09   
emb|CDX71410.1|  BnaC04g16450D                                        65.1    6e-09   
gb|EYU40234.1|  hypothetical protein MIMGU_mgv1a022215mg              65.1    6e-09   
ref|XP_002972915.1|  hypothetical protein SELMODRAFT_98227            64.7    7e-09   
ref|XP_006424392.1|  hypothetical protein CICLE_v10027752mg           64.7    7e-09   
ref|XP_010651834.1|  PREDICTED: protein argonaute 5                   64.7    7e-09   
ref|XP_010229446.1|  PREDICTED: protein argonaute MEL1-like           64.7    8e-09   
gb|EEC81647.1|  hypothetical protein OsI_25183                        64.7    8e-09   
ref|NP_001059079.1|  Os07g0188000                                     64.7    8e-09   
gb|KJB35162.1|  hypothetical protein B456_006G103000                  64.3    9e-09   
gb|KJB35168.1|  hypothetical protein B456_006G103000                  64.3    9e-09   
gb|KJB35167.1|  hypothetical protein B456_006G103000                  64.3    9e-09   
gb|KJB35169.1|  hypothetical protein B456_006G103000                  64.3    9e-09   
ref|NP_001265878.1|  uncharacterized protein LOC101244672             64.3    1e-08   
gb|KJB35165.1|  hypothetical protein B456_006G103000                  64.3    1e-08   
gb|KJB35163.1|  hypothetical protein B456_006G103000                  64.3    1e-08   
gb|KJB35161.1|  hypothetical protein B456_006G103000                  64.3    1e-08   
ref|XP_006424395.1|  hypothetical protein CICLE_v10027750mg           63.9    1e-08   
gb|KJB35164.1|  hypothetical protein B456_006G103000                  63.9    1e-08   
ref|XP_010045278.1|  PREDICTED: protein argonaute 5-like              63.9    1e-08   
dbj|BAO49750.1|  argonaute protein                                    63.9    2e-08   
ref|XP_002461596.1|  hypothetical protein SORBIDRAFT_02g005150        63.5    2e-08   
ref|XP_006347212.1|  PREDICTED: protein argonaute MEL1-like           63.5    2e-08   
ref|XP_008670390.1|  PREDICTED: protein argonaute 18-like isoform X2  63.5    2e-08   
ref|XP_008385476.1|  PREDICTED: protein argonaute 5-like isoform X1   63.5    2e-08   
ref|XP_008670386.1|  PREDICTED: protein argonaute 18-like isoform X1  63.5    2e-08   
gb|KJB35183.1|  hypothetical protein B456_006G103100                  63.2    2e-08   
emb|CDP07006.1|  unnamed protein product                              63.2    2e-08   
ref|XP_009356968.1|  PREDICTED: protein argonaute 5 isoform X3        63.2    3e-08   
ref|XP_009356967.1|  PREDICTED: protein argonaute 5 isoform X2        62.8    3e-08   
ref|XP_009356966.1|  PREDICTED: protein argonaute 5 isoform X1        62.8    3e-08   
ref|XP_004506082.1|  PREDICTED: protein argonaute 5-like isoform X1   62.8    3e-08   
ref|XP_004506083.1|  PREDICTED: protein argonaute 5-like isoform X2   62.8    3e-08   
emb|CDX94724.1|  BnaC07g17330D                                        62.8    3e-08   
ref|XP_003561331.2|  PREDICTED: protein argonaute 14-like             62.8    3e-08   
gb|KCW87437.1|  hypothetical protein EUGRSUZ_B03907                   62.8    3e-08   
gb|AAF79718.1|AC020889_26  T1N15.2                                    62.8    3e-08   
ref|XP_008226878.1|  PREDICTED: protein argonaute 5                   62.4    4e-08   
ref|XP_010045274.1|  PREDICTED: protein argonaute 5                   62.4    4e-08   
tpg|DAA42502.1|  TPA: putative argonaute family protein               62.4    4e-08   
dbj|BAE99844.1|  hypothetical protein                                 61.6    4e-08   
ref|XP_007206711.1|  hypothetical protein PRUPE_ppa024131mg           62.4    4e-08   
ref|NP_001146206.1|  uncharacterized protein LOC100279776             62.4    4e-08   
gb|KEH29936.1|  eukaryotic translation initiation factor 2c           62.4    4e-08   
ref|XP_004294050.1|  PREDICTED: protein argonaute 5                   62.0    5e-08   
ref|XP_008644431.1|  PREDICTED: protein argonaute MEL1-like           62.0    6e-08   
ref|XP_007132360.1|  hypothetical protein PHAVU_011G088200g           62.0    6e-08   
ref|XP_004957665.1|  PREDICTED: protein argonaute 18-like             61.6    7e-08   
ref|NP_849784.1|  protein argonaute 1                                 61.6    8e-08   
ref|XP_002460677.1|  hypothetical protein SORBIDRAFT_02g032980        61.6    8e-08   
ref|XP_008377246.1|  PREDICTED: protein argonaute 5-like isoform X2   61.2    8e-08   
ref|NP_175274.1|  protein argonaute 1                                 61.2    9e-08   
ref|XP_008377245.1|  PREDICTED: protein argonaute 5-like isoform X1   61.2    9e-08   
ref|XP_010494093.1|  PREDICTED: protein argonaute 6-like              57.0    9e-08   
ref|XP_009101761.1|  PREDICTED: protein argonaute 10 isoform X2       61.2    9e-08   
gb|ADE06082.1|  argonaute/Zwille-like protein 2                       61.2    9e-08   
ref|XP_002523757.1|  eukaryotic translation initiation factor 2c,...  61.2    9e-08   
ref|XP_008377247.1|  PREDICTED: protein argonaute 5-like isoform X3   61.2    1e-07   
ref|XP_001774237.1|  argonaute family member                          61.2    1e-07   
ref|XP_009101760.1|  PREDICTED: protein argonaute 10 isoform X1       61.2    1e-07   
ref|XP_009101762.1|  PREDICTED: protein argonaute 10 isoform X3       61.2    1e-07   
gb|AIN75619.1|  argonaute 5                                           61.2    1e-07   
emb|CDY22332.1|  BnaA06g36540D                                        60.8    1e-07   
ref|XP_004508549.1|  PREDICTED: protein argonaute PNH1-like isofo...  60.8    1e-07   
ref|XP_006484939.1|  PREDICTED: protein argonaute 5-like              60.8    1e-07   
ref|XP_006424391.1|  hypothetical protein CICLE_v10027763mg           60.5    2e-07   
gb|AFW67327.1|  putative argonaute superfamily protein                60.5    2e-07   
ref|XP_007016005.1|  Argonaute protein group                          60.5    2e-07   
emb|CDX98740.1|  BnaA03g45250D                                        58.9    2e-07   
gb|ABY52943.1|  argonaute/Zwille-like protein 1                       60.1    2e-07   
ref|XP_010247717.1|  PREDICTED: protein argonaute 5-like isoform X2   60.1    2e-07   
ref|XP_003573171.1|  PREDICTED: protein argonaute 1C-like             60.1    3e-07   
ref|XP_010247716.1|  PREDICTED: protein argonaute 1-like isoform X1   60.1    3e-07   
ref|XP_010247718.1|  PREDICTED: protein argonaute 5-like isoform X3   59.7    3e-07   
ref|XP_010069497.1|  PREDICTED: protein argonaute 1-like              59.3    4e-07   
ref|XP_002865401.1|  hypothetical protein ARALYDRAFT_917259           59.3    4e-07   
gb|KDO40404.1|  hypothetical protein CISIN_1g0053181mg                58.5    4e-07   
emb|CDX78331.1|  BnaA03g02430D                                        56.6    4e-07   
ref|XP_004299479.1|  PREDICTED: protein argonaute 1-like              58.9    5e-07   
ref|XP_002988014.1|  hypothetical protein SELMODRAFT_235430           58.9    6e-07   
ref|XP_008805347.1|  PREDICTED: protein argonaute 4B-like isoform X3  58.5    7e-07   
ref|XP_011072044.1|  PREDICTED: protein argonaute 1                   58.5    7e-07   
ref|XP_011465698.1|  PREDICTED: protein argonaute 1                   58.5    7e-07   
gb|EMS61534.1|  Protein argonaute 18                                  58.2    8e-07   
ref|XP_006403186.1|  hypothetical protein EUTSA_v10003139mg           58.5    8e-07   
ref|XP_009394199.1|  PREDICTED: protein argonaute 1A-like isoform X1  58.5    8e-07   
emb|CDJ26672.1|  unnamed protein product                              58.2    8e-07   
ref|XP_010494360.1|  PREDICTED: protein argonaute 10-like             58.2    9e-07   
ref|XP_010441983.1|  PREDICTED: protein argonaute 10-like             58.2    1e-06   
dbj|BAB96813.1|  ZLL/PNH homologous protein                           58.2    1e-06   
ref|XP_010481823.1|  PREDICTED: protein argonaute 10                  58.2    1e-06   
gb|AGS47797.1|  argonaute 10                                          58.2    1e-06   
sp|Q69VD5.1|PNH1_ORYSJ  RecName: Full=Protein argonaute PNH1; Alt...  58.2    1e-06   
gb|KDO42526.1|  hypothetical protein CISIN_1g002204mg                 58.2    1e-06   
ref|XP_006279940.1|  hypothetical protein CARUB_v10025804mg           57.8    1e-06   
ref|XP_009386428.1|  PREDICTED: protein argonaute 1B isoform X1       57.8    1e-06   
ref|XP_010243012.1|  PREDICTED: protein argonaute MEL1-like           57.8    1e-06   
ref|NP_001174883.1|  Os06g0597400                                     57.4    1e-06   
ref|XP_006374268.1|  hypothetical protein POPTR_0015s05550g           57.8    1e-06   
gb|AFW82929.1|  hypothetical protein ZEAMMB73_610629                  57.4    1e-06   
ref|XP_009392848.1|  PREDICTED: protein argonaute 1B-like isoform X1  57.4    2e-06   
ref|XP_010500364.1|  PREDICTED: protein argonaute 1-like isoform X2   57.4    2e-06   
ref|XP_010500363.1|  PREDICTED: protein argonaute 1-like isoform X1   57.4    2e-06   
ref|XP_010479262.1|  PREDICTED: protein argonaute 1 isoform X2        57.4    2e-06   
ref|XP_010479261.1|  PREDICTED: protein argonaute 1 isoform X1        57.4    2e-06   
ref|XP_007047836.1|  Argonaute protein group, putative                57.4    2e-06   
gb|KHN27615.1|  Protein argonaute PNH1                                57.4    2e-06   
ref|XP_003528280.1|  PREDICTED: protein argonaute PNH1-like isofo...  57.4    2e-06   
ref|XP_009392849.1|  PREDICTED: protein argonaute 1B-like isoform X2  57.4    2e-06   
ref|XP_009386429.1|  PREDICTED: protein argonaute 1B isoform X2       57.4    2e-06   
ref|XP_002454847.1|  hypothetical protein SORBIDRAFT_04g038420        57.4    2e-06   
ref|XP_002984845.1|  hypothetical protein SELMODRAFT_181346           57.0    2e-06   
ref|XP_009394207.1|  PREDICTED: protein argonaute 1A-like isoform X2  57.0    2e-06   
gb|AGS47788.1|  argonaute 1                                           57.0    2e-06   
emb|CAA11429.1|  Zwille protein                                       57.0    2e-06   
ref|NP_199194.1|  eIF2C family protein Argonaute10                    57.0    2e-06   
ref|XP_002978905.1|  hypothetical protein SELMODRAFT_110151           57.0    2e-06   
gb|EMS49242.1|  Protein argonaute 1C                                  56.6    3e-06   
ref|XP_004976513.1|  PREDICTED: protein argonaute 1B-like isoform X1  56.6    3e-06   
ref|XP_002440411.1|  hypothetical protein SORBIDRAFT_09g000530        56.6    3e-06   
ref|XP_011047764.1|  PREDICTED: protein argonaute 1-like              56.6    3e-06   
ref|XP_010914964.1|  PREDICTED: protein argonaute PNH1-like           56.6    3e-06   
ref|XP_010918322.1|  PREDICTED: protein argonaute 1A-like isoform X2  56.6    3e-06   
ref|XP_007047833.1|  Argonaute protein group, putative                56.6    3e-06   
ref|XP_004976514.1|  PREDICTED: protein argonaute 1B-like isoform X2  56.6    3e-06   
ref|XP_006648927.1|  PREDICTED: protein argonaute 1A-like             56.6    3e-06   
ref|XP_006648926.1|  PREDICTED: protein argonaute 1A-like             56.6    3e-06   
ref|XP_010238589.1|  PREDICTED: protein argonaute 18-like             56.2    4e-06   
ref|XP_006647669.1|  PREDICTED: protein argonaute 1A-like isoform X1  56.2    4e-06   
ref|XP_006647670.1|  PREDICTED: protein argonaute 1A-like isoform X2  56.2    4e-06   
gb|KDP45800.1|  hypothetical protein JCGZ_17407                       56.2    4e-06   
gb|EPS72163.1|  hypothetical protein M569_02595                       56.2    4e-06   
gb|KHN23595.1|  Protein argonaute 1                                   56.2    4e-06   
gb|KHG08402.1|  Protein argonaute 1B                                  56.2    4e-06   
gb|EYU22272.1|  hypothetical protein MIMGU_mgv1a000545mg              56.2    4e-06   
ref|XP_003595718.1|  Argonaute protein group                          55.8    4e-06   
ref|XP_010918321.1|  PREDICTED: protein argonaute 1A-like isoform X1  56.2    4e-06   
gb|KHN15131.1|  Protein argonaute PNH1                                56.2    4e-06   
ref|XP_006600761.1|  PREDICTED: protein argonaute PNH1-like isofo...  56.2    4e-06   
gb|KJB53121.1|  hypothetical protein B456_008G294100                  55.8    5e-06   
gb|KJB53120.1|  hypothetical protein B456_008G294100                  55.8    5e-06   
gb|KJB53118.1|  hypothetical protein B456_008G294100                  55.8    5e-06   
gb|EEC73763.1|  hypothetical protein OsI_08429                        55.8    5e-06   
ref|NP_001047704.1|  Os02g0672200                                     55.8    5e-06   
ref|XP_002318338.1|  hypothetical protein POPTR_0012s03410g           55.8    5e-06   
ref|XP_008792132.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...  55.8    5e-06   
ref|XP_008346888.1|  PREDICTED: protein argonaute 1-like              55.8    5e-06   
gb|EEE57555.1|  hypothetical protein OsJ_07892                        55.8    5e-06   
ref|XP_011003695.1|  PREDICTED: protein argonaute 1-like              55.8    5e-06   



>ref|XP_006362741.1| PREDICTED: protein argonaute 4-like [Solanum tuberosum]
Length=909

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   MAEEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTN  191
            MAEE+ NGAA E LPPPPPVP DFTP+K E EP KKK  R+PMARRG G+KGQKI ILTN
Sbjct  1    MAEEETNGAAAEGLPPPPPVPPDFTPAKTELEPVKKKILRVPMARRGVGNKGQKIQILTN  60

Query  192  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGKEFAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKEFAYDGEK  120

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEI  542
            SLFT+GALPRNK+EFTVVL++VTSNRNNGN SP   GSPNE D+KRLRRPY+SKT+KVEI
Sbjct  121  SLFTIGALPRNKMEFTVVLDDVTSNRNNGNSSPGGHGSPNEADRKRLRRPYQSKTFKVEI  180

Query  543  SFAAKIPMNA  572
            SFAAKIPM A
Sbjct  181  SFAAKIPMQA  190



>ref|XP_009622314.1| PREDICTED: protein argonaute 4-like [Nicotiana tomentosiformis]
Length=905

 Score =   285 bits (729),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeae-ptkkkapRLPMARRGFGSKGQKIPILTN  191
            MAEED NGAAE LPPPPPVP DFTP+K+E E   KK A RLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPAKSELEPVKKKAALRLPMARRGLGNKGQKIQILTN  60

Query  192  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
            HFKVNV+  DGHF+HYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFYHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SPNEGDKKRLRRPYRSKTYKVEI  542
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP    SPNE D+KRLRRPY+SK++KVEI
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAAHESPNENDRKRLRRPYQSKSFKVEI  180

Query  543  SFAAKIPMNA  572
            SFAAKIPM A
Sbjct  181  SFAAKIPMQA  190



>gb|ABC61505.1| AGO4-2, partial [Nicotiana benthamiana]
Length=905

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeae-ptkkkapRLPMARRGFGSKGQKIPILTN  191
            MAEED NGAAE LPPPPPVP DFTP+ +E E   KK A RLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPAISEPEPVKKKAALRLPMARRGLGNKGQKIQILTN  60

Query  192  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS---PNEGDKKRLRRPYRSKTYKVEI  542
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP +   PNE D+KRLRRPY+SK++KVEI
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAADEGPNESDRKRLRRPYQSKSFKVEI  180

Query  543  SFAAKIPMNA  572
            SFAAKIPM A
Sbjct  181  SFAAKIPMQA  190



>ref|XP_009785001.1| PREDICTED: protein argonaute 4-like [Nicotiana sylvestris]
Length=906

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 170/191 (89%), Gaps = 5/191 (3%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkap-RLPMARRGFGSKGQKIPILTN  191
            MAEED NGAAE LPPPPPVP DFTP K+E EP KKKA  RLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPVKSEPEPVKKKAAPRLPMARRGLGNKGQKIQILTN  60

Query  192  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----PNEGDKKRLRRPYRSKTYKVE  539
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP +    PNE D+KRLRRPY+SK++KVE
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAAADEGPNESDRKRLRRPYQSKSFKVE  180

Query  540  ISFAAKIPMNA  572
            ISFAAKIPM A
Sbjct  181  ISFAAKIPMQA  191



>ref|XP_006347268.1| PREDICTED: protein argonaute 4-like isoform X1 [Solanum tuberosum]
 ref|XP_006347269.1| PREDICTED: protein argonaute 4-like isoform X2 [Solanum tuberosum]
Length=913

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 171/193 (89%), Gaps = 7/193 (4%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAEE+N G+ EALPPPPPVP DF+P++AE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEENGGSTEALPPPPPVPLDFSPAQAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRN---NGNCSPG----SPNEGDKKRLRRPYRSKTYK  533
            LFT+G+LPRNKLEFTVVL+++TSNRN   NGN SPG     PNE D+KRLRRPY+SKTYK
Sbjct  121  LFTIGSLPRNKLEFTVVLDDITSNRNNGTNGNSSPGRHGSPPNETDRKRLRRPYQSKTYK  180

Query  534  VEISFAAKIPMNA  572
            VEISFAAKIPM A
Sbjct  181  VEISFAAKIPMQA  193



>ref|NP_001289847.1| uncharacterized protein LOC101246148 [Solanum lycopersicum]
 gb|AFV15382.1| AGO4B [Solanum lycopersicum]
Length=913

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 7/193 (4%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAEE+N G+ EALPPPPPVP +F+P++AE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEENGGSTEALPPPPPVPLNFSPAQAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRN---NGNCSPG----SPNEGDKKRLRRPYRSKTYK  533
            LFT+G+LPRNKLEFTVVL+++TSNRN   NGN SPG     PNE D+KRLRRPY+SKTYK
Sbjct  121  LFTIGSLPRNKLEFTVVLDDITSNRNNGTNGNSSPGRHGSPPNETDRKRLRRPYQSKTYK  180

Query  534  VEISFAAKIPMNA  572
            VEISFAAKIPM A
Sbjct  181  VEISFAAKIPMQA  193



>ref|NP_001266156.1| uncharacterized protein LOC101256023 [Solanum lycopersicum]
 gb|AFV15381.1| AGO4A [Solanum lycopersicum]
Length=909

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = +3

Query  15   MAEEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTN  191
            MAEE+ NGAA E LPPPPPVP DFTP+K E EP KKK  R+PMARRG G+KGQKI ILTN
Sbjct  1    MAEEETNGAAAEGLPPPPPVPPDFTPAKTEIEPVKKKILRVPMARRGVGNKGQKIQILTN  60

Query  192  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLD VH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVNNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDTVHETYDTELAGKDFAYDGEK  120

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEI  542
            SLFT+GALPRNK+EFTVVL++V SNRNNGN SP   GSPNE D+KRLRRPY+SKT+KVEI
Sbjct  121  SLFTIGALPRNKMEFTVVLDDVISNRNNGNSSPGGHGSPNEADRKRLRRPYQSKTFKVEI  180

Query  543  SFAAKIPMNA  572
            SFAAKIPM A
Sbjct  181  SFAAKIPMQA  190



>ref|XP_011080473.1| PREDICTED: protein argonaute 4 [Sesamum indicum]
 ref|XP_011080474.1| PREDICTED: protein argonaute 4 [Sesamum indicum]
Length=911

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 3/188 (2%)
 Frame = +3

Query  18   AEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  197
            +E+D NGA EALPPPPPVP + TP KA +EP  KK  R+PMARRG G++G K+PILTNHF
Sbjct  4    SEQDGNGAPEALPPPPPVPPNVTPIKAVSEPEAKKVLRVPMARRGLGTRGTKVPILTNHF  63

Query  198  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  377
            KVNVS  DGHFFHYSVAL YEDGRPVD KG+GRKVLDRVH+TYDTELAGKEFAYDGEKSL
Sbjct  64   KVNVSNVDGHFFHYSVALSYEDGRPVDGKGVGRKVLDRVHETYDTELAGKEFAYDGEKSL  123

Query  378  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISF  548
            FTVG LPRNKLEFTVVLE+VTS+RNNGN SP   GSPNE D+KRLRRPY+SKT+KVEISF
Sbjct  124  FTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGGHGSPNESDRKRLRRPYQSKTFKVEISF  183

Query  549  AAKIPMNA  572
            AAKIPM A
Sbjct  184  AAKIPMQA  191



>gb|AGS47791.1| argonaute 4 [Salvia miltiorrhiza]
Length=870

 Score =   271 bits (693),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 164/188 (87%), Gaps = 3/188 (2%)
 Frame = +3

Query  18   AEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  197
            +E D NGA+EALPPPPPVP + TP K   EP  KK  R PMARRGFG++G K+PILTNHF
Sbjct  4    SEHDGNGASEALPPPPPVPPNVTPIKVVTEPEVKKVFRAPMARRGFGTRGNKVPILTNHF  63

Query  198  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  377
            KVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRV DTYD+ELAGKEFAYDGEKSL
Sbjct  64   KVNVNNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVRDTYDSELAGKEFAYDGEKSL  123

Query  378  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISF  548
            FTVG+LPRNKLEFTVVLE+VTS+RNNGN SP   GSPNE DKKRLRRPY+SKT+KVEISF
Sbjct  124  FTVGSLPRNKLEFTVVLEDVTSSRNNGNSSPGGKGSPNESDKKRLRRPYQSKTFKVEISF  183

Query  549  AAKIPMNA  572
            AAKIPM A
Sbjct  184  AAKIPMQA  191



>ref|XP_009591976.1| PREDICTED: protein argonaute 4 [Nicotiana tomentosiformis]
Length=912

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 169/192 (88%), Gaps = 6/192 (3%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAEEDN+G  EALPPPPP+P DF+P+KAE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEDNSGVTEALPPPPPIPPDFSPAKAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDKKRLRRPYRSKTYKV  536
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+KRLRRPY+SK+YKV
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGNSSPGRHGSPNENDRKRLRRPYQSKSYKV  180

Query  537  EISFAAKIPMNA  572
            EISFAAKIPM A
Sbjct  181  EISFAAKIPMQA  192



>ref|XP_011090194.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090195.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090196.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090197.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090198.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090199.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090200.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090201.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
Length=910

 Score =   269 bits (687),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG G++G K+PILTNHFKVNV+K DGHFFHYSVAL+YEDGRPVD KG+GRKVLD
Sbjct  40   RVPMARRGLGTRGNKVPILTNHFKVNVNKVDGHFFHYSVALFYEDGRPVDGKGVGRKVLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYDTELAGKEFAYDGEKSLFTVG LPRNKLEFTVVLE+VTS+RNNGN SP   GSP
Sbjct  100  RVHETYDTELAGKEFAYDGEKSLFTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGGHGSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRPY+SKT+KVEISFAAKIPM A
Sbjct  160  NESDRKRLRRPYQSKTFKVEISFAAKIPMQA  190



>gb|ABC61504.1| AGO4-1, partial [Nicotiana benthamiana]
Length=912

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 167/192 (87%), Gaps = 6/192 (3%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAEEDN G  EALPPPPP+P DF+P+ AE EP KKK  R+PM+RRG GSKGQKIPILTNH
Sbjct  1    MAEEDNGGVTEALPPPPPIPPDFSPAIAEPEPVKKKVLRVPMSRRGLGSKGQKIPILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDKKRLRRPYRSKTYKV  536
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+KRLRRPY+SK+YKV
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGSSSPGKHGSPNENDRKRLRRPYQSKSYKV  180

Query  537  EISFAAKIPMNA  572
            EISFAAKIPM A
Sbjct  181  EISFAAKIPMQA  192



>ref|XP_009773871.1| PREDICTED: protein argonaute 4 [Nicotiana sylvestris]
Length=912

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 167/192 (87%), Gaps = 6/192 (3%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAEEDN G  EALPPPPP+P DF P+KAE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEDNIGVTEALPPPPPIPPDFYPAKAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDKKRLRRPYRSKTYKV  536
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+KRLRRPY+SK+YKV
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGNSSPGRHGSPNENDRKRLRRPYQSKSYKV  180

Query  537  EISFAAKIPMNA  572
            EISFAAKIPM A
Sbjct  181  EISFAAKIPMQA  192



>gb|EYU46161.1| hypothetical protein MIMGU_mgv1a000944mg [Erythranthe guttata]
Length=936

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG G+KG K+PILTNHFKVNV+  DG+FFHYSVAL YEDGRPVD KGIGRKVLD
Sbjct  67   RVPMARRGLGTKGNKVPILTNHFKVNVNSVDGYFFHYSVALAYEDGRPVDGKGIGRKVLD  126

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS--PN  482
            RVH+TYD+ELAGKEFAYDGEKSLFTVG LPRNKLEFTVVLE+VTS+RNNGN SPGS  PN
Sbjct  127  RVHETYDSELAGKEFAYDGEKSLFTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGSENPN  186

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            + D+KRLRRPY+SKT++VEISFAAKIPM A
Sbjct  187  DSDRKRLRRPYQSKTFQVEISFAAKIPMQA  216



>ref|XP_004149653.1| PREDICTED: protein argonaute 4-like [Cucumis sativus]
 gb|KGN54041.1| hypothetical protein Csa_4G269720 [Cucumis sativus]
Length=915

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALAYEDGRPVDGKGVGRKVID  107

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N GD+KR++RPYRSK++KVEISFAAKIPM A
Sbjct  168  NNGDRKRMKRPYRSKSFKVEISFAAKIPMQA  198



>ref|XP_008449865.1| PREDICTED: protein argonaute 4 [Cucumis melo]
 ref|XP_008449866.1| PREDICTED: protein argonaute 4 [Cucumis melo]
Length=915

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALSYEDGRPVDGKGVGRKVID  107

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N GD+KR++RPYRSK++KVEISFAAKIPM A
Sbjct  168  NNGDRKRMKRPYRSKSFKVEISFAAKIPMQA  198



>ref|XP_004165479.1| PREDICTED: LOW QUALITY PROTEIN: protein argonaute 4-like [Cucumis 
sativus]
Length=915

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALAYEDGRPVDGKGVGRKVID  107

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N GD+KR++RPYRSK++KVEISFAAKIPM A
Sbjct  168  NNGDRKRMKRPYRSKSFKVEISFAAKIPMQA  198



>ref|XP_002527764.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF34625.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=921

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQKI +LTNHFKVNV+K D +FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  54   RVPIARRGLGSKGQKISLLTNHFKVNVNKVDDYFFHYCVSLSYEDGRPVDGKGVGRKVID  113

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYD+E+ GK+FAYDGEKSLFTVGALPRNKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  114  RVHETYDSEMGGKKFAYDGEKSLFTVGALPRNKLEFTVVLEDVTSNRNNGNASPDGHGSP  173

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NEGD+KR+RRPY+SKT+KVEISFAAKIPM A
Sbjct  174  NEGDRKRMRRPYQSKTFKVEISFAAKIPMQA  204



>ref|XP_002275928.1| PREDICTED: protein argonaute 4 [Vitis vinifera]
 ref|XP_010651616.1| PREDICTED: protein argonaute 4 [Vitis vinifera]
 emb|CBI24382.3| unnamed protein product [Vitis vinifera]
Length=913

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 5/188 (3%)
 Frame = +3

Query  24   EDNNGAAEALpppppvpSD---FTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            ED NGA +ALPPPPPVP +          +EP KKK  R+P+ARRGF SKGQKI + TNH
Sbjct  5    EDGNGAQDALPPPPPVPPNVVPIKADSVASEPVKKKVARVPIARRGFASKGQKIALTTNH  64

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            FKVNV+  DGHFFHYSV+L YEDGRPVD KGIGRKV+DRVH+TYD+EL GK+FAYDGEKS
Sbjct  65   FKVNVTGADGHFFHYSVSLSYEDGRPVDGKGIGRKVIDRVHETYDSELGGKDFAYDGEKS  124

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPNEGDKKRLRRPYRSKTYKVEISF  548
            LFTVG LPRNKLEFTVVLE+V+SNRNNGN SP  GSPNE D+KR+RRPY+SKT+KVEISF
Sbjct  125  LFTVGPLPRNKLEFTVVLEDVSSNRNNGNGSPDRGSPNESDRKRMRRPYQSKTFKVEISF  184

Query  549  AAKIPMNA  572
            AAKIPM A
Sbjct  185  AAKIPMQA  192



>gb|AGS47796.1| argonaute 9 [Salvia miltiorrhiza]
Length=888

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = +3

Query  21   EEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFK  200
            E   NGA EALP PPPVP + TP K + EP  KK  R+PMARRG G++G ++PILTNHFK
Sbjct  23   EHGGNGAPEALPAPPPVPPNVTPLKVQPEPESKKVVRVPMARRGPGTRGNRVPILTNHFK  82

Query  201  VNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLF  380
            VNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRV  TY+TELAGKEFAYDGEKSLF
Sbjct  83   VNVASVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVRATYETELAGKEFAYDGEKSLF  142

Query  381  TVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLRRPYRSKTYKVEISFAAKI  560
            TVG+LPRNKLEFTVVLE+VTS+RNNGN SPG  NE D+KRLRRPY+SKT+KVEISFAAKI
Sbjct  143  TVGSLPRNKLEFTVVLEDVTSSRNNGNSSPG--NESDRKRLRRPYQSKTFKVEISFAAKI  200

Query  561  PMNA  572
            PM A
Sbjct  201  PMQA  204



>ref|XP_010093806.1| hypothetical protein L484_022518 [Morus notabilis]
 gb|EXB54657.1| hypothetical protein L484_022518 [Morus notabilis]
Length=226

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARR  G+KGQKIP+LTNHF+V VS  +GHFFHYSVAL YEDGR VD KGIGRKV+D
Sbjct  45   RVPMARRNLGTKGQKIPLLTNHFRVKVSNVEGHFFHYSVALSYEDGRAVDGKGIGRKVID  104

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++LA KEFAYDGEKSLFTVG LPRNKLEFTVVL++V++ R+NGN SP   GSP
Sbjct  105  KVHETYRSDLADKEFAYDGEKSLFTVGPLPRNKLEFTVVLDDVSAARSNGNRSPDGHGSP  164

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KRLRR Y+SKT+KVEISFAAKIPM A
Sbjct  165  SENDRKRLRRQYQSKTFKVEISFAAKIPMQA  195



>ref|XP_006369389.1| hypothetical protein POPTR_0001s22710g [Populus trichocarpa]
 gb|ERP65958.1| hypothetical protein POPTR_0001s22710g [Populus trichocarpa]
Length=883

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQK+P+LTNHFKVNV+  +G+FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLLTNHFKVNVTNTEGYFFHYCVSLAYEDGRPVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NEGD+KRLRRPY SKT+KVEISFAAKIPM A
Sbjct  162  NEGDRKRLRRPYHSKTFKVEISFAAKIPMQA  192



>ref|XP_007016688.1| Argonaute family protein isoform 1 [Theobroma cacao]
 ref|XP_007016689.1| Argonaute family protein isoform 1 [Theobroma cacao]
 gb|EOY34307.1| Argonaute family protein isoform 1 [Theobroma cacao]
 gb|EOY34308.1| Argonaute family protein isoform 1 [Theobroma cacao]
Length=913

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG GSKGQKIPILTNHF+VNV   +GHFFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  42   RVPMARRGLGSKGQKIPILTNHFQVNVGNVNGHFFHYSVSLSYEDGRPVDGKGVGRKVID  101

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY +ELAGK+FAYDGEKSLFTVG LP NKLEFTVVLE+VTSNRNNGN SP    SP
Sbjct  102  RVHETYSSELAGKDFAYDGEKSLFTVGPLPSNKLEFTVVLEDVTSNRNNGNVSPDGHDSP  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRPY+SK ++VEISFAAKIPM A
Sbjct  162  NEHDRKRLRRPYQSKAFRVEISFAAKIPMQA  192



>ref|XP_006369390.1| Argonaute 4 family protein [Populus trichocarpa]
 gb|ERP65959.1| Argonaute 4 family protein [Populus trichocarpa]
Length=911

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQK+P+LTNHFKVNV+  +G+FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLLTNHFKVNVTNTEGYFFHYCVSLAYEDGRPVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NEGD+KRLRRPY SKT+KVEISFAAKIPM A
Sbjct  162  NEGDRKRLRRPYHSKTFKVEISFAAKIPMQA  192



>gb|KDP45657.1| hypothetical protein JCGZ_17264 [Jatropha curcas]
Length=910

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM+RRG GSKG KIP+LTNHFKVNV+  DG+FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  45   RVPMSRRGLGSKGNKIPLLTNHFKVNVTNVDGYFFHYSVSLSYEDGRPVDGKGVGRKVID  104

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TYD+EL GK FAYDGEKSLFTVG+LPRNKLEFTVVLE+++SNR+NGN SP   GSP
Sbjct  105  RVQETYDSELGGKNFAYDGEKSLFTVGSLPRNKLEFTVVLEDISSNRSNGNASPDGHGSP  164

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KR+RRPYRSKT+KVEISFAAKIPM A
Sbjct  165  NESDRKRMRRPYRSKTFKVEISFAAKIPMQA  195



>ref|XP_010689361.1| PREDICTED: protein argonaute 4 [Beta vulgaris subsp. vulgaris]
Length=910

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 155/193 (80%), Gaps = 9/193 (5%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpS----DFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPI  182
            M   D NG+AEALPPPPP P+    D  P   + E    K  R+PMAR+G  ++GQKI +
Sbjct  1    MDSHDGNGSAEALPPPPPPPAEIPPDVVP--IKVESDPPKKKRVPMARKGLATRGQKIQL  58

Query  183  LTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYD  362
            L+NHFKVNVS  DGHFFHYSV L YEDGRPVD KG+GRKVLDRV +TYDTELAGK+FAYD
Sbjct  59   LSNHFKVNVSNVDGHFFHYSVNLMYEDGRPVDGKGVGRKVLDRVQETYDTELAGKDFAYD  118

Query  363  GEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYK  533
            GEKSLFTVGALP NKLEFTVVLE+VTS RNNGN SP   GSPNE D+KR+RRPY+SKT+K
Sbjct  119  GEKSLFTVGALPGNKLEFTVVLEDVTSARNNGNASPEGRGSPNETDRKRVRRPYQSKTFK  178

Query  534  VEISFAAKIPMNA  572
            VE+SFAAKIPM A
Sbjct  179  VELSFAAKIPMQA  191



>emb|CDP09667.1| unnamed protein product [Coffea canephora]
Length=868

 Score =   250 bits (638),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 132/148 (89%), Gaps = 3/148 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            MARRG G+KGQKI +LTNHFKV V   DG FFHYSVAL+YEDGRPVD KGIGR+VLDRV 
Sbjct  1    MARRGLGTKGQKIQLLTNHFKVAVKNVDGQFFHYSVALFYEDGRPVDGKGIGRRVLDRVQ  60

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SPNEG  488
            +TYDTELAG+EFAYDGEKSLFTVG LPRNKL+FTVVLE+VTSNRN GN SPG   SPN+G
Sbjct  61   ETYDTELAGREFAYDGEKSLFTVGPLPRNKLQFTVVLEDVTSNRNTGNSSPGGHESPNDG  120

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KRLRRPY+SKT+KVEISFAAKIPM A
Sbjct  121  DRKRLRRPYQSKTFKVEISFAAKIPMQA  148



>ref|XP_011006053.1| PREDICTED: protein argonaute 4-like [Populus euphratica]
 ref|XP_011006054.1| PREDICTED: protein argonaute 4-like [Populus euphratica]
Length=911

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQK+P+ TNHFKVNV+  +G+FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLSTNHFKVNVTNTEGYFFHYSVSLAYEDGRPVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NEGD+KRLRRPY SKT+KVEISFAAKIPM A
Sbjct  162  NEGDRKRLRRPYYSKTFKVEISFAAKIPMQA  192



>ref|XP_004241389.1| PREDICTED: protein argonaute 4-like [Solanum lycopersicum]
Length=904

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  15   MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  194
            MAE++  G+ EALPPPPPVP DF+P KAE  P +KK  R+PMARRG G KG+ I ILTNH
Sbjct  1    MAEQEYGGSTEALPPPPPVPLDFSPEKAEPAPVEKKLLRVPMARRGLGKKGRNIQILTNH  60

Query  195  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  374
            F+VNVS  DGHFFHYSVAL+YEDG+PV+ KGIGRKVLDRVH+TY  ELAGK FAYDGEKS
Sbjct  61   FQVNVSNVDGHFFHYSVALFYEDGQPVEVKGIGRKVLDRVHETYHAELAGKGFAYDGEKS  120

Query  375  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLRRPYRSKTYKVEISFAA  554
            LFT+G+LPR++ EFTVVL ++TSNRN G  SP  PNE D+KRLRRPY+SKTYKV+IS A 
Sbjct  121  LFTIGSLPRSRFEFTVVLNDITSNRNVGTSSP--PNEADRKRLRRPYQSKTYKVKISLAG  178

Query  555  KIPMNA  572
            KIPM A
Sbjct  179  KIPMQA  184



>gb|KCW87286.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
Length=851

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQKIP+LTNHFKVNV+  DG FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  49   RVPIARRGPGSKGQKIPLLTNHFKVNVTNLDGQFFHYSVSLSYEDGRPVDGKGVGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  482
            +V  TY +ELAGK+FAYDGEKSLFTVG LP+NKLEFTVVLE+VTS+RNNGN SP  GSPN
Sbjct  109  KVQATYSSELAGKDFAYDGEKSLFTVGPLPQNKLEFTVVLEDVTSSRNNGNASPDGGSPN  168

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KRLRRPY+SKT+KVEISFAAKIPM A
Sbjct  169  ESDRKRLRRPYQSKTFKVEISFAAKIPMQA  198



>ref|XP_010045128.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010045129.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010045131.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 gb|KCW87284.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
 gb|KCW87285.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
Length=918

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG GSKGQKIP+LTNHFKVNV+  DG FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  49   RVPIARRGPGSKGQKIPLLTNHFKVNVTNLDGQFFHYSVSLSYEDGRPVDGKGVGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  482
            +V  TY +ELAGK+FAYDGEKSLFTVG LP+NKLEFTVVLE+VTS+RNNGN SP  GSPN
Sbjct  109  KVQATYSSELAGKDFAYDGEKSLFTVGPLPQNKLEFTVVLEDVTSSRNNGNASPDGGSPN  168

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KRLRRPY+SKT+KVEISFAAKIPM A
Sbjct  169  ESDRKRLRRPYQSKTFKVEISFAAKIPMQA  198



>ref|XP_010031652.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010031653.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 gb|KCW51009.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
 gb|KCW51010.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
Length=921

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG GSKGQKI +LTNHFKVNV+  DG FFHYSV++ YEDGRPVD+KG+GR+V+D
Sbjct  50   RVPMARRGLGSKGQKIALLTNHFKVNVTNVDGQFFHYSVSVSYEDGRPVDAKGVGRRVMD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY +EL+GK+FAYDGEKSLFT+G LPRNKLEFTVVLE+V+S+RNNGN SP   GSP
Sbjct  110  RVQETYSSELSGKDFAYDGEKSLFTIGPLPRNKLEFTVVLEDVSSSRNNGNASPDAHGSP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KR+R+PY+SKT+KVEISFAAKIPM A
Sbjct  170  NHTDRKRMRQPYQSKTFKVEISFAAKIPMQA  200



>gb|KCW51008.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
Length=949

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG GSKGQKI +LTNHFKVNV+  DG FFHYSV++ YEDGRPVD+KG+GR+V+D
Sbjct  50   RVPMARRGLGSKGQKIALLTNHFKVNVTNVDGQFFHYSVSVSYEDGRPVDAKGVGRRVMD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY +EL+GK+FAYDGEKSLFT+G LPRNKLEFTVVLE+V+S+RNNGN SP   GSP
Sbjct  110  RVQETYSSELSGKDFAYDGEKSLFTIGPLPRNKLEFTVVLEDVSSSRNNGNASPDAHGSP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KR+R+PY+SKT+KVEISFAAKIPM A
Sbjct  170  NHTDRKRMRQPYQSKTFKVEISFAAKIPMQA  200



>gb|KHN37954.1| Protein argonaute 4 [Glycine soja]
Length=947

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  79   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  138

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  482
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  139  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  198

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KR+RRPYRSK++KVEISFAAKIPM A
Sbjct  199  ESDRKRMRRPYRSKSFKVEISFAAKIPMQA  228



>ref|XP_003555656.1| PREDICTED: protein argonaute 4 isoform X1 [Glycine max]
Length=915

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  47   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  106

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  482
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  107  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  166

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KR+RRPYRSK++KVEISFAAKIPM A
Sbjct  167  ESDRKRMRRPYRSKSFKVEISFAAKIPMQA  196



>ref|XP_006605639.1| PREDICTED: protein argonaute 4 isoform X2 [Glycine max]
Length=947

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  79   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  138

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  482
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  139  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  198

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KR+RRPYRSK++KVEISFAAKIPM A
Sbjct  199  ESDRKRMRRPYRSKSFKVEISFAAKIPMQA  228



>gb|KHG16394.1| Protein argonaute 4 -like protein [Gossypium arboreum]
Length=863

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  21   EEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  197
            E+D NGAA ++LPPPPPVP D  P KAE EP KKK  R+PMARRG GSKGQKI +LTNHF
Sbjct  10   EQDGNGAAPDSLPPPPPVPPDVVPIKAEPEPAKKKVVRIPMARRGLGSKGQKITLLTNHF  69

Query  198  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  377
            KVNV  +DGHFFHY V+LYYEDGRPVD KG+GRKV++RV +TY  ELAGK+FAYDGEKSL
Sbjct  70   KVNVGSSDGHFFHYCVSLYYEDGRPVDGKGVGRKVIERVQETYGNELAGKDFAYDGEKSL  129

Query  378  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISF  548
            FTVGALP NK EFTVVLE+VTSNRNNGN SP      N  D+KR++RPY+SKT+KVEISF
Sbjct  130  FTVGALPNNKHEFTVVLEDVTSNRNNGNASPDVHDDSNGQDRKRIKRPYQSKTFKVEISF  189

Query  549  AAKIPMNA  572
            AAKIPM A
Sbjct  190  AAKIPMQA  197



>gb|KDO66364.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=676

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>gb|KJB26170.1| hypothetical protein B456_004G228100 [Gossypium raimondii]
Length=913

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  21   EEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  197
            E+D NGAA ++LPPPPPVP D  P KAE EP KKK  R+PMARRG GSKGQKI +LTNHF
Sbjct  5    EQDGNGAAPDSLPPPPPVPPDVVPIKAEPEPAKKKVVRVPMARRGLGSKGQKITLLTNHF  64

Query  198  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  377
            KVNV  +DGHFFHY V+LYYEDGRPVD KG+GRKV++RV +TY  ELAGK+FAYDGEKSL
Sbjct  65   KVNVGSSDGHFFHYCVSLYYEDGRPVDGKGVGRKVIERVQETYGNELAGKDFAYDGEKSL  124

Query  378  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISF  548
            FTVGALP NK EFTVVLE+VTSNRNNGN SP      N  D+KR++RPY+SKT+KVEISF
Sbjct  125  FTVGALPNNKHEFTVVLEDVTSNRNNGNASPDVHDDSNGQDRKRIKRPYQSKTFKVEISF  184

Query  549  AAKIPMNA  572
            AAKIPM A
Sbjct  185  AAKIPMQA  192



>gb|KDO66363.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=735

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>ref|XP_004491186.1| PREDICTED: protein argonaute 4-like isoform X1 [Cicer arietinum]
 ref|XP_004491187.1| PREDICTED: protein argonaute 4-like isoform X2 [Cicer arietinum]
Length=906

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG GSKG K+P+LTNHFKVNV+ NDG+F+ YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  42   RVPMARRGLGSKGTKLPLLTNHFKVNVANNDGYFYQYSVALFYEDGRPVEGKGAGRKLLD  101

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TYD+EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  102  RVQETYDSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ DKKR+RR YRSKT+KVEISFA+KIP+ A
Sbjct  162  NDADKKRMRRAYRSKTFKVEISFASKIPLQA  192



>gb|KDO66362.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=845

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>gb|ACZ04920.1| argonaute 4-like protein [Pelargonium x hortorum]
Length=933

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG  SKGQKIP+LTNHFKVNV+  +GHFFHYSVAL+YEDGRPVD KG+G KV+D
Sbjct  65   RVPIARRGLASKGQKIPLLTNHFKVNVTNVEGHFFHYSVALFYEDGRPVDGKGVGGKVID  124

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            RV +TYDTELAGK+FAYDGEKSLFTVG LPRNK EF VVLE+V+SNR NGN SP + +  
Sbjct  125  RVQETYDTELAGKDFAYDGEKSLFTVGPLPRNKHEFIVVLEDVSSNRVNGNASPDAGDGN  184

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR+RRP+ SKT+KVEISFAAKIPM A
Sbjct  185  DRKRMRRPFHSKTFKVEISFAAKIPMQA  212



>gb|KDO66360.1| hypothetical protein CISIN_1g0024491mg, partial [Citrus sinensis]
 gb|KDO66361.1| hypothetical protein CISIN_1g0024491mg, partial [Citrus sinensis]
Length=820

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>ref|XP_006470434.1| PREDICTED: protein argonaute 4-like [Citrus sinensis]
Length=920

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>ref|XP_006446389.1| hypothetical protein CICLE_v10014186mg [Citrus clementina]
 gb|ESR59629.1| hypothetical protein CICLE_v10014186mg [Citrus clementina]
Length=920

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  D+KRLRRPYRSKT+KVEISFAAKIP+ A
Sbjct  169  NGNDRKRLRRPYRSKTFKVEISFAAKIPIQA  199



>ref|XP_007146204.1| hypothetical protein PHAVU_006G021200g [Phaseolus vulgaris]
 gb|ESW18198.1| hypothetical protein PHAVU_006G021200g [Phaseolus vulgaris]
Length=919

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARR  GS+G KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  47   RLPIARRDLGSRGMKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIMD  106

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  482
            RV +TY ++L GK+FAYDGEKSLFT+G+LPRNKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  107  RVQETYHSDLNGKDFAYDGEKSLFTIGSLPRNKLEFEVVLEDVTSNRNNGNCSPDGNGDN  166

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E D+KR+RRPY +K++KVEIS+AAKIPM A
Sbjct  167  ESDRKRMRRPYHAKSFKVEISYAAKIPMQA  196



>ref|XP_010653696.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
 ref|XP_010653697.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
Length=918

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM+RRGFGSKGQKI +LTNHFKV ++   GHFFHYSVAL YEDGRPV+ KG+GRK++D
Sbjct  47   RVPMSRRGFGSKGQKISLLTNHFKVGITNASGHFFHYSVALTYEDGRPVEMKGVGRKIMD  106

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TYDTEL+GK+FAYDGEKSLFTVGALP NKLEFTVVL+ V+SNRN  N SP   GSP
Sbjct  107  KVHETYDTELSGKDFAYDGEKSLFTVGALPHNKLEFTVVLDSVSSNRNTRNGSPDVNGSP  166

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N GD+KR RR  +SKT+KVEISFAAKIPM A
Sbjct  167  NGGDRKRPRRASQSKTFKVEISFAAKIPMQA  197



>ref|XP_007207224.1| hypothetical protein PRUPE_ppa000990mg [Prunus persica]
 gb|EMJ08423.1| hypothetical protein PRUPE_ppa000990mg [Prunus persica]
Length=939

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG G+KG KIP++TNHFKVNV+  DG+FFHYSV++ YEDGRP+D KG GR+++D
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIDGYFFHYSVSVSYEDGRPLDGKGAGRRIID  129

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE++ SNRNNGN SP   GSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDMPSNRNNGNASPDGHGSP  189

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  190  NESDRKRLRRPNRSKTFNVEISYAAKIPMKA  220



>ref|XP_008231109.1| PREDICTED: protein argonaute 4 [Prunus mume]
 ref|XP_008231117.1| PREDICTED: protein argonaute 4 [Prunus mume]
Length=939

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG G+KG KIP++TNHFKVNV+  DG+FFHYSV++ YEDGRP+D KG GR+++D
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIDGYFFHYSVSVSYEDGRPLDGKGAGRRIID  129

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE++ SNRNNGN SP   GSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDMPSNRNNGNASPDGHGSP  189

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  190  NENDRKRLRRPNRSKTFNVEISYAAKIPMKA  220



>ref|XP_008363553.1| PREDICTED: protein argonaute 4-like [Malus domestica]
 ref|XP_008363554.1| PREDICTED: protein argonaute 4-like [Malus domestica]
 ref|XP_008363555.1| PREDICTED: protein argonaute 4-like [Malus domestica]
Length=939

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNGNC    PGSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGNCEPDGPGSP  189

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  190  NESDRKRLRRPNRSKTFNVEISYAAKIPMKA  220



>ref|XP_009339636.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339637.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339638.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339640.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339641.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339642.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339643.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339644.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
Length=939

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNGNC    PGSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGNCEPDGPGSP  189

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  190  NESDRKRLRRPNRSKTFNVEISYAAKIPMKA  220



>ref|XP_002323196.2| hypothetical protein POPTR_0016s02480g [Populus trichocarpa]
 gb|EEF04957.2| hypothetical protein POPTR_0016s02480g [Populus trichocarpa]
Length=921

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ RRG GS+GQKI ++TNHFKV++S   GHFFHYSV+LYYEDGRPVD+KGIGR+++D
Sbjct  50   RSPITRRGVGSRGQKIQLVTNHFKVSISNTGGHFFHYSVSLYYEDGRPVDAKGIGRRLID  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  110  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RR ++SKT+KVE+SFAAKIPM A
Sbjct  170  NETDKKRMRRAFQSKTFKVEMSFAAKIPMQA  200



>ref|XP_002308843.1| hypothetical protein POPTR_0006s02680g [Populus trichocarpa]
 gb|EEE92366.1| hypothetical protein POPTR_0006s02680g [Populus trichocarpa]
Length=930

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ARRGFGS+GQKI +L+NHFKV++S   GHFFHY V+L YEDGRP+D+KGIGR+++D
Sbjct  59   RSPIARRGFGSRGQKIQLLSNHFKVSISNTGGHFFHYCVSLSYEDGRPIDAKGIGRRLID  118

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  119  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  178

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RR ++SKT+KVE+SFAAKIPM A
Sbjct  179  NETDKKRMRRAFQSKTFKVEMSFAAKIPMQA  209



>ref|XP_006293644.1| hypothetical protein CARUB_v10022599mg [Capsella rubella]
 gb|EOA26542.1| hypothetical protein CARUB_v10022599mg [Capsella rubella]
Length=923

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F VVLEEV++ R NGN SP   GSP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPNNKMDFAVVLEEVSAARTNGNASPNGNGSP  172

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP R+K +KVEIS+AAKIP+ A
Sbjct  173  SDGDRKRLRRPNRTKNFKVEISYAAKIPLQA  203



>gb|KJB56072.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=688

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>ref|XP_003617094.1| Protein argonaute 4 [Medicago truncatula]
Length=908

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  38   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  97

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  98   RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  157

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ D+KRL++ +RSKTYKVEISFA+KIP+ A
Sbjct  158  NDTDRKRLKKSHRSKTYKVEISFASKIPLQA  188



>ref|XP_003617096.1| Protein argonaute 4 [Medicago truncatula]
 gb|AET00055.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=926

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  78   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  137

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  138  RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  197

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ D+KRL++ +RSKTYKVEISFA+KIP+ A
Sbjct  198  NDTDRKRLKKSHRSKTYKVEISFASKIPLQA  228



>ref|XP_003617095.1| Protein argonaute 4 [Medicago truncatula]
 gb|AET00054.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=948

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  78   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  137

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  138  RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  197

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ D+KRL++ +RSKTYKVEISFA+KIP+ A
Sbjct  198  NDTDRKRLKKSHRSKTYKVEISFASKIPLQA  228



>emb|CBI32885.3| unnamed protein product [Vitis vinifera]
Length=879

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRGFGSKGQKI +LTNHFKV ++   GHFFHYSVAL YEDGRPV+ KG+GRK++D+VH
Sbjct  1    MSRRGFGSKGQKISLLTNHFKVGITNASGHFFHYSVALTYEDGRPVEMKGVGRKIMDKVH  60

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEG  488
            +TYDTEL+GK+FAYDGEKSLFTVGALP NKLEFTVVL+ V+SNRN  N SP   GSPN G
Sbjct  61   ETYDTELSGKDFAYDGEKSLFTVGALPHNKLEFTVVLDSVSSNRNTRNGSPDVNGSPNGG  120

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RR  +SKT+KVEISFAAKIPM A
Sbjct  121  DRKRPRRASQSKTFKVEISFAAKIPMQA  148



>gb|KJB56075.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=822

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>ref|XP_010520483.1| PREDICTED: protein argonaute 4-like [Tarenaya hassleriana]
Length=911

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMARRG G+KGQKI +LTNHFKVN + ++GHFFHYSVAL YEDG PV++KG+GRKVL+
Sbjct  41   RLPMARRGLGTKGQKISLLTNHFKVNYTNSNGHFFHYSVALMYEDGHPVEAKGVGRKVLE  100

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K+FAYDGEK+LFT+GALPRNKL+F+VVLE+++S+RN GN SP   N+ 
Sbjct  101  KVQETYQSDLGFKDFAYDGEKTLFTIGALPRNKLDFSVVLEDISSSRNTGNASPSDTNDA  160

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KRLRRPY SK +KVEISFA KIPM A
Sbjct  161  DRKRLRRPYNSKKFKVEISFATKIPMQA  188



>ref|XP_011041311.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011041312.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=921

 Score =   230 bits (587),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ RRG GS+GQKI ++TNHFKV++S   GHFFHYSV+LYYEDGRPVD+ GIGR+++D
Sbjct  50   RSPITRRGVGSRGQKIQLVTNHFKVSISNTGGHFFHYSVSLYYEDGRPVDATGIGRRLID  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++LAGK+FAYDGEKS+FT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  110  KVHETYGSDLAGKDFAYDGEKSVFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RR ++SKT+KVE+SFAAKIPM A
Sbjct  170  NETDKKRMRRAFQSKTFKVEMSFAAKIPMQA  200



>gb|KJB56074.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=844

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>gb|KJB56071.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
 gb|KJB56076.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
 gb|KJB56078.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=912

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>gb|KJB56073.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=863

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>gb|KEH35100.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=923

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMARRG GSKG KIPILTNHF VN+ KNDG+FF YSV+  YEDGRPV+ KG+GRK++D
Sbjct  58   RLPMARRGLGSKGMKIPILTNHFSVNIGKNDGYFFQYSVSFAYEDGRPVEGKGVGRKIMD  117

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS--PN  482
            RV +TY ++L GKEFAYDGEKSLFT+G+LP+NKLEF +VLE+V S+RNNGN SP +   N
Sbjct  118  RVQETYASDLNGKEFAYDGEKSLFTIGSLPQNKLEFEIVLEDVVSSRNNGNRSPDANGDN  177

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E DKKR+RRPY +KT+KVEISFA K+PM A
Sbjct  178  EADKKRVRRPYNAKTFKVEISFATKVPMYA  207



>ref|XP_002880875.1| hypothetical protein ARALYDRAFT_481584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57134.1| hypothetical protein ARALYDRAFT_481584 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  54   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  113

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  114  KVHETYHSDLDGKEFAYDGEKTLFTYGALPDNKMDFSVVLEEVSAARTNGNGSPNGNESP  173

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK ++VEIS+AAKIP+ A
Sbjct  174  SDGDRKRLRRPNRSKNFRVEISYAAKIPLQA  204



>gb|KHN38433.1| Protein argonaute 4 [Glycine soja]
Length=878

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RLPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE++ ++RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDIIASRNNGNCSPDGNGEL  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RRP RSK +KVE+S+A+KIP+ A
Sbjct  160  NESDKKRMRRPNRSKAFKVELSYASKIPLQA  190



>ref|NP_565633.1| argonaute 4 [Arabidopsis thaliana]
 ref|NP_001189613.1| argonaute 4 [Arabidopsis thaliana]
 sp|Q9ZVD5.2|AGO4_ARATH RecName: Full=Protein argonaute 4; AltName: Full=Protein OVEREXPRESSOR 
OF CATIONIC PEROXIDASE 11 [Arabidopsis thaliana]
 gb|AAK59586.1| putative Argonaute (AGO1) protein [Arabidopsis thaliana]
 gb|AAK93710.1| putative argonaute AGO1 protein [Arabidopsis thaliana]
 gb|AAC77862.2| Argonaute (AGO1)-like protein [Arabidopsis thaliana]
 gb|AEC07928.1| argonaute 4 [Arabidopsis thaliana]
 gb|AEC07929.1| argonaute 4 [Arabidopsis thaliana]
Length=924

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  54   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEQKGVGRKILD  113

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  114  KVHQTYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSATRANGNGSPNGNESP  173

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK ++VEIS+AAKIP+ A
Sbjct  174  SDGDRKRLRRPNRSKNFRVEISYAAKIPLQA  204



>ref|XP_010510823.1| PREDICTED: protein argonaute 4 [Camelina sativa]
Length=923

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+GFG++GQKIP+LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIPLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+  R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSVARTNGNGSPNGNESP  172

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK +KVEIS+AAKIP+ A
Sbjct  173  SDGDRKRLRRPNRSKNFKVEISYAAKIPLQA  203



>ref|XP_009103572.1| PREDICTED: protein argonaute 4-like [Brassica rapa]
Length=923

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 132/152 (87%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKILD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  476
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            P++GD+KRLRRP RSK+++VEIS+AAKIP+ A
Sbjct  170  PSDGDRKRLRRPNRSKSFRVEISYAAKIPLQA  201



>ref|XP_004501969.1| PREDICTED: protein argonaute 4-like [Cicer arietinum]
Length=918

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+AR G GSKG KIP+LTNHFKVNV+ NDG+FFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  51   RLPIARTGLGSKGMKIPLLTNHFKVNVNNNDGYFFHYSVAFTYEDGRPVEGKGVGRKIMD  110

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP----GS  476
            RV +TY ++L  K+FAYDGEKSLFT+G+LP+ KLEF +VLE+VTSNRNNG+ SP      
Sbjct  111  RVQETYHSDLNDKDFAYDGEKSLFTIGSLPQKKLEFEIVLEDVTSNRNNGSRSPDGNGNE  170

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             NE DKKR+RRPYR+KT++VEISFAAKIPM+A
Sbjct  171  DNESDKKRMRRPYRAKTFRVEISFAAKIPMSA  202



>ref|XP_011461779.1| PREDICTED: protein argonaute 4-like [Fragaria vesca subsp. vesca]
 ref|XP_011461780.1| PREDICTED: protein argonaute 4-like [Fragaria vesca subsp. vesca]
Length=944

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 131/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNV--SKNDGHFFHYSVALYYEDGRPVDSKGIGRKV  302
            RLP+ARRG G+KGQKIP+LTNHFKVNV  S  + HFFHYSV + YEDGRP+D KG GR++
Sbjct  73   RLPIARRGLGTKGQKIPLLTNHFKVNVTNSNKEEHFFHYSVLVTYEDGRPLDGKGAGRRI  132

Query  303  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---G  473
            +DRVH+TY++EL GK+FAYDGEKSLFTVG+LPRNKLEF+VVLE+  SNRNNG+ +    G
Sbjct  133  IDRVHETYNSELGGKDFAYDGEKSLFTVGSLPRNKLEFSVVLEDTPSNRNNGSINADGEG  192

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SPNE D+KRLRRP R+KT+ VEIS+AAKIPM A
Sbjct  193  SPNESDRKRLRRPGRTKTFNVEISYAAKIPMKA  225



>ref|XP_002527383.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF35008.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=917

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM+RRG GS+GQ+I +LTNHFKV V+ + GHF HYSVAL+YEDGRPVDSKGIGRKV+D
Sbjct  45   RVPMSRRGNGSRGQRIELLTNHFKVGVNCDGGHFSHYSVALFYEDGRPVDSKGIGRKVID  104

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TYD++LAGK+FAYDGEKSLFTVG+LPRNK+EFTV+L++V+SNR NG+ SP   GSP
Sbjct  105  KVRETYDSDLAGKDFAYDGEKSLFTVGSLPRNKMEFTVLLDDVSSNRINGSGSPVGNGSP  164

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  +KKR++R + SKTYKVEISFAAKIPM A
Sbjct  165  NGSEKKRMKRVFHSKTYKVEISFAAKIPMQA  195



>emb|CDY56413.1| BnaC04g54830D [Brassica napus]
Length=923

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 131/152 (86%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KGIGRK+LD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGIGRKILD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  476
            +VH TY ++L G+EFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHQTYHSDLDGQEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            P++GD+KRLRRP RSK+++VEIS+AAKIP+ A
Sbjct  170  PSDGDRKRLRRPNRSKSFRVEISYAAKIPLQA  201



>ref|XP_003545462.1| PREDICTED: protein argonaute 4-like [Glycine max]
 gb|KHN26023.1| Protein argonaute 4 [Glycine soja]
Length=906

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RFPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE+V + RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDVIATRNNGNCSPEGNGEL  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RRP RSK +KVE+S+A+KIP+ A
Sbjct  160  NESDKKRMRRPNRSKAFKVELSYASKIPLQA  190



>ref|XP_010417848.1| PREDICTED: protein argonaute 4-like [Camelina sativa]
Length=920

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+G G++GQKIP+LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGIGTRGQKIPLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+  R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSVARTNGNGSPNGNESP  172

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK +KVEIS+AAKIP+ A
Sbjct  173  SDGDRKRLRRPNRSKNFKVEISYAAKIPLQA  203



>ref|XP_006408675.1| hypothetical protein EUTSA_v10001902mg [Eutrema salsugineum]
 gb|ESQ50128.1| hypothetical protein EUTSA_v10001902mg [Eutrema salsugineum]
Length=922

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR GFGSKGQKIP+LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPIARAGFGSKGQKIPLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNE-  485
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F VVLEEV+S R NGN SP    E 
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFAVVLEEVSSARTNGNASPNGNEER  169

Query  486  --GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KRLRRP RSK ++VEIS+AAKIP+ A
Sbjct  170  SDGDRKRLRRPNRSKNFRVEISYAAKIPLQA  200



>emb|CDY04475.1| BnaA07g13010D [Brassica napus]
Length=923

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 131/152 (86%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  50   RVPMVRPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKILD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  476
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            P++GD+KRLRRP RSK+++VEIS+AAKIP+ A
Sbjct  170  PSDGDRKRLRRPNRSKSFRVEISYAAKIPLQA  201



>gb|KHG11406.1| Protein argonaute 4 -like protein [Gossypium arboreum]
Length=880

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRG G+KGQK+ ILTNHFKV+V   DG F+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGQFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            R+H+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RLHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N  ++KRLRRPY SKT+KVEIS+AAKIPM A
Sbjct  160  NGRERKRLRRPYHSKTFKVEISYAAKIPMQA  190



>ref|XP_011040669.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011040670.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=914

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 132/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ARRG GS+GQKI +L+NHF+V++S   GHFFHY V+L YEDGRP+D+KGIGR+++D
Sbjct  43   RSPIARRGVGSRGQKIQLLSNHFRVSISNTGGHFFHYCVSLSYEDGRPIDAKGIGRRLID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN GN SP   GSP
Sbjct  103  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNAGNGSPVGNGSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KR+RR ++SKT+KV++SFAAKIPM A
Sbjct  163  NETDRKRMRRAFQSKTFKVDMSFAAKIPMQA  193



>ref|XP_010473093.1| PREDICTED: protein argonaute 4 [Camelina sativa]
Length=923

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR+GFG++GQKI +LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIQLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSAARTNGNRSPNGNESP  172

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK +KVEIS+AAKIP+ A
Sbjct  173  SDGDRKRLRRPNRSKNFKVEISYAAKIPLQA  203



>ref|XP_008385629.1| PREDICTED: protein argonaute 4 [Malus domestica]
 ref|XP_008385630.1| PREDICTED: protein argonaute 4 [Malus domestica]
Length=939

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RAPIARRGQGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNG      PGSP
Sbjct  130  RVHETYQSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGTSEPDGPGSP  189

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  190  NESDRKRLRRPNRSKTFNVEISYAAKIPMKA  220



>ref|XP_009345605.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009345606.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
Length=945

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  76   RAPIARRGQGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  135

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  479
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNG      PGSP
Sbjct  136  RVHETYQSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGTSEPDGPGSP  195

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE D+KRLRRP RSKT+ VEIS+AAKIPM A
Sbjct  196  NESDRKRLRRPNRSKTFNVEISYAAKIPMKA  226



>ref|XP_003519489.1| PREDICTED: protein argonaute 4-like [Glycine max]
Length=906

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RLPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE++ ++RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDIIASRNNGNCSPDGNGEL  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE DKKR+RRP  SK +KVE+S+A+KIP+ A
Sbjct  160  NESDKKRMRRPNSSKAFKVELSYASKIPLQA  190



>ref|XP_010521596.1| PREDICTED: protein argonaute 4 [Tarenaya hassleriana]
Length=920

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG G+KGQKIP+LTNHFKVNV+  DG+F+HYSVAL+Y+DGRPV++KG+GRKVLD
Sbjct  51   RVPMARRGLGTKGQKIPLLTNHFKVNVTNLDGYFYHYSVALFYDDGRPVETKGVGRKVLD  110

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++H+TY ++LA K+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN +  SP++G
Sbjct  111  KLHETYRSDLADKDFAYDGEKTLFTFGALPTNKMDFSVVLEEVSSKRTNGNSNLDSPDDG  170

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR+RR  +SK+++VEIS+AAKIP+ A
Sbjct  171  DKKRMRRRNQSKSFRVEISYAAKIPLQA  198



>emb|CDY48192.1| BnaA04g15560D [Brassica napus]
Length=922

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTNGNASPNGNEEP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK+++VEIS+AAKIP+ A
Sbjct  170  SDGDRKRLRRPNRSKSFRVEISYAAKIPLQA  200



>ref|XP_009140756.1| PREDICTED: protein argonaute 4 [Brassica rapa]
 gb|AGA95981.1| argonaute 4 [Brassica rapa subsp. pekinensis]
Length=922

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTNGNASPNGNEEP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLR+P RSK+++VEIS+AAKIP+ A
Sbjct  170  SDGDRKRLRQPNRSKSFRVEISYAAKIPLQA  200



>ref|XP_007141565.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
 gb|ESW13559.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
Length=904

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARRG  SKG K+ +LTNHF+VNV   DGHFF YSV+L YEDGRPV+ KG+GRKVLD
Sbjct  40   RLPIARRGLASKGTKLRLLTNHFRVNVGNTDGHFFQYSVSLSYEDGRPVEGKGVGRKVLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTS-NRNNGNCSP---GS  476
            RV +TY++EL GK FAYDGEK+LFT+G+L RN+LEFTVVLE+V S +R+NGN SP   G 
Sbjct  100  RVQETYNSELNGKNFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSTSRSNGNVSPDGNGE  159

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             +EGDKKR+RRP R+K++KVEISFA+KIP+ A
Sbjct  160  LSEGDKKRMRRPNRAKSFKVEISFASKIPLQA  191



>ref|XP_007141564.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
 gb|ESW13558.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
Length=907

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARRG  SKG K+ +LTNHF+VNV   DGHFF YSV+L YEDGRPV+ KG+GRKVLD
Sbjct  43   RLPIARRGLASKGTKLRLLTNHFRVNVGNTDGHFFQYSVSLSYEDGRPVEGKGVGRKVLD  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTS-NRNNGNCSP---GS  476
            RV +TY++EL GK FAYDGEK+LFT+G+L RN+LEFTVVLE+V S +R+NGN SP   G 
Sbjct  103  RVQETYNSELNGKNFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSTSRSNGNVSPDGNGE  162

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             +EGDKKR+RRP R+K++KVEISFA+KIP+ A
Sbjct  163  LSEGDKKRMRRPNRAKSFKVEISFASKIPLQA  194



>emb|CDX77061.1| BnaC04g38560D [Brassica napus]
Length=922

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 126/151 (83%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMDRTGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R  GN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTTGNASPNGNEEP  169

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++GD+KRLRRP RSK+++VEIS+AAKIP+ A
Sbjct  170  SDGDRKRLRRPNRSKSFRVEISYAAKIPLQA  200



>ref|XP_007141563.1| hypothetical protein PHAVU_008G206500g [Phaseolus vulgaris]
 gb|ESW13557.1| hypothetical protein PHAVU_008G206500g [Phaseolus vulgaris]
Length=904

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLP+ARRG  SKG K+ +LTNHF+VN+   DGHFF YSV+L YEDGRPV+ KG+GRKVL+
Sbjct  40   RLPIARRGLASKGTKLRLLTNHFRVNIGNTDGHFFQYSVSLCYEDGRPVEGKGVGRKVLE  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN-RNNGNCSP---GS  476
            R+ +TY++EL GK+FAYDGEK+LFT+G+L RN+LEFTVVLE+V SN RNNGN SP   G 
Sbjct  100  RLQETYNSELNGKDFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSNGRNNGNVSPDGNGE  159

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             +E D KR+RRP R+KT+KVEISFA+KIP+ A
Sbjct  160  FSENDTKRMRRPNRAKTFKVEISFASKIPLQA  191



>ref|XP_003592510.1| Protein argonaute 4A [Medicago truncatula]
Length=902

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            ++PMARRG G+ G K+ +LTNHFKVN +  DG FF Y+VA++YEDG PV++ G GRK+LD
Sbjct  37   KVPMARRGLGTTGNKLSLLTNHFKVNAANTDGFFFQYNVAIFYEDGCPVEASGAGRKILD  96

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +V  TYD+EL GK+FAYDGEK+LFT+G+L +NKLEFTVVLE+VTS+RNNGNCSP    S 
Sbjct  97   KVKKTYDSELRGKDFAYDGEKTLFTMGSLAQNKLEFTVVLEDVTSSRNNGNCSPEGIRSS  156

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ D KR+RRP+RSK+YKVEI++A+KIP+ A
Sbjct  157  NDIDSKRIRRPFRSKSYKVEINYASKIPLQA  187



>gb|KEH26048.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=903

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            ++PMARRG G+ G K+ +LTNHFKVN +  DG FF Y+VA++YEDG PV++ G GRK+LD
Sbjct  37   KVPMARRGLGTTGNKLSLLTNHFKVNAANTDGFFFQYNVAIFYEDGCPVEASGAGRKILD  96

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +V  TYD+EL GK+FAYDGEK+LFT+G+L +NKLEFTVVLE+VTS+RNNGNCSP    S 
Sbjct  97   KVKKTYDSELRGKDFAYDGEKTLFTMGSLAQNKLEFTVVLEDVTSSRNNGNCSPEGIRSS  156

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            N+ D KR+RRP+RSK+YKVEI++A+KIP+ A
Sbjct  157  NDIDSKRIRRPFRSKSYKVEINYASKIPLQA  187



>ref|XP_006400685.1| hypothetical protein EUTSA_v10012624mg [Eutrema salsugineum]
 gb|ESQ42138.1| hypothetical protein EUTSA_v10012624mg [Eutrema salsugineum]
Length=903

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR G GSKGQKIP+LTNHF+VN +  +GHFFHYSVA+ YEDGRPV++KGIGR++LD
Sbjct  29   RPPMARPGNGSKGQKIPLLTNHFRVNFNNANGHFFHYSVAITYEDGRPVEAKGIGRRILD  88

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNE  485
            +V +TY T+L  K FAYDGEK+LFTVGALP NKL+F+VVLE+  S RNN GN SP   N+
Sbjct  89   KVQETYQTDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDTPSGRNNTGNASPNETND  148

Query  486  GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            GD+KR RRP +SK + VEIS+AAKIPM+A
Sbjct  149  GDRKRSRRPNQSKKFMVEISYAAKIPMHA  177



>ref|XP_011091875.1| PREDICTED: protein argonaute 4A-like [Sesamum indicum]
Length=909

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMA+RGF S+GQ I +LTNHFKV +S+ DGHF+HYSV++ YED  P D+KGIGRKVLD
Sbjct  40   RVPMAKRGFASRGQSISLLTNHFKVALSRTDGHFYHYSVSIKYEDDSPADAKGIGRKVLD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR---NNGNCSPGSP  479
            +VHDTY +ELAGK FAYDGEKSLFTVG LP+NKLEFTVVLEE++SNR   +  + + GSP
Sbjct  100  KVHDTYASELAGKRFAYDGEKSLFTVGPLPQNKLEFTVVLEEISSNRKIWSGSHGADGSP  159

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KR  R   S+TYKV I++AAKIPM A
Sbjct  160  DESDRKRSCRQRHSRTYKVSINYAAKIPMQA  190



>ref|XP_009126507.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=906

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG GSKGQ+IP+LTNHFKVN +  +G FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  33   LPMARRGTGSKGQRIPLLTNHFKVNFNNANGQFFHYSVAITYEDGRPVEAKGIGRKILDK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V  TY T+L  K FAYDGEK+LFTVG LP NKL+F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQQTYKTDLGSKYFAYDGEKTLFTVGPLPSNKLDFSVVLEDAPSSRNNTGNGSPNESNDA  152

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR +RP +SK + VEIS+AAKIPM+A
Sbjct  153  DRKRSKRPNQSKKFMVEISYAAKIPMHA  180



>emb|CDY09103.1| BnaA02g05290D [Brassica napus]
Length=906

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG GSKGQ+IP+LTNHFKVN +   G FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  33   LPMARRGTGSKGQRIPLLTNHFKVNFNNASGQFFHYSVAITYEDGRPVEAKGIGRKILDK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V  TY T+L  K FAYDGEK+LFTVG LP NKL+F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQQTYKTDLGSKYFAYDGEKTLFTVGPLPSNKLDFSVVLEDAPSSRNNTGNGSPNESNDA  152

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR +RP +SK + VEIS+AAKIPM+A
Sbjct  153  DRKRSKRPNQSKKFMVEISYAAKIPMHA  180



>emb|CDP19981.1| unnamed protein product [Coffea canephora]
Length=866

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M R G  S+GQK+ +LTNHF V V++N+ +F+HYSV++ YEDG PVD+KG+GR++LD+VH
Sbjct  1    MNRLGLASRGQKLRLLTNHFNVKVARNEDYFYHYSVSISYEDGHPVDAKGVGRRILDKVH  60

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEG  488
            +TY +ELAGK+FAYDGEKSLFT+G+LPRNKLEFTVVL+E+ SNRN G+ SP    SPNE 
Sbjct  61   ETYASELAGKDFAYDGEKSLFTIGSLPRNKLEFTVVLDELASNRNVGSGSPEGNSSPNES  120

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +R  RSKTYKV IS+AAKIP+ A
Sbjct  121  DKKRSKRQGRSKTYKVAISYAAKIPVQA  148



>gb|AGS47795.1| argonaute 8 [Salvia miltiorrhiza]
Length=890

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G  ++G+ I +L NHFKV V+  +G+FFHYSV++ YEDG PVD+KGIGR++LD
Sbjct  30   RIPMARPGVATRGRNISLLVNHFKVTVNNTEGYFFHYSVSIKYEDGSPVDAKGIGRRILD  89

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +VH+TY  EL GK+FAYDGEKSLFT+G LP NKLEFTV+L+E+ SNRN G+ SPG+ ++ 
Sbjct  90   KVHETYAAELDGKKFAYDGEKSLFTIGPLPHNKLEFTVILDEIASNRNTGSGSPGADDDL  149

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             KKRLRR  RSKTY V IS+AAKIPM A
Sbjct  150  VKKRLRRQPRSKTYNVAISYAAKIPMQA  177



>ref|XP_002310956.1| hypothetical protein POPTR_0008s01100g [Populus trichocarpa]
 gb|EEE88323.1| hypothetical protein POPTR_0008s01100g [Populus trichocarpa]
Length=923

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG+G+KGQ+I +LTNHFKV V K++ HF+ YSVAL+YEDG P D KGIGRKV+D
Sbjct  41   RVPMARRGYGAKGQRIQLLTNHFKVAVPKSNDHFYQYSVALFYEDGHPTDGKGIGRKVMD  100

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TYD+EL GK+ AYDGEK+LFT G+LP NKLEFTVVLE+V+  R   N S    GSP
Sbjct  101  KVQETYDSELEGKQLAYDGEKTLFTTGSLPHNKLEFTVVLEDVSLTRGGDNDSSRGNGSP  160

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KR +RPY SKT KV+IS+A KIP+ A
Sbjct  161  SESDQKRRKRPYHSKTIKVQISYATKIPVQA  191



>gb|EYU42905.1| hypothetical protein MIMGU_mgv1a001084mg [Erythranthe guttata]
Length=893

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPM R GFGSKGQ IP+LTNHFKV VSK DGHF+HYSVA+ Y+D  PV++KG GRK+L+
Sbjct  24   RLPMVRSGFGSKGQPIPLLTNHFKVAVSKTDGHFYHYSVAIKYDDDTPVEAKGSGRKILE  83

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V+DTY  EL  K FAYDGEK+LFTVG LPRNK EFTV+LE+  SNR+ GN SPG+   G
Sbjct  84   KVYDTYAAELDRKRFAYDGEKTLFTVGPLPRNKFEFTVILEDGQSNRSAGNGSPGADESG  143

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             K+  R+P RSKTYKV I+FAAKIPM A
Sbjct  144  PKRSKRQP-RSKTYKVAINFAAKIPMQA  170



>ref|XP_009120721.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=911

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFHYSVA+ YEDGRPV++KGIGRK+L++
Sbjct  33   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHYSVAITYEDGRPVEAKGIGRKILEK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDGEK+LFTVGALP NKL+F+VVLE+ +S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDTSSSRNNTGNASPNESNDA  152

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP RSK + VEIS+AA+IPM A
Sbjct  153  DRKRSRRPNRSKKFMVEISYAARIPMQA  180



>ref|XP_009801790.1| PREDICTED: protein argonaute 4A-like [Nicotiana sylvestris]
 ref|XP_009801791.1| PREDICTED: protein argonaute 4A-like [Nicotiana sylvestris]
Length=887

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR GFGSKGQKI +LTNHFKV ++ +DG+FFHYSVAL YEDG PV++KGIGRK+LD
Sbjct  15   RVPMARPGFGSKGQKIRLLTNHFKVGMTNSDGYFFHYSVALNYEDGNPVEAKGIGRKILD  74

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN---GNCSPGSP  479
            +V  TY  ELAGK+FAYDGEKSLFT+GALP NKLEFTVVLE+++S+  +   G    GSP
Sbjct  75   KVQQTYALELAGKDFAYDGEKSLFTIGALPHNKLEFTVVLEDLSSSSRSTTLGGSLEGSP  134

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             E DKKR +R  RSK YKV I +AAKIPM A
Sbjct  135  GEADKKRSKRQPRSKAYKVVIKYAAKIPMQA  165



>ref|XP_006347690.1| PREDICTED: protein argonaute 4-like [Solanum tuberosum]
Length=881

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMAR+G GSKGQKI +LTNHFKV ++ +DGHFFHYSVA+ YEDG PV+ KGIGRK+LD
Sbjct  15   RLPMARQGTGSKGQKIRLLTNHFKVGMNNSDGHFFHYSVAINYEDGNPVEVKGIGRKILD  74

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NK EF VVLE+V+S+R       GSP++ 
Sbjct  75   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKFEFDVVLEDVSSSRTTRGSPGGSPSDV  134

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR ++   SK YKV I +AAKIPM A
Sbjct  135  DRKRSKKQPWSKAYKVVIKYAAKIPMQA  162



>ref|XP_011032992.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011032994.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=913

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMARRG+G+KGQ+I +LTNHFKV V K++ HF+ YSV L+YEDG P D KGIGRKV+D
Sbjct  41   RVPMARRGYGAKGQRIQLLTNHFKVAVPKSNDHFYQYSVGLFYEDGHPTDGKGIGRKVMD  100

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TYD+EL GK+ AYDGEK+LFT+G+LP NKLEFTVVLE+V+  R   N S    GSP
Sbjct  101  KVQETYDSELEGKQLAYDGEKTLFTIGSLPHNKLEFTVVLEDVSLTRGGDNDSSRGNGSP  160

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D KR +RPY SKT KV+IS+A KIP+ A
Sbjct  161  SESDLKRRKRPYHSKTIKVQISYATKIPVQA  191



>ref|XP_006432529.1| hypothetical protein CICLE_v10003971mg, partial [Citrus clementina]
 gb|ESR45769.1| hypothetical protein CICLE_v10003971mg, partial [Citrus clementina]
Length=723

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  38   RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  97

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  98   KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  157

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +EGD+KR+RRP RSK  +VEIS+AAKIPM A
Sbjct  158  SEGDRKRMRRPSRSKVIRVEISYAAKIPMQA  188



>ref|XP_010493237.1| PREDICTED: protein argonaute 9-like isoform X3 [Camelina sativa]
Length=723

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN   S    N+ D
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN---SGNDTNDAD  157

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR RRP +SK + VEIS+AAKIPM A
Sbjct  158  RKRSRRPTQSKKFMVEISYAAKIPMQA  184



>gb|KDO53795.1| hypothetical protein CISIN_1g0026362mg, partial [Citrus sinensis]
Length=736

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  38   RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  97

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  98   KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  157

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             EGD+KR+RRP RSK  +VEIS+AAKIPM A
Sbjct  158  GEGDRKRMRRPSRSKVIRVEISYAAKIPMQA  188



>ref|XP_010673246.1| PREDICTED: protein argonaute 4-like [Beta vulgaris subsp. vulgaris]
Length=884

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 127/153 (83%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM+R G+G+KGQKI + TNHF V ++  D +FFHYSVALYYEDG+PV+ KGIGRKV+D
Sbjct  11   RVPMSRPGYGTKGQKIRLCTNHFNVKIANIDDYFFHYSVALYYEDGKPVEMKGIGRKVMD  70

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN--RNNGNCSP---G  473
            ++++TY +E+ GK+FAYDGEK+LFTVG+LPRNKLEFTVVL++V+S   RN+G  SP   G
Sbjct  71   KINETYRSEMGGKDFAYDGEKTLFTVGSLPRNKLEFTVVLDKVSSESCRNDGKSSPGGDG  130

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SP+E DKKR +R  +SKT+ VEIS+A KIPM A
Sbjct  131  SPSENDKKRRKRASQSKTFWVEISYATKIPMKA  163



>dbj|BAC42876.1| putative zwille/pinhead [Arabidopsis thaliana]
Length=304

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+        N+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHAG---NDTNDA  151

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP ++K + VEIS+AAKIPM A
Sbjct  152  DRKRSRRPNQTKKFMVEISYAAKIPMQA  179



>ref|NP_001266010.1| uncharacterized protein LOC101248049 [Solanum lycopersicum]
 ref|XP_010323744.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323747.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323752.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 gb|AFV15383.1| AGO4D [Solanum lycopersicum]
Length=881

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR+G GSKGQKI +LTNHFKV ++  DGHFFHYSVA+ YEDG PV+ KG+GRK+LD
Sbjct  15   RHPMARQGTGSKGQKIRLLTNHFKVGMNNTDGHFFHYSVAINYEDGNPVEVKGVGRKILD  74

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NKLEF VVLE+V+S+R +     GSP++ 
Sbjct  75   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKLEFDVVLEDVSSSRTDRGSPDGSPSDV  134

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR ++   SK YKV I +AAKIPM A
Sbjct  135  DRKRSKKQPWSKAYKVVIKYAAKIPMQA  162



>ref|XP_010323741.1| PREDICTED: uncharacterized protein LOC101248049 isoform X2 [Solanum 
lycopersicum]
Length=901

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR+G GSKGQKI +LTNHFKV ++  DGHFFHYSVA+ YEDG PV+ KG+GRK+LD
Sbjct  35   RHPMARQGTGSKGQKIRLLTNHFKVGMNNTDGHFFHYSVAINYEDGNPVEVKGVGRKILD  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NKLEF VVLE+V+S+R +     GSP++ 
Sbjct  95   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKLEFDVVLEDVSSSRTDRGSPDGSPSDV  154

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR ++   SK YKV I +AAKIPM A
Sbjct  155  DRKRSKKQPWSKAYKVVIKYAAKIPMQA  182



>emb|CDX92405.1| BnaA10g14440D [Brassica napus]
Length=915

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFHYSVA+ YEDGRPV++KGIGRK+L++
Sbjct  35   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHYSVAITYEDGRPVEAKGIGRKILEK  94

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDGEK+LFTVGALP NKL+F++VLE+  S+RNN GN SP   N+ 
Sbjct  95   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKLDFSIVLEDTPSSRNNTGNASPNESNDA  154

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP +SK + VEIS+AA+IPM A
Sbjct  155  DRKRSRRPNQSKKFMVEISYAARIPMQA  182



>ref|XP_010493236.1| PREDICTED: protein argonaute 9-like isoform X2 [Camelina sativa]
Length=882

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN   S    N+ D
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN---SGNDTNDAD  157

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR RRP +SK + VEIS+AAKIPM A
Sbjct  158  RKRSRRPTQSKKFMVEISYAAKIPMQA  184



>ref|XP_010493235.1| PREDICTED: protein argonaute 9-like isoform X1 [Camelina sativa]
Length=901

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN   S    N+ D
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN---SGNDTNDAD  157

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR RRP +SK + VEIS+AAKIPM A
Sbjct  158  RKRSRRPTQSKKFMVEISYAAKIPMQA  184



>ref|XP_007016691.1| Argonaute family protein isoform 4, partial [Theobroma cacao]
 gb|EOY34310.1| Argonaute family protein isoform 4, partial [Theobroma cacao]
Length=667

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 3/121 (2%)
 Frame = +3

Query  219  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  398
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  399  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISFAAKIPMN  569
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+KRLRRPY+SK ++VEISFAAKIPM 
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDRKRLRRPYQSKAFRVEISFAAKIPMQ  120

Query  570  A  572
            A
Sbjct  121  A  121



>ref|XP_007016692.1| Argonaute family protein isoform 5, partial [Theobroma cacao]
 gb|EOY34311.1| Argonaute family protein isoform 5, partial [Theobroma cacao]
Length=675

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 3/121 (2%)
 Frame = +3

Query  219  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  398
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  399  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISFAAKIPMN  569
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+KRLRRPY+SK ++VEISFAAKIPM 
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDRKRLRRPYQSKAFRVEISFAAKIPMQ  120

Query  570  A  572
            A
Sbjct  121  A  121



>ref|XP_006471315.1| PREDICTED: protein argonaute 4B-like [Citrus sinensis]
Length=1271

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  402  RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  461

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  462  KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  521

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +EGD+KR+RRP RSK  +VEIS+AAKIPM A
Sbjct  522  SEGDRKRMRRPSRSKVIRVEISYAAKIPMQA  552



>ref|XP_009416373.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416374.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416375.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416376.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
Length=915

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G G KGQ +P+LTNHFKV+V   D +F+HYSV L YED RPVD KGIGR+V+D
Sbjct  44   RVPMPRPGLGKKGQVVPLLTNHFKVSVRNVDDYFYHYSVLLKYEDDRPVDGKGIGRRVID  103

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  479
            ++H TYD +L  K+FAYDGEKSLFT+GALP  K EFTVVLE+V+S R  GN SP    SP
Sbjct  104  KLHQTYDVDLGNKDFAYDGEKSLFTLGALPHVKNEFTVVLEDVSSARTTGNRSPHGNDSP  163

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             E D KR+RRPYR KT+KVE++FAAKIPM +
Sbjct  164  GESDCKRVRRPYRIKTFKVELNFAAKIPMKS  194



>ref|XP_007016690.1| Argonaute family protein isoform 3, partial [Theobroma cacao]
 gb|EOY34309.1| Argonaute family protein isoform 3, partial [Theobroma cacao]
Length=773

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 3/121 (2%)
 Frame = +3

Query  219  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  398
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  399  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSKTYKVEISFAAKIPMN  569
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+KRLRRPY+SK ++VEISFAAKIPM 
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDRKRLRRPYQSKAFRVEISFAAKIPMQ  120

Query  570  A  572
            A
Sbjct  121  A  121



>emb|CDY16595.1| BnaC09g36780D [Brassica napus]
Length=920

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFH SVA+ YEDGRPV++KGIGRK+L++
Sbjct  33   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHCSVAITYEDGRPVEAKGIGRKILEK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDGEK+LFTVGALP NK++F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKMDFSVVLEDTPSSRNNTGNASPNESNDA  152

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP RSK + VEIS+AA+IPM A
Sbjct  153  DRKRSRRPNRSKKFMVEISYAARIPMQA  180



>ref|XP_007220876.1| hypothetical protein PRUPE_ppa017623mg [Prunus persica]
 gb|EMJ22075.1| hypothetical protein PRUPE_ppa017623mg [Prunus persica]
Length=911

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 124/153 (81%), Gaps = 7/153 (5%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+A+ YEDG PVD KGIGRKVLD
Sbjct  43   RVPMTRPGIGSKGQRIPLLTNHFKVAVNKSDGYFFHYSIAMLYEDGTPVDGKGIGRKVLD  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +V +TY +EL  KEFAYDGEKSLFTVG LPRN+L+F VVL++++S R  G  SPG   +P
Sbjct  103  KVKETYGSELEHKEFAYDGEKSLFTVGPLPRNRLDFLVVLDDISSTRRTG--SPGGSSNP  160

Query  480  NE--GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             E  GD KR+++ ++SKT KV+++FA KIPM A
Sbjct  161  GESAGDMKRVKKQFQSKTLKVQVNFATKIPMQA  193



>ref|XP_008231753.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
Length=910

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 124/151 (82%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+A+ YEDG PVD KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVAVNKSDGYFFHYSIAMLYEDGTPVDGKGIGRKVLD  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR---NNGNCSPGSP  479
            +V +TY +EL  KEFAYDGEKSLFTVG LPRN+L+F VVL++++S R     G+ +PG  
Sbjct  103  KVKETYGSELEHKEFAYDGEKSLFTVGPLPRNRLDFLVVLDDISSTRIGSPGGSSNPGE-  161

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            + GD KR+++ ++SKT KV+++FA KIPM A
Sbjct  162  SAGDMKRVKKQFQSKTLKVQVNFATKIPMQA  192



>gb|AIO05706.1| putative argonaute 4, partial [Cocos nucifera]
Length=714

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR G   +GQ I +LTNHFKV V   D  F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPITLLTNHFKVAVRNVDDCFYHYSVSLKYEDNRPVDGKGIGRRVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE++ S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMASGRTAGNGSPGGHDSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KR RRPY++KT+KVE+SFAAKIPM +
Sbjct  169  SESDRKRQRRPYQTKTFKVELSFAAKIPMQS  199



>ref|XP_002871971.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48230.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  41   LPMARPRGSGSKGQKIPLLTNHFGVKFNKASGYFFHYSVAISYEDGRPVEAKGIGRKILD  100

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE++ S+RNN        N+G
Sbjct  101  KVQETYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDIPSSRNNAG---NDTNDG  157

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP +SK + VEIS+AAKIPM A
Sbjct  158  DRKRSRRPNQSKKFMVEISYAAKIPMQA  185



>ref|XP_008231754.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
 ref|XP_008231755.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
Length=902

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 123/152 (81%), Gaps = 5/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+ + YEDG PV  KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVGVNKSDGYFFHYSIDMLYEDGTPVGEKGIGRKVLD  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN--  482
            +V +TY +EL  KEFAYDGEKSLFTVG+LPRN+L+F +VL++++S R  G+   GS N  
Sbjct  103  KVKETYGSELGHKEFAYDGEKSLFTVGSLPRNRLDFVIVLDDISSIRRTGSAG-GSSNPT  161

Query  483  --EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               GD+KR+++ Y+SKT KV+++FA KIPM A
Sbjct  162  DSAGDRKRVKKQYQSKTLKVQVNFATKIPMQA  193



>ref|XP_010420963.1| PREDICTED: protein argonaute 9 [Camelina sativa]
Length=902

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  41   LPMARPRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILD  100

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN   S    N+ 
Sbjct  101  KVQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN---SGNDTNDA  157

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP +SK + VEIS+AAKIPM A
Sbjct  158  DRKRSRRPTQSKKFMVEISYAAKIPMQA  185



>ref|XP_009590319.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590320.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590321.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590322.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590323.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590324.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
Length=887

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G GSKGQKI +LTNHFKV ++ +DG+FFHYSVAL YEDG PV++KGIGRK+LD
Sbjct  15   RVPMARLGIGSKGQKIRLLTNHFKVGMTNSDGYFFHYSVALNYEDGNPVEAKGIGRKILD  74

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            +V  TY  ELAGK+FAYDGEKSLFT+GALP NKLEFTVVLE+++S+  +         SP
Sbjct  75   KVQQTYALELAGKDFAYDGEKSLFTIGALPHNKLEFTVVLEDLSSSSRSTTRGGSLERSP  134

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             E DKKR +R  RSK YKV I +AAKIPM A
Sbjct  135  GEADKKRSKRQPRSKAYKVVIKYAAKIPMQA  165



>gb|AET00057.2| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=892

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            + PMARRG G+KG K+P+LTNHF+VNV+  +  FF YSVAL+YEDGRPV+ KG GRK++D
Sbjct  38   KAPMARRGLGTKGAKLPLLTNHFEVNVANTNRVFFQYSVALFYEDGRPVEGKGAGRKIID  97

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TYD+EL GK+ AYDGE +LFT+G+L + KLEF VV+E+V SNRNN N SP      
Sbjct  98   KVQETYDSELNGKDLAYDGE-TLFTIGSLAQKKLEFIVVVEDVASNRNNANTSP------  150

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR+R+ YRSKTYKVEI+FA +IP+ A
Sbjct  151  DKKRIRKSYRSKTYKVEINFAKEIPLQA  178



>ref|NP_197613.2| argonaute 9 [Arabidopsis thaliana]
 sp|Q84VQ0.2|AGO9_ARATH RecName: Full=Protein argonaute 9 [Arabidopsis thaliana]
 gb|AED92940.1| Argonaute family protein [Arabidopsis thaliana]
Length=896

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+        N+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHAG---NDTNDA  151

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP ++K + VEIS+AAKIPM A
Sbjct  152  DRKRSRRPNQTKKFMVEISYAAKIPMQA  179



>emb|CAD66636.1| ARGONAUTE9 protein [Arabidopsis thaliana]
Length=896

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+        N+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHAG---NDTNDA  151

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP ++K + VEIS+AAKIPM A
Sbjct  152  DRKRSRRPNQTKKFMVEISYAAKIPMQA  179



>gb|AAO73892.1| PAZ (Piwi Argonaut and Zwille) family [Arabidopsis thaliana]
Length=892

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+        N+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHAG---NDTNDA  151

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR RRP ++K + VEIS+AAKIPM A
Sbjct  152  DRKRSRRPNQTKKFMVEISYAAKIPMQA  179



>ref|XP_007219668.1| hypothetical protein PRUPE_ppa025242mg [Prunus persica]
 gb|EMJ20867.1| hypothetical protein PRUPE_ppa025242mg [Prunus persica]
Length=872

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 5/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+ G+FFHYS+ + YEDG PV  KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVGVNKSGGYFFHYSIDMLYEDGTPVGEKGIGRKVLD  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN--  482
            +V +TY +EL  KEFAYDGEKSLFTVG+LPRN+L+F +VL+ ++S R  G+   GS N  
Sbjct  103  KVKETYGSELGHKEFAYDGEKSLFTVGSLPRNRLDFVIVLDGISSIRRTGSAG-GSSNPT  161

Query  483  --EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               GD+KR+++ Y+SKT KV+++FA KIPM A
Sbjct  162  DSAGDRKRVKKQYQSKTLKVQVNFATKIPMQA  193



>emb|CAH65970.1| H0820C10.3 [Oryza sativa Indica Group]
 gb|EEC76718.1| hypothetical protein OsI_14737 [Oryza sativa Indica Group]
Length=911

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR G G KGQ I +L NH+KV+V  ++ +FFHY+V L YED RPVD KG+GRKV+D
Sbjct  43   RFPMARPGLGRKGQPIQLLANHYKVSVKSSEEYFFHYNVILKYEDDRPVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY +EL+ K+FAYDGEKSLFT+GALP+   EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRSELSSKDFAYDGEKSLFTIGALPQVTNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               D+KR+RRPY++KT+KVE+ FAAKIPMNA
Sbjct  163  GGSDRKRVRRPYQTKTFKVELCFAAKIPMNA  193



>ref|XP_008805346.1| PREDICTED: protein argonaute 4B-like isoform X2 [Phoenix dactylifera]
Length=852

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR G   +GQ I +LTNHF+V V   D +F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPINLLTNHFRVAVRNVDDYFYHYSVSLKYEDDRPVDGKGIGRRVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE+++S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMSSGR-TGNGSPGGHDSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KR RRPY +KT+KVE+SFAAKIPM +
Sbjct  168  SESDRKRQRRPYHAKTFKVELSFAAKIPMQS  198



>ref|NP_001052115.1| Os04g0151800 [Oryza sativa Japonica Group]
 sp|Q0JF58.1|AGO4B_ORYSJ RecName: Full=Protein argonaute 4B; Short=OsAGO4b [Oryza sativa 
Japonica Group]
 dbj|BAF14029.1| Os04g0151800 [Oryza sativa Japonica Group]
 gb|EEE60454.1| hypothetical protein OsJ_13701 [Oryza sativa Japonica Group]
Length=911

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR G G KGQ I +L NH+KV+V  ++ +FFHY+V L YED RPVD KG+GRKV+D
Sbjct  43   RFPMARPGLGRKGQPIQLLANHYKVSVKSSEEYFFHYNVILKYEDDRPVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY +EL+ K+FAYDGEKSLFT+GALP+   EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRSELSSKDFAYDGEKSLFTIGALPQVTNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               D+KR+RRPY++KT+KVE+ FAAKIPMNA
Sbjct  163  GGSDRKRVRRPYQTKTFKVELCFAAKIPMNA  193



>ref|XP_008375403.1| PREDICTED: protein argonaute 4A-like [Malus domestica]
Length=911

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 7/153 (5%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G G+KGQKIP+LTNHFKV V+K+D +FFHYS+A+ YEDG PVD KGIGRKV+D
Sbjct  43   RVPMARSGNGTKGQKIPLLTNHFKVAVNKSDEYFFHYSIAMSYEDGTPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG-----  473
            +V  TY  ELA KEFAYDGEKSLFTVG LP N+LEFTVVL++++S R     SPG     
Sbjct  103  KVKQTYAMELADKEFAYDGEKSLFTVGPLPHNRLEFTVVLDDISSTRRTA--SPGGGSNR  160

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            + +EGD+KR+++ ++SK   V I++A KIPM A
Sbjct  161  ADSEGDRKRVKKQFQSKQLNVLINYATKIPMQA  193



>ref|XP_008805343.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805344.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805345.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
Length=919

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR G   +GQ I +LTNHF+V V   D +F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPINLLTNHFRVAVRNVDDYFYHYSVSLKYEDDRPVDGKGIGRRVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE+++S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMSSGR-TGNGSPGGHDSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E D+KR RRPY +KT+KVE+SFAAKIPM +
Sbjct  168  SESDRKRQRRPYHAKTFKVELSFAAKIPMQS  198



>ref|XP_010251689.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
 ref|XP_010251690.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
 ref|XP_010251691.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
Length=921

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G G KG+ I +L+NHF+VNV      FFHYSV++ YEDGRP + KGIGR+V+D
Sbjct  48   RVPMARPGMGRKGKPIQLLSNHFRVNVVNVTSIFFHYSVSICYEDGRPAEGKGIGRRVMD  107

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR---NNGNCSPGSP  479
            +VH+TYDTEL GK+ AYDGEKSLFTVG LPRNKLEFTVVLE+++SNR   N      GSP
Sbjct  108  KVHETYDTELEGKDLAYDGEKSLFTVGPLPRNKLEFTVVLEDLSSNRAAGNGSPGGSGSP  167

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            NE ++KRLRR ++SKT+KVEISFAAKI M A
Sbjct  168  NESERKRLRRQFQSKTFKVEISFAAKIQMQA  198



>ref|XP_010943265.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943266.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943267.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943268.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
Length=920

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 115/151 (76%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+ R G   +GQ I +LTNHF+V V   D  F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVTRPGLAKRGQPITLLTNHFRVAVRNVDDCFYHYSVSLKYEDNRPVDGKGIGRRVID  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE++ S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMGSGRTAGNGSPGGNDSP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             E D+KR RRPY++KT+KVE+SFA KIPM +
Sbjct  169  GESDRKRQRRPYQTKTFKVELSFATKIPMQS  199



>ref|XP_008778689.1| PREDICTED: protein argonaute 4B-like [Phoenix dactylifera]
Length=920

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PMAR G  S+GQ I +LTNHF+V+V   DG+F+HYSV+L YED  PVD  G+GR+V+D
Sbjct  49   RVPMARPGLASRGQPITLLTNHFRVSVQNLDGYFYHYSVSLKYEDNHPVDGNGVGRRVMD  108

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TYDTEL  K+FAYDGEK+LFT+GALP+   EFTVVLE+++S+R  G+ S G    P
Sbjct  109  KLQQTYDTELGNKDFAYDGEKNLFTMGALPQVNNEFTVVLEDISSSRTAGDGSLGGNDGP  168

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +E  +KRLRRPY++KT+KVE+SFAA+IPM +
Sbjct  169  SESVRKRLRRPYQTKTFKVELSFAARIPMQS  199



>ref|XP_006287018.1| hypothetical protein CARUB_v10000166mg [Capsella rubella]
 gb|EOA19916.1| hypothetical protein CARUB_v10000166mg [Capsella rubella]
Length=922

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  132  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMAR RG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  61   LPMARPRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILD  120

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNE  485
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN GN      ++
Sbjct  121  KVQETYRSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNNTGN----ETDD  176

Query  486  GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             D+KR +RP +SK + VEIS+AAKIPM A
Sbjct  177  ADRKRSKRPNQSKKFMVEISYAAKIPMQA  205



>ref|XP_002264978.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
Length=889

 Score =   188 bits (478),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  299
            RLPMARRG G  G+ I ++TNHFKV++  N     HF+ Y+V+L +EDG P D+K IGRK
Sbjct  21   RLPMARRGLGRTGETIQLVTNHFKVSMHSNANTGAHFYQYNVSLAHEDGHPADAKDIGRK  80

Query  300  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSP  479
            V+D+VH+TY TE+AG  FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR +   +  SP
Sbjct  81   VMDKVHETYHTEMAGMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNRISTTRNIDSP  140

Query  480  NEG-DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++G D+KR RRPY SKT+ VEISFAAK PM++
Sbjct  141  DDGSDRKRSRRPYHSKTFNVEISFAAKFPMDS  172



>ref|XP_006652094.1| PREDICTED: protein argonaute 4B-like [Oryza brachyantha]
Length=911

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR G G KGQ I +  NH+KV+V   +  FFHY+V L YED R VD KG+GRKV+D
Sbjct  43   RFPMARPGLGKKGQPIQLYANHYKVSVKSTEEFFFHYNVILKYEDDRLVDGKGVGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY +EL+ KEFAYDGEKSLFT+GALP+   EFTVVLE+VT+ +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKEFAYDGEKSLFTIGALPQVNNEFTVVLEDVTTGKTAANGSPGGSDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               D+KRLRRPY++K++KVE+ FAAKIPM+A
Sbjct  163  GGSDRKRLRRPYQTKSFKVELCFAAKIPMSA  193



>emb|CDY59516.1| BnaCnng35060D [Brassica napus]
Length=906

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+ YSV + YEDG P+++KG+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYRYSVTITYEDGSPMEAKGVFRKILEK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDG+K+LFT+G LP NK++F VVLE   S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGQKNLFTIGVLPSNKMDFLVVLENTPSSRNNTGNASPNETNDA  152

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR R P+RSK + VEIS+AA+IPM A
Sbjct  153  DRKRSRLPHRSKKFMVEISYAARIPMQA  180



>ref|NP_001169445.1| argonaute104 [Zea mays]
 gb|ACN33790.1| unknown [Zea mays]
 gb|AFW79427.1| argonaute104 [Zea mays]
Length=560

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>gb|AFW79428.1| argonaute104 [Zea mays]
Length=633

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>ref|XP_009120723.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=903

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+HYSV + YEDG P+++ G+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYHYSVTITYEDGSPMEAIGVFRKILEK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDG K+LFT+GALP NK++F VVLE   S+RNN GN    SPN+ 
Sbjct  93   VQETYRTDLGSKYFAYDGHKNLFTIGALPSNKMDFLVVLENTPSSRNNTGN---ASPNDA  149

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR R P+RSK + VEIS+AA+IPM A
Sbjct  150  DRKRSRLPHRSKKFMVEISYAARIPMQA  177



>emb|CDX92406.1| BnaA10g14450D [Brassica napus]
Length=904

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+HYSV + YEDG P+++ G+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYHYSVTITYEDGSPMEAIGVFRKILEK  92

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  488
            V +TY T+L  K FAYDG K+LFT+GALP NK++F VVLE   S+RNN GN    SPN+ 
Sbjct  93   VQETYRTDLGSKYFAYDGHKNLFTIGALPSNKMDFLVVLENTPSSRNNTGN---ASPNDA  149

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            D+KR R P+RSK + VEIS+AA+IPM A
Sbjct  150  DRKRSRLPHRSKKFMVEISYAARIPMQA  177



>ref|XP_008648109.1| PREDICTED: argonaute104 isoform X5 [Zea mays]
Length=890

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>ref|XP_008648108.1| PREDICTED: argonaute104 isoform X4 [Zea mays]
Length=901

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>ref|XP_008648107.1| PREDICTED: argonaute104 isoform X3 [Zea mays]
 gb|AFW79429.1| argonaute104 [Zea mays]
Length=910

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>ref|XP_008648106.1| PREDICTED: argonaute104 isoform X2 [Zea mays]
Length=917

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>ref|XP_006644052.1| PREDICTED: protein argonaute 4A-like [Oryza brachyantha]
Length=905

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  M R G+G KGQ I +LTNHFKV++   D  F+HY V L YED RPVD KG+GRKV+D
Sbjct  37   RALMPRAGYGKKGQPIQLLTNHFKVSLKTTDEFFYHYYVNLKYEDDRPVDGKGVGRKVID  96

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNE  485
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EFTVVLE+V + ++  N  SPG+ + 
Sbjct  97   KLQQTYASELANKDFAYDGEKSLFTIGALPQVNNEFTVVLEDVNTGKSAANGGSPGNESP  156

Query  486  G-DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            G DKKR+RRPY++KT+KVE++FAAKIPM+A
Sbjct  157  GNDKKRVRRPYQTKTFKVELNFAAKIPMSA  186



>ref|XP_008648104.1| PREDICTED: argonaute104 isoform X1 [Zea mays]
 ref|XP_008648105.1| PREDICTED: argonaute104 isoform X1 [Zea mays]
Length=940

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAA++PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAEVPMSA  193



>emb|CBI40895.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   183 bits (465),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 91/152 (60%), Positives = 116/152 (76%), Gaps = 8/152 (5%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  299
            RLPMARRG G  G+ I ++TNHFKV++  N     HF+ Y+V+L +EDG P D+K IGRK
Sbjct  21   RLPMARRGLGRTGETIQLVTNHFKVSMHSNANTGAHFYQYNVSLAHEDGHPADAKDIGRK  80

Query  300  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSP  479
            V+D+VH+TY TE+AG  FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR    C+   P
Sbjct  81   VMDKVHETYHTEMAGMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNRY--KCT--FP  136

Query  480  NEG-DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++G D+KR RRPY SKT+ VEISFAAK PM++
Sbjct  137  DDGSDRKRSRRPYHSKTFNVEISFAAKFPMDS  168



>ref|NP_001167850.1| putative argonaute family protein [Zea mays]
 ref|XP_008655164.1| PREDICTED: putative argonaute family protein isoform X1 [Zea 
mays]
 ref|XP_008655165.1| PREDICTED: putative argonaute family protein isoform X1 [Zea 
mays]
 gb|ACN26293.1| unknown [Zea mays]
 gb|AFW79548.1| putative argonaute family protein [Zea mays]
Length=898

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            + R GFG KGQ+I ++TNHFKV++ K +  F+HY V L YED  PVD KG GRKV++++ 
Sbjct  39   VQRNGFGRKGQQIKLITNHFKVSLMKAEDFFYHYYVNLKYEDDTPVDRKGSGRKVIEKLQ  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPNEGD  491
             TY  ELA K+FAYDGEKSLFT+GALP+ K+EFTVV E+V++ +   N SPG  SP   D
Sbjct  99   QTYAAELANKDFAYDGEKSLFTIGALPQVKMEFTVVDEDVSTGKTPANGSPGNDSPPGSD  158

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR+RRPY +KTYKVE+SFAAKIPM+A
Sbjct  159  RKRVRRPYNTKTYKVELSFAAKIPMSA  185



>ref|XP_004967701.1| PREDICTED: protein argonaute 4A-like [Setaria italica]
Length=902

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+ + R+GFG KGQ I ++TNHFKV++   +  FFHY V L YED  PVD KG GR V++
Sbjct  37   RVLVPRKGFGKKGQPIRLVTNHFKVSLKNTEEFFFHYYVNLKYEDDTPVDRKGAGRSVIE  96

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  482
            ++  TY TELA K+FAYDGEKSLFT+GALP+   EFTVV+E+V++ +   N SPG  SP 
Sbjct  97   KLQQTYATELANKDFAYDGEKSLFTIGALPQVNNEFTVVVEDVSTGKTPANGSPGNDSPP  156

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              D+KR+RRPY +KTYKVE+SFAA+IPMNA
Sbjct  157  GSDRKRVRRPYNTKTYKVELSFAARIPMNA  186



>emb|CAN61334.1| hypothetical protein VITISV_044457 [Vitis vinifera]
Length=855

 Score =   181 bits (459),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  299
            RLPMARRG G  G+ I ++ NHFKV++  N     HF+ Y+V+L  EDG P D+K IGRK
Sbjct  137  RLPMARRGLGRTGETIQLVXNHFKVSMHSNANTGAHFYQYNVSLAXEDGHPADAKDIGRK  196

Query  300  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSP  479
            V+D+VH+TY TE+A   FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR +   +   P
Sbjct  197  VMDKVHETYHTEMAXMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNRISTXRNIDXP  256

Query  480  NEG-DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++G D+KR RRPY SKT+ VEISFAAK PM++
Sbjct  257  DDGSDRKRSRRPYHSKTFNVEISFAAKFPMDS  288



>ref|NP_001042722.1| Os01g0275600 [Oryza sativa Japonica Group]
 sp|Q9SDG8.1|AGO4A_ORYSJ RecName: Full=Protein argonaute 4A; Short=OsAGO4a [Oryza sativa 
Japonica Group]
 dbj|BAA88176.1| putative zwille protein [Oryza sativa Japonica Group]
 dbj|BAF04636.1| Os01g0275600 [Oryza sativa Japonica Group]
Length=904

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = +3

Query  24   EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  203
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  2    ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  61

Query  204  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  383
            ++   D  F HY V L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  62   SLKAADEFFHHYYVNLKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  121

Query  384  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEG-DKKRLRRPYRSKTYKVEISFAAK  557
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G D+KR+RRPY++KT+KVE++FAAK
Sbjct  122  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGNDRKRVRRPYQTKTFKVELNFAAK  181

Query  558  IPMNA  572
            IPM+A
Sbjct  182  IPMSA  186



>ref|XP_010694897.1| PREDICTED: protein argonaute 4A-like [Beta vulgaris subsp. vulgaris]
Length=930

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 10/158 (6%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RLPM R G GSKGQKI ++TNHF+V +  +DGHF+ YSV + YEDG  V++KGIGR+VLD
Sbjct  53   RLPMVRCGLGSKGQKIQLITNHFQVKMPNSDGHFYQYSVKMSYEDGTAVEAKGIGRRVLD  112

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN-------RNNGNCS  467
            ++H+TY++EL GK FAYDG+K+LFT+GALP  K++F V+LE+  SN          G   
Sbjct  113  KLHETYESELGGKHFAYDGDKTLFTLGALPCTKVDFDVILEDQQSNRSGGRGGSPGGRGG  172

Query  468  PGSPNE---GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              + NE   G++KRLRRP RSKTYKVEI++A KIP+ A
Sbjct  173  SPTENEDPNGERKRLRRPQRSKTYKVEITYATKIPLQA  210



>ref|XP_004308183.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
 ref|XP_011468750.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
Length=915

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 118/153 (77%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G GS+GQKI ++TNHFKV ++K++  F+HYS+A+ Y+DG  VD KGIGRKVLD
Sbjct  42   RVPMKRPGIGSQGQKISLVTNHFKVGLNKSNTEFYHYSIAMQYDDGTEVDGKGIGRKVLD  101

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG-----  473
            +V +TY  EL  KEFAYDGEKSLFTVG LPR +LEFTVVL +++S+R+  N   G     
Sbjct  102  KVKETYILELENKEFAYDGEKSLFTVGQLPRKQLEFTVVLNDISSSRSGTNGVSGGSYSL  161

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              ++GD+KR+++ ++SKT +V+++FAAKI M A
Sbjct  162  EESQGDRKRVKQSFQSKTIQVQVNFAAKISMQA  194



>ref|XP_003617098.1| Protein argonaute 4A [Medicago truncatula]
Length=929

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 119/178 (67%), Gaps = 37/178 (21%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSV---------------------  245
            + PMARRG G+KG K+P+LTNHF+VNV+  +  FF YSV                     
Sbjct  38   KAPMARRGLGTKGAKLPLLTNHFEVNVANTNRVFFQYSVCFVFYDSVVFLRTFVLIFLFV  97

Query  246  ---------ALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  398
                     AL+YEDGRPV+ KG GRK++D+V +TYD+EL GK+ AYDGE +LFT+G+L 
Sbjct  98   GSYYVFVQVALFYEDGRPVEGKGAGRKIIDKVQETYDSELNGKDLAYDGE-TLFTIGSLA  156

Query  399  RNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            + KLEF VV+E+V SNRNN N SP      DKKR+R+ YRSKTYKVEI+FA +IP+ A
Sbjct  157  QKKLEFIVVVEDVASNRNNANTSP------DKKRIRKSYRSKTYKVEINFAKEIPLQA  208



>ref|XP_002440386.1| hypothetical protein SORBIDRAFT_09g030910 [Sorghum bicolor]
 gb|EES18816.1| hypothetical protein SORBIDRAFT_09g030910 [Sorghum bicolor]
Length=909

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED +PV+ KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQLAQLYSNHFKVAVKSTEDFFFHYYVNLKYEDDQPVEGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+   EFTVVLE+ ++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKNNEFTVVLEDASTGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RRPY++KT+KVEI+FAAK+PM+A
Sbjct  163  GGGDRKRVRRPYQTKTFKVEINFAAKVPMSA  193



>gb|EAZ11412.1| hypothetical protein OsJ_01273 [Oryza sativa Japonica Group]
Length=190

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            +LPM+R+GFG+KGQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTKGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEV-----TSNRNNGNCSPG  473
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+      T+ R +     G
Sbjct  67   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSSGRTTTRRSSGGDDG  126

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SP   D+KR++RP   K + VEISFAAK PM+A
Sbjct  127  SPGGSDRKRMKRPMAVKKFMVEISFAAKDPMSA  159



>ref|XP_004960964.1| PREDICTED: protein argonaute 4B-like isoform X2 [Setaria italica]
Length=872

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G G KGQ I + +NHFKV+V   +  F HY V L YED RPV+ KGIGRKV+D
Sbjct  43   RVPMVRPGIGRKGQSIQLYSNHFKVSVKSTEDFFVHYHVNLKYEDDRPVEGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY +EL+ K+FAYDGEKSLFTVG LP    EFTVVLE+  + +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKDFAYDGEKSLFTVGELPHKNNEFTVVLEDAATGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RR Y+ KT KVE+++AAKIPM+A
Sbjct  163  GGGDRKRVRRSYQPKTLKVELTYAAKIPMSA  193



>gb|EMS68540.1| Protein argonaute 4A [Triticum urartu]
Length=916

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  110

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG+ +  
Sbjct  111  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPGN-DSP  169

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR++RPY++KT+KVE+SFAA+IPM+A
Sbjct  170  DKKRVKRPYQTKTFKVELSFAARIPMSA  197



>gb|AGB34311.1| Argonaute [Triticum aestivum]
Length=916

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  110

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG+ +  
Sbjct  111  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPGN-DSP  169

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR++RPY++KT+KVE+SFAA+IPM+A
Sbjct  170  DKKRVKRPYQTKTFKVELSFAARIPMSA  197



>ref|XP_004960963.1| PREDICTED: protein argonaute 4B-like isoform X1 [Setaria italica]
Length=910

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G G KGQ I + +NHFKV+V   +  F HY V L YED RPV+ KGIGRKV+D
Sbjct  43   RVPMVRPGIGRKGQSIQLYSNHFKVSVKSTEDFFVHYHVNLKYEDDRPVEGKGIGRKVID  102

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  479
            ++  TY +EL+ K+FAYDGEKSLFTVG LP    EFTVVLE+  + +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKDFAYDGEKSLFTVGELPHKNNEFTVVLEDAATGKTAANGSPGGNDSP  162

Query  480  NEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              GD+KR+RR Y+ KT KVE+++AAKIPM+A
Sbjct  163  GGGDRKRVRRSYQPKTLKVELTYAAKIPMSA  193



>gb|AGO99010.1| argonaute 4, partial [Triticum aestivum]
Length=969

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  104  RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  163

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG+ +  
Sbjct  164  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPGN-DSP  222

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR++RPY++KT+KVE+SFAA+IPM+A
Sbjct  223  DKKRVKRPYQTKTFKVELSFAARIPMSA  250



>ref|XP_010252577.1| PREDICTED: protein argonaute 16 isoform X2 [Nelumbo nucifera]
Length=857

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LP+ R GFG +G++I +LTNHFKV     DG FF YSV++  +D R V+ KGIGRKV+D+
Sbjct  32   LPIRRSGFGKEGRRISLLTNHFKVTFGAMDGIFFQYSVSIISDDKRAVEGKGIGRKVIDK  91

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            ++ TY +E  GK FAYDGEKSL+TVG+LP+N  EFTVVLEE +  RN      GSP EGD
Sbjct  92   LYQTYASEFEGKTFAYDGEKSLYTVGSLPQNNFEFTVVLEESSFKRN------GSPTEGD  145

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR R+ Y+SK +KVEISF+AKIPM +
Sbjct  146  RKRSRQSYQSKLFKVEISFSAKIPMKS  172



>ref|XP_010252575.1| PREDICTED: protein argonaute 16 isoform X1 [Nelumbo nucifera]
 ref|XP_010252576.1| PREDICTED: protein argonaute 16 isoform X1 [Nelumbo nucifera]
Length=893

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LP+ R GFG +G++I +LTNHFKV     DG FF YSV++  +D R V+ KGIGRKV+D+
Sbjct  32   LPIRRSGFGKEGRRISLLTNHFKVTFGAMDGIFFQYSVSIISDDKRAVEGKGIGRKVIDK  91

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            ++ TY +E  GK FAYDGEKSL+TVG+LP+N  EFTVVLEE +  RN      GSP EGD
Sbjct  92   LYQTYASEFEGKTFAYDGEKSLYTVGSLPQNNFEFTVVLEESSFKRN------GSPTEGD  145

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KR R+ Y+SK +KVEISF+AKIPM +
Sbjct  146  RKRSRQSYQSKLFKVEISFSAKIPMKS  172



>gb|EEC70394.1| hypothetical protein OsI_01365 [Oryza sativa Indica Group]
Length=706

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            +LPM+R+GFG++GQ I +LTN+F+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTRGQSIQLLTNYFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN-RNNGNCSP----G  473
            ++ +TY +ELAG+EFAYDGEK LFT GAL + K +F VV+E+ +S+ R     SP    G
Sbjct  67   KLQETYASELAGREFAYDGEKGLFTAGALLQTKHQFVVVMEDASSSGRTTTRRSPGGDDG  126

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SP   D+KR+++P   K + VEISFAAK+PM+A
Sbjct  127  SPRGSDRKRMKQPMAVKKFMVEISFAAKVPMSA  159



>ref|XP_008347021.1| PREDICTED: protein argonaute 4B-like [Malus domestica]
Length=330

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 113/152 (74%), Gaps = 5/152 (3%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            +PM+R GFGS+G+ I + TNHFKV V  +DG+FFHYS+ ++YEDG PV +  IGRKV+++
Sbjct  44   VPMSRPGFGSRGKSIQLTTNHFKVGVKISDGYFFHYSIDMFYEDGTPVTANAIGRKVVEK  103

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS---PN  482
            V +TYD +L  KEFAYDG+K+LFTVG+LP  +L+F VVL+ ++S+R  GN    S   P 
Sbjct  104  VKETYDRDLGRKEFAYDGQKNLFTVGSLPHKRLDFVVVLDNISSSRRIGNVGGSSSYDPA  163

Query  483  E--GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E   D+KRL+  ++SKT KV I++A KIPM A
Sbjct  164  ESGSDRKRLKHSFQSKTIKVLINYAXKIPMQA  195



>ref|XP_010230772.1| PREDICTED: protein argonaute 4A [Brachypodium distachyon]
Length=924

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  ++R GFG  G+ I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  55   RTLISRPGFGKNGKPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  114

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNE-  485
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG+ N  
Sbjct  115  KLQQTYASELAHKDFAYDGEKSLFTIGALPQVNNEFVVVLEDVSSGKTAANGSPGNDNSP  174

Query  486  -GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              D+KR+RRPY++KT+KVE++FA++IPM++
Sbjct  175  GSDRKRVRRPYQTKTFKVELNFASRIPMSS  204



>ref|XP_008803511.1| PREDICTED: LOW QUALITY PROTEIN: protein argonaute 16-like [Phoenix 
dactylifera]
Length=906

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMARRGFGS G+ I +L+NHF V  +  D  F+HYS  +  ED   V +KG+GRK++D
Sbjct  40   RSPMARRGFGSDGRHIQLLSNHFSVRFTAQDAVFYHYSATIKSEDKHAVVAKGMGRKIMD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS-PGSPNE  485
            +++ TY +ELAGKEFAYDGEKSLFT+G LP+N  EFTVVLEE + +R  G  S   SP+E
Sbjct  100  KLYQTYSSELAGKEFAYDGEKSLFTIGPLPQNNFEFTVVLEESSVSRVAGVSSGNASPSE  159

Query  486  GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            GD+KR +R + +K + VEIS+AAKIP+N+
Sbjct  160  GDRKRSKRLHLAKKFNVEISYAAKIPLNS  188



>ref|XP_002874028.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50287.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=848

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 110/148 (74%), Gaps = 13/148 (9%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGH-FFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMARRG GSKG+KI +LTNHF+VN S+ + H FFHYSVA+ YEDG PV++KGIGRK+L+
Sbjct  13   LPMARRGNGSKGKKIHLLTNHFRVNFSQPNNHDFFHYSVAITYEDGSPVEAKGIGRKILE  72

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY T+L  K FAYDG+K+LFT G LP + LEF+VVLE+++S RN G          
Sbjct  73   KVQQTYQTDLGFKHFAYDGDKNLFTAGPLPGSNLEFSVVLEDMSSRRNAG----------  122

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              KRLR  ++SK + V ISFAAKIPM A
Sbjct  123  --KRLRLSHQSKKFNVAISFAAKIPMKA  148



>ref|XP_010943243.1| PREDICTED: protein argonaute 16-like [Elaeis guineensis]
Length=906

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PM R GFGS G+ I +L+NHF V  +  D  F+HY+V +  ED   V++KG+GRK++D
Sbjct  40   RSPMVRCGFGSGGRHIQLLSNHFSVRFTAQDAAFYHYTVTIKSEDKHAVEAKGMGRKIMD  99

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  482
            +++ TY +ELAGKEFAYDGEKSLFTVG LP+N  EFTVVLEE +S R  G  SPG  SP+
Sbjct  100  KLYQTYSSELAGKEFAYDGEKSLFTVGPLPQNNFEFTVVLEE-SSLRRVGGLSPGNASPS  158

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            EGD+KR +    +K + +EIS+AAKIP+N+
Sbjct  159  EGDRKRSKHSRLAKKFNIEISYAAKIPLNS  188



>dbj|BAC84805.1| putative ARGONAUTE9 protein [Oryza sativa Japonica Group]
 dbj|BAD32046.1| putative ARGONAUTE9 protein [Oryza sativa Japonica Group]
Length=889

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ YSV++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGIDAVFYQYSVSIKSEDDKVIDGKGIGRKVMD  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  79   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  138

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +  + +K   V IS+AAKIP+ +
Sbjct  139  DKKRSKCTHLAKKIVVGISYAAKIPLKS  166



>sp|Q6YSJ5.2|AGO16_ORYSJ RecName: Full=Protein argonaute 16; Short=OsAGO16; AltName: Full=OsAGO6; 
AltName: Full=Protein ZWILLE/PINHEAD-like 1 [Oryza 
sativa Japonica Group]
Length=883

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ YSV++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGIDAVFYQYSVSIKSEDDKVIDGKGIGRKVMD  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  79   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  138

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +  + +K   V IS+AAKIP+ +
Sbjct  139  DKKRSKCTHLAKKIVVGISYAAKIPLKS  166



>emb|CDY16587.1| BnaC09g36860D [Brassica napus]
Length=882

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 5/147 (3%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            L MAR G GS+GQKI +LTNHF VN +    HFF YSVA+ YEDG PV++KGIGRK+L +
Sbjct  9    LQMARSGNGSRGQKIDLLTNHFGVNFTSKSQHFFQYSVAITYEDGNPVEAKGIGRKILAK  68

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            V +TY T+L  K FAYDG+K+LFTVG LP NKL+F+VVLE+++  R+N + S     + +
Sbjct  69   VQETYQTDLGSKHFAYDGDKTLFTVGPLPNNKLDFSVVLEDMSCTRSNTSTS-----DAN  123

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
             KRLR   +SK + V ISFAAKI M A
Sbjct  124  TKRLRPHNQSKRFNVAISFAAKISMQA  150



>ref|XP_004298218.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
Length=888

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+PM R G GS+GQ+IP+LTNHF+V ++K+   F+HYS+A+ Y+DG PVD K +GRKVLD
Sbjct  25   RVPMRRPGLGSRGQRIPLLTNHFQVGMNKSKDDFYHYSIAMQYDDGTPVDGKCVGRKVLD  84

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V + Y  ELA KEFAYDGEK+LFT G LP  +LEF +VL++++++ + G  S     EG
Sbjct  85   KVKEVYGKELAYKEFAYDGEKTLFTGGQLPHKRLEFMIVLDDISASTSGG--SGRQEREG  142

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            ++KR+++ +RSK  KV+ + AA IPM A
Sbjct  143  NRKRVKQFFRSKKIKVQFNLAAIIPMQA  170



>ref|XP_008375508.1| PREDICTED: protein argonaute 4A-like [Malus domestica]
Length=1226

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 112/152 (74%), Gaps = 5/152 (3%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            +PM+R GFGS+G+ I + TNHFKV V  +DG+FFHYS+ ++YEDG PV +  IGRKV+++
Sbjct  357  VPMSRPGFGSRGKNIQLTTNHFKVGVKISDGYFFHYSIDMFYEDGTPVTANAIGRKVVEK  416

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS---PN  482
            V +TYD +L  KEFAYDG+K+LFTVG+LP  +L+F VVL+ ++S+R  GN    S   P 
Sbjct  417  VKETYDRDLGRKEFAYDGQKNLFTVGSLPHKRLDFVVVLDNISSSRRIGNVGGSSSYDPA  476

Query  483  E--GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            E   D+KRL+  ++SKT KV I++A KI M A
Sbjct  477  ESGSDRKRLKHSFQSKTIKVLINYAXKIXMQA  508



>gb|EAZ11413.1| hypothetical protein OsJ_01274 [Oryza sativa Japonica Group]
Length=997

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 128/185 (69%), Gaps = 16/185 (9%)
 Frame = +3

Query  24   EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  203
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  109  ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  168

Query  204  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  383
            N              L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  169  N--------------LKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  214

Query  384  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEG-DKKRLRRPYRSKTYKVEISFAAK  557
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G D+KR+RRPY++KT+KVE++FAAK
Sbjct  215  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGNDRKRVRRPYQTKTFKVELNFAAK  274

Query  558  IPMNA  572
            IPM+A
Sbjct  275  IPMSA  279



>ref|XP_006289242.1| hypothetical protein CARUB_v10002706mg [Capsella rubella]
 gb|EOA22140.1| hypothetical protein CARUB_v10002706mg [Capsella rubella]
Length=861

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 15/150 (10%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVS---KNDGHFFHYSVALYYEDGRPVDSKGIGRKV  302
            LP++RRG GS G+KI +LTNHF V+ S    N  +FFHYSVA+ YE+G PV +KG+GR++
Sbjct  23   LPLSRRGHGSNGRKINLLTNHFSVDFSIRELNSQYFFHYSVAITYENGSPVMTKGVGRRI  82

Query  303  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN  482
            L++V  TY T+L  K FAYDG+KSLFTVG LPR+KL+F+VVLE+V S RN          
Sbjct  83   LEKVQQTYQTDLDFKHFAYDGDKSLFTVGPLPRSKLDFSVVLEDVPSRRNA---------  133

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
               +KRL+ P++S+ Y V ISFAAKIPM A
Sbjct  134  ---EKRLKLPHQSEKYNVAISFAAKIPMQA  160



>ref|XP_008449486.1| PREDICTED: protein argonaute 16 [Cucumis melo]
Length=904

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YED RPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDSRPVEGKEIGRKLMDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNC-SPGSPNEGDK  494
             T+ TELA K FAYDGEK L+T+G LP+ KLEF+VVLE   +    G+    GSPN G  
Sbjct  99   QTHSTELANKRFAYDGEKCLYTIGPLPQRKLEFSVVLEGFCAKIETGSSGESGSPN-GTG  157

Query  495  KRLRRPYRSKTYKVEISFAAKIPMNA  572
            KR +R  +SKT+K+E+SFA KIPM +
Sbjct  158  KRFKRSSQSKTFKIELSFATKIPMKS  183



>ref|XP_010657243.1| PREDICTED: protein argonaute 16 [Vitis vinifera]
Length=904

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RRG G+ G++I +LTNHFKV+++ +D  F+ YSV++  ED R VD KGIGRKV+DR++
Sbjct  38   ISRRGVGTAGRRISLLTNHFKVSMNISDAMFYQYSVSITSEDKRVVDGKGIGRKVIDRLY  97

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK+FAYDGEKSL+TVG LP+N  EFTVV+EE+ +   NG+        G+ K
Sbjct  98   LTYSSELAGKKFAYDGEKSLYTVGPLPQNNFEFTVVVEELLARSANGSPGANGSPSGNGK  157

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  +RSKT+KV IS+AAKIP+ +
Sbjct  158  RPKCSFRSKTFKVAISYAAKIPLKS  182



>ref|XP_010497367.1| PREDICTED: protein argonaute 8-like, partial [Camelina sativa]
Length=235

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 14/149 (9%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSK-NDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPMARRG GSKG KI +LTNHF+VN S     HFFHYSVA+ YEDG PV +K IGRK+L+
Sbjct  25   LPMARRGNGSKGDKIHLLTNHFRVNFSNPTCQHFFHYSVAITYEDGSPVIAKSIGRKILE  84

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY T+L  K F YDG+++L+TVG LPR+KL+F+VVLE+  S RN            
Sbjct  85   KVQQTYQTDLDFKHFVYDGDQNLYTVGPLPRSKLDFSVVLEDAPSRRNA-----------  133

Query  489  DKKRLRRPYRSKTYKVEISFAA-KIPMNA  572
              KRLR P++SK + V IS +A +IPM A
Sbjct  134  -DKRLRLPHQSKKFNVTISSSATEIPMQA  161



>ref|XP_009418523.1| PREDICTED: protein argonaute 16-like [Musa acuminata subsp. malaccensis]
Length=896

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYE--DGRPVDSKGIGRKV  302
            RLPMAR  FG++G+ + +LTNHF V  +K D  F+HYSV + ++  D     SKG GRKV
Sbjct  37   RLPMARPAFGTEGRPVQLLTNHFNVKFTKQDTVFYHYSVNISHDKSDENHAHSKGFGRKV  96

Query  303  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN  482
            LDR++ TY +E  GK+FAYDGEKSLFTVG LP+N  EFTVVLE+ ++    G+ S  S  
Sbjct  97   LDRLYQTYRSEFEGKQFAYDGEKSLFTVGPLPQNNFEFTVVLEDSSARATGGDPSGDSLG  156

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            EGD+KR RR + ++T+KVE+SFAAKIP+ +
Sbjct  157  EGDQKRSRRSHFTRTFKVELSFAAKIPLKS  186



>dbj|BAD81109.1| zwille protein -like [Oryza sativa Japonica Group]
Length=879

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            +LPM+R+GFG++GQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTRGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEV-----TSNRNNGNCSPG  473
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+      T+ R +     G
Sbjct  67   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSSGRTTTRRSSGGDDG  126

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SP   D+KR++RP   K + VEISFAAK PM+A
Sbjct  127  SPGGSDRKRMKRPMAVKKFMVEISFAAKDPMSA  159



>ref|XP_003598353.1| Protein argonaute 4A [Medicago truncatula]
 gb|AES68604.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=876

 Score =   163 bits (413),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            +PMARRG GSKG KI +L NHF+V +SKNDG+F+HY+VAL Y+DG  V+ KG+GRKV+D+
Sbjct  19   VPMARRGLGSKGAKIQLLANHFRVGLSKNDGYFYHYNVALCYQDGHAVEVKGVGRKVIDK  78

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            + +TYD  L  K FAYDGEKSLFT+ +L   K EF VVLEEV+S R   N     P+E  
Sbjct  79   LCETYDV-LRNKNFAYDGEKSLFTLRSLHHKKQEFIVVLEEVSSTRVGSN-----PSEA-  131

Query  492  KKRLRRPYRSKTYKVEISFAAKIPM  566
             KR++   RSKT+KVEIS  +KIP+
Sbjct  132  TKRMKHQSRSKTFKVEISHVSKIPL  156



>sp|Q5NBN9.2|AGO15_ORYSJ RecName: Full=Protein argonaute 15; Short=OsAGO15 [Oryza sativa 
Japonica Group]
Length=889

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            +LPM+R+GFG++GQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  19   KLPMSRKGFGTRGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEV-----TSNRNNGNCSPG  473
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+      T+ R +     G
Sbjct  79   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSSGRTTTRRSSGGDDG  138

Query  474  SPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            SP   D+KR++RP   K + VEISFAAK PM+A
Sbjct  139  SPGGSDRKRMKRPMAVKKFMVEISFAAKDPMSA  171



>ref|XP_002320489.2| PAZ domain-containing family protein [Populus trichocarpa]
 gb|EEE98804.2| PAZ domain-containing family protein [Populus trichocarpa]
Length=869

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RRG G+ G+ I +LTNHFKV+V+  D  F+ Y+V++  ED R V+SKGIGRK++DR++
Sbjct  2    ISRRGVGTSGRHISLLTNHFKVSVNVPDAVFYQYNVSITSEDNRAVESKGIGRKLIDRLY  61

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +E AGK FAYDGEKSL+TVG LP+NK EFTVVLEE  +   +G+   G       K
Sbjct  62   QTYSSEFAGKRFAYDGEKSLYTVGPLPQNKSEFTVVLEESFAKHESGSPGGGESPPAAVK  121

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R YRSKT+KVE S+AAKIP+ +
Sbjct  122  RSKRSYRSKTFKVETSYAAKIPLKS  146



>gb|EMT20780.1| Protein argonaute 4A [Aegilops tauschii]
Length=1186

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 115/187 (61%), Gaps = 40/187 (21%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALY------------------  254
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V LY                  
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVCLYPCLLYCMPLSSFTFIVVE  110

Query  255  ---------------------YEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  371
                                 YED RPVD KG+GRKV+D++  TY +ELA K+FAYDGEK
Sbjct  111  FLVLPSNVIPPLFNWMQVNLKYEDDRPVDGKGVGRKVIDKLAQTYPSELAHKDFAYDGEK  170

Query  372  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLRRPYRSKTYKVEISFA  551
            SLFT+GALP+   EF VVLE+V+S +   N SPG+ +  DKKR++RPY++KT+KVE+SFA
Sbjct  171  SLFTIGALPQINNEFVVVLEDVSSGKTPANGSPGN-DSPDKKRVKRPYQTKTFKVELSFA  229

Query  552  AKIPMNA  572
            A+IPM+A
Sbjct  230  ARIPMSA  236



>ref|XP_003576965.2| PREDICTED: protein argonaute 16 [Brachypodium distachyon]
Length=888

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  MAR GFG +G+ I +++NHF V +S+ D  F+ YSV++  +D + VD KGIGRKV+D
Sbjct  25   RTAMARPGFGREGKPIRLMSNHFAVKLSRTDAVFYQYSVSIKSDDDKVVDGKGIGRKVID  84

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S     +   GSP  G
Sbjct  85   KMLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAVGRSPEHGSPGLG  144

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +R +  K + V IS+AAKIP+ A
Sbjct  145  DKKRAKRSHLPKQFVVGISYAAKIPLRA  172



>ref|XP_010035502.1| PREDICTED: protein argonaute 16-like [Eucalyptus grandis]
 gb|KCW46920.1| hypothetical protein EUGRSUZ_K00735 [Eucalyptus grandis]
Length=904

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G GS G++I +LTNHFKV+V+  D  F+ YSV++  ED R V+ KGIGRK++D+++
Sbjct  40   ISRGGIGSAGRQISLLTNHFKVSVNVPDAVFYQYSVSITSEDTRAVEGKGIGRKLIDKLY  99

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK+FAYDGEK+L+TVG LP+NKL+FTVVLE+  + R + +   G    G  K
Sbjct  100  QTYSSELAGKKFAYDGEKTLYTVGPLPQNKLQFTVVLEDSFAKRESESVGGGESPNGSTK  159

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R ++SKT++VEIS+AAK+P+ +
Sbjct  160  RSKRSFQSKTFQVEISYAAKVPLKS  184



>gb|EEC70395.1| hypothetical protein OsI_01366 [Oryza sativa Indica Group]
Length=871

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 127/185 (69%), Gaps = 16/185 (9%)
 Frame = +3

Query  24   EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  203
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  2    ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  61

Query  204  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  383
            N              L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  62   N--------------LKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  107

Query  384  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEG-DKKRLRRPYRSKTYKVEISFAAK  557
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G D+KR+RR Y++KT+KVE++FAAK
Sbjct  108  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGNDRKRVRRSYQTKTFKVELNFAAK  167

Query  558  IPMNA  572
            IPM+A
Sbjct  168  IPMSA  172



>ref|XP_004956340.1| PREDICTED: protein argonaute 16-like isoform X1 [Setaria italica]
Length=882

 Score =   161 bits (408),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 77/148 (52%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR   G +G+ I +L+NHF V ++  D  F+ YSV++  ED + VD KGIGRKV+D
Sbjct  19   RTPMARPSIGREGKPIRLLSNHFAVKLNGVDAVFYQYSVSIKSEDDKVVDGKGIGRKVID  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSP++ 
Sbjct  79   KLLQTYSSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAVGGSPGHGSPSQA  138

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR++R + +K + V IS+AAKIP+ +
Sbjct  139  DKKRVKRSHLAKKFIVAISYAAKIPLKS  166



>gb|KDP30816.1| hypothetical protein JCGZ_13759 [Jatropha curcas]
Length=896

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R GFG+ G++IP+LTNHFKV+V  +D  F+ Y+V++  ED + V+ KGIGRK++DR++
Sbjct  30   ISRHGFGTSGRRIPLLTNHFKVSVRVSDAVFYQYTVSITSEDKQVVEGKGIGRKLIDRLY  89

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL GK FAYDGEKSL+TVG LP+NK EFTV+LEE  +   NG+   G       K
Sbjct  90   QTYSSELGGKMFAYDGEKSLYTVGPLPQNKFEFTVLLEESFAKHQNGSPGGGGSPAAAAK  149

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R +RSKT+KVEIS+A KIP+ +
Sbjct  150  RSKRSFRSKTFKVEISYATKIPLKS  174



>ref|XP_011007758.1| PREDICTED: protein argonaute 16 [Populus euphratica]
 ref|XP_011007759.1| PREDICTED: protein argonaute 16 [Populus euphratica]
 ref|XP_011007760.1| PREDICTED: protein argonaute 16 [Populus euphratica]
Length=910

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RRG G+ G  I +LTNHFKV+V+  D  F+ Y V++  ED R V+SKGIGRK++DR++
Sbjct  43   ISRRGVGTSGHHISLLTNHFKVSVNVPDTVFYQYFVSITSEDNRAVESKGIGRKLIDRLY  102

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +E AGK FAYDGEKSL+TVG LP+NK EF VVLEE  +   +G+   G       K
Sbjct  103  QTYSSEFAGKRFAYDGEKSLYTVGPLPQNKSEFRVVLEESFAKHESGSPGGGESPPAAVK  162

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R YRSKT+KVEIS+AAKIP+ +
Sbjct  163  RSKRSYRSKTFKVEISYAAKIPLKS  187



>gb|KDO59555.1| hypothetical protein CISIN_1g002661mg [Citrus sinensis]
Length=832

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +LTNHFKV+V+  D  F+HY+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+        G  K
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGK  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFA KIP+ +
Sbjct  156  RSKHSFQSKTFMVEISFATKIPLRS  180



>ref|XP_004156089.1| PREDICTED: protein argonaute 16-like [Cucumis sativus]
Length=903

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YEDGRPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDGRPVEGKDIGRKLMDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY TELA K FAYDGEK L+T+G LP+ KLEF+VVLE   +    G+           K
Sbjct  99   QTYSTELANKRFAYDGEKCLYTIGPLPQKKLEFSVVLEGFCAKIETGSSGGSGSPNRTGK  158

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R  +SKT+K+E+SFA KIPM +
Sbjct  159  RFKRSSQSKTFKIELSFATKIPMKS  183



>ref|XP_004140126.1| PREDICTED: protein argonaute 16-like [Cucumis sativus]
 gb|KGN47971.1| hypothetical protein Csa_6G421650 [Cucumis sativus]
Length=904

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YEDGRPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDGRPVEGKDIGRKLMDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY TELA K FAYDGEK L+T+G LP+ KLEF+VVLE   +    G+           K
Sbjct  99   QTYSTELANKRFAYDGEKCLYTIGPLPQKKLEFSVVLEGFCAKIETGSSGGSGSPNRTGK  158

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R  +SKT+K+E+SFA KIPM +
Sbjct  159  RFKRSSQSKTFKIELSFATKIPMKS  183



>emb|CBI28870.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RRG G+ G++I +LTNHFKV+++ +D  F+ YSV++  ED R VD KGIGRKV+DR++
Sbjct  53   ISRRGVGTAGRRISLLTNHFKVSMNISDAMFYQYSVSITSEDKRVVDGKGIGRKVIDRLY  112

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK+FAYDGEKSL+TVG LP+N  EFTVV+EE+ + R+     P     G+ K
Sbjct  113  LTYSSELAGKKFAYDGEKSLYTVGPLPQNNFEFTVVVEELLARRHVLCPIPS----GNGK  168

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  +RSKT+KV IS+AAKIP+ +
Sbjct  169  RPKCSFRSKTFKVAISYAAKIPLKS  193



>gb|KDO59554.1| hypothetical protein CISIN_1g002661mg [Citrus sinensis]
Length=895

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +LTNHFKV+V+  D  F+HY+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+        G  K
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGK  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFA KIP+ +
Sbjct  156  RSKHSFQSKTFMVEISFATKIPLRS  180



>gb|EMS52455.1| Protein argonaute 4B [Triticum urartu]
Length=1055

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 5/150 (3%)
 Frame = +3

Query  138  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            MAR   GFG KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  73   MARPPNGFGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  132

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG---NCSPGSPN  482
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S +        + GSP 
Sbjct  133  LQHTYHSELANKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGKTAAGSPGGNNGSPG  192

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             GD+KR+RRPY++KT+KVE++FAA IPM A
Sbjct  193  GGDQKRVRRPYQAKTFKVELNFAATIPMAA  222



>ref|XP_007049194.1| Eukaryotic translation initiation factor 2c, putative isoform 
1 [Theobroma cacao]
 gb|EOX93351.1| Eukaryotic translation initiation factor 2c, putative isoform 
1 [Theobroma cacao]
Length=903

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G G +G+ I +LTNHFKV+V+  D  F+ Y+V +  ED R V+SKGIGRK+LD+++
Sbjct  41   VSRLGVGMRGRHISLLTNHFKVSVNATDAVFYQYTVTISSEDNRAVESKGIGRKLLDKLY  100

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+ K +FT+VLEE  + R  G+        G  K
Sbjct  101  QTYSSELAGKRFAYDGEKSLYTVGPLPQKKFDFTIVLEESFAKREIGSLDGDGSPVGTGK  160

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R +RSKTYKVE+ ++AKIP+ +
Sbjct  161  RTKRSFRSKTYKVELRYSAKIPLKS  185



>ref|XP_007049195.1| Eukaryotic translation initiation factor 2c, putative isoform 
2 [Theobroma cacao]
 gb|EOX93352.1| Eukaryotic translation initiation factor 2c, putative isoform 
2 [Theobroma cacao]
Length=904

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G G +G+ I +LTNHFKV+V+  D  F+ Y+V +  ED R V+SKGIGRK+LD+++
Sbjct  41   VSRLGVGMRGRHISLLTNHFKVSVNATDAVFYQYTVTISSEDNRAVESKGIGRKLLDKLY  100

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+ K +FT+VLEE  + R  G+        G  K
Sbjct  101  QTYSSELAGKRFAYDGEKSLYTVGPLPQKKFDFTIVLEESFAKREIGSLDGDGSPVGTGK  160

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R +RSKTYKVE+ ++AKIP+ +
Sbjct  161  RTKRSFRSKTYKVELRYSAKIPLKS  185



>gb|AGO99012.1| argonaute 4, partial [Triticum aestivum]
Length=954

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = +3

Query  138  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            MAR   G G KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  88   MARPPNGLGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  147

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG---NCSPGSPN  482
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S +        + GSP 
Sbjct  148  LQHTYHSELANKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGKTAAGSPGGNNGSPG  207

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             GD+KR+RRPY++KT+KVE++FAA IPM A
Sbjct  208  GGDQKRVRRPYQAKTFKVELNFAATIPMAA  237



>gb|EMT11809.1| Protein argonaute 4B [Aegilops tauschii]
Length=1093

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = +3

Query  138  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            MAR   G G KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  108  MARPPNGLGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  167

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG---NCSPGSPN  482
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S +        + GSP 
Sbjct  168  LQHTYHSELADKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGKTAAGSPGGNNGSPG  227

Query  483  EGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             GD+KR+RRPY++KT+KVE++FAA IPM A
Sbjct  228  GGDQKRVRRPYQAKTFKVELNFAATIPMAA  257



>ref|XP_006447659.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 gb|ESR60899.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=835

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  39   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+        G  K
Sbjct  99   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGK  158

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFA KIP+ +
Sbjct  159  RSKHSFQSKTFMVEISFATKIPLRS  183



>tpg|DAA60814.1| TPA: putative argonaute family protein [Zea mays]
Length=746

 Score =   156 bits (394),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  19   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  79   KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  138

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KKR++R + +K + V+IS+AAKIP+ +
Sbjct  139  NKKRVKRSHLAKKFSVDISYAAKIPLQS  166



>ref|XP_006447661.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 ref|XP_006469599.1| PREDICTED: protein argonaute 16-like isoform X2 [Citrus sinensis]
 ref|XP_006469600.1| PREDICTED: protein argonaute 16-like isoform X3 [Citrus sinensis]
 ref|XP_006469601.1| PREDICTED: protein argonaute 16-like isoform X4 [Citrus sinensis]
 gb|ESR60901.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=895

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+        G  K
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGK  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFA KIP+ +
Sbjct  156  RSKHSFQSKTFMVEISFATKIPLRS  180



>ref|XP_006447660.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 ref|XP_006469598.1| PREDICTED: protein argonaute 16-like isoform X1 [Citrus sinensis]
 gb|ESR60900.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=898

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  39   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+        G  K
Sbjct  99   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGSPRGRDSPIGPGK  158

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFA KIP+ +
Sbjct  159  RSKHSFQSKTFMVEISFATKIPLRS  183



>ref|XP_008651670.1| PREDICTED: uncharacterized protein LOC100382704 isoform X2 [Zea 
mays]
Length=901

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  50   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  110  KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  169

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KKR++R + +K + V+IS+AAKIP+ +
Sbjct  170  NKKRVKRSHLAKKFSVDISYAAKIPLQS  197



>ref|XP_008651669.1| PREDICTED: uncharacterized protein LOC100382704 isoform X1 [Zea 
mays]
Length=912

 Score =   157 bits (397),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  50   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  109

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  110  KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  169

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KKR++R + +K + V+IS+AAKIP+ +
Sbjct  170  NKKRVKRSHLAKKFSVDISYAAKIPLQS  197



>ref|XP_008651671.1| PREDICTED: uncharacterized protein LOC100382704 isoform X3 [Zea 
mays]
Length=881

 Score =   157 bits (396),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  19   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  78

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  79   KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  138

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KKR++R + +K + V+IS+AAKIP+ +
Sbjct  139  NKKRVKRSHLAKKFSVDISYAAKIPLQS  166



>ref|XP_006661042.1| PREDICTED: protein argonaute 16-like [Oryza brachyantha]
Length=909

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ Y V++  ED + +D KGIGRKV+D
Sbjct  46   RVPIARPSFGHEGKQIKLLSNHFTVKLSGIDAIFYQYCVSIKSEDDKVIDGKGIGRKVMD  105

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSP +G
Sbjct  106  KLLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPGHGSPGQG  165

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +R + +K + V +S+AAKIP+ +
Sbjct  166  DKKRSKRAHLAKKFVVAMSYAAKIPLKS  193



>gb|EEE66926.1| hypothetical protein OsJ_23783 [Oryza sativa Japonica Group]
Length=863

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR  FG +G++I +L+NHF V +S  D      +V++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGID------AVSIKSEDDKVIDGKGIGRKVMD  72

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  73   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  132

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +  + +K   V IS+AAKIP+ +
Sbjct  133  DKKRSKCTHLAKKIVVGISYAAKIPLKS  160



>gb|EEC81834.1| hypothetical protein OsI_25587 [Oryza sativa Indica Group]
Length=863

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R+P+AR  FG +G++I +L+NHF V +S  D      +V++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGID------AVSIKSEDDKVIDGKGIGRKVMD  72

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  73   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  132

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            DKKR +  + +K   V IS+AAKIP+ +
Sbjct  133  DKKRSKCTHLAKKIVVGISYAAKIPLKS  160



>ref|XP_003567769.1| PREDICTED: protein argonaute 4B-like [Brachypodium distachyon]
Length=914

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 4/149 (3%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDS-KGIGRKVLDRV  314
            +AR G G  GQ I +L+NHFKV+V  +   F HY V+L YED  PVD  KGIGRKV+D++
Sbjct  46   VARPGLGRIGQPIQLLSNHFKVSVKSSQDFFHHYDVSLKYEDDTPVDRLKGIGRKVIDKL  105

Query  315  HDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG---NCSPGSPNE  485
              TY +ELA K+FAYDGEKSLFT+GALP+   EF V+LE++ + +          GSP  
Sbjct  106  QHTYLSELANKDFAYDGEKSLFTIGALPQVTNEFIVILEDLGTGKTAANGSPGGNGSPGG  165

Query  486  GDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
             DKKR+RRPY++KT+KVE+ FAAKIPM A
Sbjct  166  SDKKRVRRPYQTKTFKVELRFAAKIPMGA  194



>gb|AHC30882.1| argonaute 6 protein [Dimocarpus longan]
Length=900

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            +A  G G+ G +I +LTNHFKV+V   D  F+ Y+V +  +D R V+ KGIGRK+LDR++
Sbjct  45   VANNGVGNSGHRIGLLTNHFKVSVKAQDAVFYQYTVTISGDDKRSVEGKGIGRKLLDRLY  104

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY  ELA  +FAYDGEKSL+TVGALP+N LEFTVVL+E  +   NG+ S         K
Sbjct  105  QTYSAELAHNKFAYDGEKSLYTVGALPQNNLEFTVVLDESRAKLKNGSPSADDSASDAGK  164

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  +RSKT+KVEIS++AKIP+ +
Sbjct  165  RSKVSFRSKTFKVEISYSAKIPLKS  189



>ref|XP_010035500.1| PREDICTED: protein argonaute 16-like [Eucalyptus grandis]
Length=864

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  RRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDT  323
            RRG GS G+ I +LTNHFKV+V+  D  F+ YSV+   E+ R V+ KGIGRK++D+++ T
Sbjct  4    RRGTGSAGRPINLLTNHFKVSVNVPDAVFYQYSVSFTSEERRDVEGKGIGRKLMDKLYQT  63

Query  324  YDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRL  503
            Y +ELAGK+FAYDGEK+L+TVG LP+NKL  TVVLE+  + R + N   G   E   KR 
Sbjct  64   YSSELAGKKFAYDGEKTLYTVGPLPQNKLVLTVVLEDSFAKRESENLGGG---ESSTKRS  120

Query  504  RRPYRSKTYKVEISFAAKIPMNA  572
            +R ++S+T+KVEIS+AAK+P+ +
Sbjct  121  KRSFQSRTFKVEISYAAKVPLKS  143



>gb|KCW46921.1| hypothetical protein EUGRSUZ_K00736 [Eucalyptus grandis]
Length=880

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = +3

Query  144  RRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDT  323
            RRG GS G+ I +LTNHFKV+V+  D  F+ YSV+   E+ R V+ KGIGRK++D+++ T
Sbjct  35   RRGTGSAGRPINLLTNHFKVSVNVPDAVFYQYSVSFTSEERRDVEGKGIGRKLMDKLYQT  94

Query  324  YDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRL  503
            Y +ELAGK+FAYDGEK+L+TVG LP+NKL  TVVLE+  + R + N   G   E   KR 
Sbjct  95   YSSELAGKKFAYDGEKTLYTVGPLPQNKLVLTVVLEDSFAKRESENLGGG---ESSTKRS  151

Query  504  RRPYRSKTYKVEISFAAKIPMNA  572
            +R ++S+T+KVEIS+AAK+P+ +
Sbjct  152  KRSFQSRTFKVEISYAAKVPLKS  174



>gb|EYU42875.1| hypothetical protein MIMGU_mgv1a001065mg [Erythranthe guttata]
Length=898

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 106/145 (73%), Gaps = 1/145 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            + R GFG+ G++I +L NHFKV+++  D  F+ YSVA+ +ED + V+SK +GRKV+D+++
Sbjct  38   ITRPGFGTSGKRISLLANHFKVSITNPDETFYQYSVAISFEDNKAVESKVLGRKVIDKLY  97

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDG+ SL+TVG LP+N LE+TVVLEE  + + +GN S         K
Sbjct  98   QTYSSELAGKRFAYDGDASLYTVGPLPQNNLEYTVVLEESIA-KCSGNPSDNGTQIESYK  156

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +    SKT+KVEIS+AAK+P+N+
Sbjct  157  RSKSSLHSKTFKVEISYAAKVPLNS  181



>ref|XP_011100483.1| PREDICTED: protein argonaute 16 isoform X2 [Sesamum indicum]
Length=901

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            + R GFG+ GQ+I +L NHF+V+V   D +F+ YSV++  E+   VDSK IGRKV D+++
Sbjct  38   ITRPGFGTSGQRISLLVNHFRVSVRYPDEYFYQYSVSISSENNSMVDSKVIGRKVTDKLY  97

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL+GK+FAYDGEK+L+TVG LP N  EFTVVLEE    R + + S GSPN+   K
Sbjct  98   QTYSSELSGKKFAYDGEKNLYTVGPLPHNNFEFTVVLEESIGKRGSPSHS-GSPNDSS-K  155

Query  498  RLRRPYRSKTYKVEISFAAKIPM  566
            R +R  +S T+KVEIS+AAKIP+
Sbjct  156  RSKRTLQSNTFKVEISYAAKIPL  178



>gb|EMS52406.1| Protein argonaute 4B [Triticum urartu]
Length=932

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVA----LYYEDGRPVDSKGIGR  296
            RLP AR G G +GQ I +L NH+KV++  ++  F HY V+    L YED +PV  KGIGR
Sbjct  44   RLPKARPGLGKRGQTIQLLANHYKVSMRSSEDFFHHYHVSILVNLKYEDDQPVVGKGIGR  103

Query  297  KVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  476
            KVLD++   Y +ELA  EFAYDGEKSLFT+GALP+   EFTVVLE++   + +G  S  S
Sbjct  104  KVLDKLQHMYRSELANNEFAYDGEKSLFTIGALPQVHNEFTVVLEDIGRGKCSGGNSGSS  163

Query  477  PNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
            P   D KR++RPY++K +KVE+ F AKIP  A
Sbjct  164  PGGSDTKRVKRPYKTKIFKVELCFVAKIPTAA  195



>ref|XP_004304078.2| PREDICTED: protein argonaute 16-like [Fragaria vesca subsp. vesca]
 ref|XP_011467764.1| PREDICTED: protein argonaute 16-like [Fragaria vesca subsp. vesca]
Length=889

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 5/142 (4%)
 Frame = +3

Query  147  RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTY  326
            RG G+ G++I + TNHFKV+V   D  F+ Y V + YED RPV+  GIGRK++D+++ TY
Sbjct  34   RGSGTTGRRIALSTNHFKVSVKNPDAVFYQYCVLITYEDKRPVEGMGIGRKLVDKLYQTY  93

Query  327  DTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLR  506
             +E AGK+FAYDGEK+L+TVG LPRNKLEFTV+L+E  +    G        E DK+  R
Sbjct  94   TSEFAGKKFAYDGEKALYTVGPLPRNKLEFTVILDESFAKSETGKS-----GETDKRMKR  148

Query  507  RPYRSKTYKVEISFAAKIPMNA  572
               RSK++ +EIS+AAKIP+ +
Sbjct  149  CSTRSKSFNIEISYAAKIPLKS  170



>ref|XP_004296440.2| PREDICTED: protein argonaute 16-like [Fragaria vesca subsp. vesca]
Length=900

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 5/133 (4%)
 Frame = +3

Query  174  IPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEF  353
            I +L NHFKV V   D  FF YSV +  ED R V+ KGIGRK++DR+  TY +ELAGK+F
Sbjct  53   IQLLANHFKVTVKAPDAVFFQYSVHITAEDKRAVEGKGIGRKLVDRLFQTYSSELAGKKF  112

Query  354  AYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKKRLRRPYRSKTYK  533
            AYDGEK+L+TVG LP+NKLEFTVVLEE  +          SP EG +KR RR  +SKT+ 
Sbjct  113  AYDGEKALYTVGPLPQNKLEFTVVLEETFAKSET-----VSPGEGTEKRSRRTLQSKTFT  167

Query  534  VEISFAAKIPMNA  572
            VE+S+AAKIP+ +
Sbjct  168  VELSYAAKIPLKS  180



>gb|KJB10319.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=898

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+  +  +    + G P E   K
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLEDSFAKWSPD--ADGGPAETG-K  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R ++SKTYKVE+S++AKIP+ +
Sbjct  156  RTKRSFQSKTYKVELSYSAKIPLKS  180



>gb|KJB10321.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=832

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+  +  +    + G P E   K
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLEDSFAKWSPD--ADGGPAETG-K  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R ++SKTYKVE+S++AKIP+ +
Sbjct  156  RTKRSFQSKTYKVELSYSAKIPLKS  180



>gb|KJB10320.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=850

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+  +  +    + G P E   K
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLEDSFAKWSPD--ADGGPAETG-K  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R ++SKTYKVE+S++AKIP+ +
Sbjct  156  RTKRSFQSKTYKVELSYSAKIPLKS  180



>ref|NP_197602.2| protein argonaute 8 [Arabidopsis thaliana]
 sp|Q3E984.1|AGO8_ARATH RecName: Full=Protein argonaute 8 [Arabidopsis thaliana]
 gb|AED92921.1| protein argonaute 8 [Arabidopsis thaliana]
Length=850

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 14/149 (9%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGH-FFHYSVALYYEDGRPVDSKGIGRKVLD  308
            LPM RRG GSKGQKI +LTNHF+VN  K + H FFHYSV + YEDG P+ +KG GRK+L+
Sbjct  23   LPMTRRGNGSKGQKILLLTNHFRVNFRKPNSHNFFHYSVTITYEDGSPLLAKGFGRKILE  82

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            +V  T   +L  K FAYDG+K+L+TVG LPR+ L+F+VVLE   S RN            
Sbjct  83   KVQQTCQADLGCKHFAYDGDKNLYTVGPLPRSSLDFSVVLETAPSRRN------------  130

Query  489  DKKRLRRPYRSKTYKVEISFA-AKIPMNA  572
              KRL+ P++SK + V I FA  +IPM A
Sbjct  131  ADKRLKLPHQSKKFNVAILFAPPEIPMEA  159



>ref|XP_008229810.1| PREDICTED: protein argonaute 16 [Prunus mume]
Length=898

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 104/145 (72%), Gaps = 7/145 (5%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+R G G+ GQ IP+L NHFKV+V+  D  F+ Y V +  ED   V+ KGIGRK++DR++
Sbjct  40   MSRCGTGTTGQTIPLLANHFKVSVNVPDAVFYQYFVRITSEDKIAVEGKGIGRKLIDRLY  99

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL GK+FAYDG+K+L+T+G LP+ +LEF+VVLEE  +   NG  SP +      K
Sbjct  100  QTYSSELGGKKFAYDGDKALYTLGPLPQRRLEFSVVLEETFAKHENG--SPLA-----DK  152

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R RR +RSKT+ VEIS+AA+IP+ +
Sbjct  153  RSRRSFRSKTFNVEISYAAEIPLKS  177



>ref|XP_008379693.1| PREDICTED: protein argonaute 16 [Malus domestica]
 ref|XP_008379694.1| PREDICTED: protein argonaute 16 [Malus domestica]
Length=899

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+RRG G+ G++I +L NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++
Sbjct  40   MSRRGTGTTGKEINLLANHFKVSVNVPDAVFYQYSVSITSEDKKVVEGKGIGRKLIDRLY  99

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL GK+FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+        G +K
Sbjct  100  QTYSSELGGKKFAYDGEKALYTVGPLPQNKLEFTVVLEETFAKHENGS------TNGTEK  153

Query  498  RLRRPYRSKTYKVEISFAAKIPM  566
            R RR +RS+T+ +EIS+AAKIP+
Sbjct  154  RSRRSFRSRTFNLEISYAAKIPL  176



>gb|KHG12030.1| hypothetical protein F383_20383 [Gossypium arboreum]
Length=898

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R   G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRSEVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVSSEDSRVVESKRIGRKLVDKLY  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+  S       + G P E   K
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLED--SFTKWSPVADGGPAETG-K  155

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +R ++SKTYKVE+S++AKIP+ +
Sbjct  156  RTKRSFQSKTYKVELSYSAKIPLKS  180



>ref|XP_002534129.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF28257.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=863

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (68%), Gaps = 11/156 (7%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R+GFG+ G +IP+L+NHFKV+++  D  F+ YSV+   ED R V+ KGIGRK+++R++
Sbjct  30   VSRQGFGNSGHRIPLLSNHFKVSINIPDAVFYQYSVSFTSEDDRVVEVKGIGRKLIERLY  89

Query  318  DTYDTELAGK-----------EFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNC  464
             TY T+L              +FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+ 
Sbjct  90   QTYYTDLGDTKFAYDGEKTLYKFAYDGEKTLYTVGPLPQNKLEFTVVLEESFAKHGNGSP  149

Query  465  SPGSPNEGDKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              G       KR +R + SK++KV IS+AAKIP+ +
Sbjct  150  ESGGSPTATSKRSKRSFHSKSFKVAISYAAKIPLKS  185



>ref|XP_007217062.1| hypothetical protein PRUPE_ppa001137mg [Prunus persica]
 gb|EMJ18261.1| hypothetical protein PRUPE_ppa001137mg [Prunus persica]
Length=898

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 103/145 (71%), Gaps = 7/145 (5%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            M+R G G+ GQ IP+L NHFKV+V+  D  F+ Y V +  ED   V+ KGIGRK++DR++
Sbjct  40   MSRCGTGTTGQTIPLLANHFKVSVNVPDAVFYQYFVRITSEDKIAVEGKGIGRKLIDRLY  99

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL GK+FAYDG+K+L+ +G LP+ +LEF+VVLEE  +   NGN  P +      K
Sbjct  100  QTYSSELGGKKFAYDGDKALYILGPLPQRRLEFSVVLEETFAKHENGN--PLA-----DK  152

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R RR +RSKT+ VEIS+AA+IP+ +
Sbjct  153  RSRRSFRSKTFNVEISYAAEIPLKS  177



>ref|XP_003526363.1| PREDICTED: protein argonaute 4B-like [Glycine max]
Length=881

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKN----DGHFFHYSVALYYEDGRPVDSKGIGR  296
            R+PMAR+  GSKG+   +L NHF V + K     DG+F+HY VA+ YEDG PV++KG+GR
Sbjct  6    RVPMARKEVGSKGEPRQLLANHFGVCLVKPKDDIDGYFYHYDVAMSYEDGNPVEAKGVGR  65

Query  297  KVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG-  473
            KVL++V +TY  EL    FAYDGEKSLFT+G L   +L++ VVLE+V+S R   N +P  
Sbjct  66   KVLNQVCETY-VELRNMSFAYDGEKSLFTLGPLASQRLQYPVVLEDVSSRRVGKNGNPAE  124

Query  474  SPNEGDKKRL--RRPYRSKTYKVEISFAAKIPMNA  572
            SP  G  KR+  R  +R KT  V+I +AAKIP+ A
Sbjct  125  SPKGGYTKRMRIRHQFRPKTINVDIKYAAKIPLQA  159



>ref|XP_006400673.1| hypothetical protein EUTSA_v10015501mg [Eutrema salsugineum]
 gb|ESQ42126.1| hypothetical protein EUTSA_v10015501mg [Eutrema salsugineum]
Length=850

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 101/147 (69%), Gaps = 19/147 (13%)
 Frame = +3

Query  132  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  311
            LP+ARRG GSKGQKI + TNHF+V              A+ YEDG PV +KGIGRK+L+ 
Sbjct  9    LPIARRGNGSKGQKIQLRTNHFRV--------------AITYEDGNPVVAKGIGRKILEN  54

Query  312  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  491
            V DTY ++L  K FAYDG+K+LFTVG LP NKL+F+VVLE+++ +R N        ++ D
Sbjct  55   VQDTYKSDLGSKYFAYDGDKTLFTVGPLPANKLDFSVVLEDMSCSRGNTR-----SDDAD  109

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
            +KRLRRP +SK + V I+FA +I + A
Sbjct  110  RKRLRRPNKSKKFNVAITFAKQISIQA  136



>ref|XP_011100478.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100479.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100480.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100481.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
Length=902

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            + R GFG+ GQ+I +L NHF+V+V   D +F+ YSV++  E+   VDSK IGRKV D+++
Sbjct  38   ITRPGFGTSGQRISLLVNHFRVSVRYPDEYFYQYSVSISSENNSMVDSKVIGRKVTDKLY  97

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
             TY +EL+GK+FAYDGEK+L+TVG LP N  EFTVVLEE    R+      GSPN+   K
Sbjct  98   QTYSSELSGKKFAYDGEKNLYTVGPLPHNNFEFTVVLEESIGKRSGSPSHSGSPNDSS-K  156

Query  498  RLRRPYRSKTYKVEISFAAKIPM  566
            R +R  +S T+KVEIS+AAKIP+
Sbjct  157  RSKRTLQSNTFKVEISYAAKIPL  179



>ref|XP_009769203.1| PREDICTED: protein argonaute 16 [Nicotiana sylvestris]
Length=903

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  129  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  308
            R  M+R G G+ G+ I +L NH KV+V   D  F+ YSV++  ++ R V+ K IGRK++D
Sbjct  35   RTVMSRPGNGTSGRGITLLANHLKVSVKCPDEIFYQYSVSITCDEKRDVNIKRIGRKIID  94

Query  309  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  488
            ++H+TY +E AGK+F YDGEKSL+TVG LPRNK+EFTVV+EE ++   + + S    N  
Sbjct  95   KIHETYSSEFAGKKFVYDGEKSLYTVGPLPRNKVEFTVVVEESSAKHASESPSDNGSNNH  154

Query  489  DKKRLRRPYRSKTYKVEISFAAKIPMNA  572
              KR +R   SK ++VEI+FAAKIP+ +
Sbjct  155  SSKRSKRSLHSKAFRVEINFAAKIPLKS  182



>ref|XP_010110219.1| Protein argonaute 16 [Morus notabilis]
 gb|EXC25516.1| Protein argonaute 16 [Morus notabilis]
Length=900

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 100/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  174  IPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEF  353
            IP++ NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++ TY  E +GK F
Sbjct  46   IPLVANHFKVSVNVPDAVFYQYSVSITLEDNKDVNVKGIGRKLIDRLYQTYSLEFSGKSF  105

Query  354  AYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDKKRLRRPYRSK  524
            AYDGEKSL+TVG LP+ K EFTVVLEE  +   NG  SP   GSPNE   KR +R + SK
Sbjct  106  AYDGEKSLYTVGPLPQKKFEFTVVLEESFAKNENG--SPGFTGSPNESG-KRSKRSFNSK  162

Query  525  TYKVEISFAAKIPMNA  572
            T+K+++S+AAKIP+ +
Sbjct  163  TFKIQLSYAAKIPVKS  178



>emb|CDP05690.1| unnamed protein product [Coffea canephora]
Length=908

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 104/145 (72%), Gaps = 2/145 (1%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R GFG  G+ I +LTNHF+V++   D  F+ Y+V++  E G+ VDSKGIGRK++D+++
Sbjct  36   ISRPGFGKTGRPISLLTNHFRVSLKHPDEIFYQYTVSISSELGKTVDSKGIGRKIMDKLY  95

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
              Y ++LAGK FAYDGEK+L+TVG LP N LEF VVLEE    R + +   GSP+E   K
Sbjct  96   QIYFSDLAGKRFAYDGEKALYTVGPLPHNNLEFPVVLEESMVKRGSPS-QTGSPSESG-K  153

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +   +SKT+KV IS+AAK+P+ +
Sbjct  154  RAKHSLQSKTFKVAISYAAKVPLKS  178



>tpg|DAA54155.1| TPA: hypothetical protein ZEAMMB73_367489, partial [Zea mays]
Length=161

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            + R GFG KGQ I ++TNHFKV++   +  F+HY V L YED  PVD KG GRKV++++ 
Sbjct  39   VQRNGFGRKGQPIKLITNHFKVSLVNAEEFFYHYYVNLKYEDDTPVDRKGSGRKVIEKLQ  98

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPNEGD  491
             TY  ELA K+FAYDGEKSLFT+GALP+ K EFTVV+E+ ++ +   N SPG  SP   D
Sbjct  99   QTYAAELANKDFAYDGEKSLFTIGALPQVKNEFTVVVEDFSTGKTPANGSPGNDSPPGSD  158

Query  492  KKR  500
            +KR
Sbjct  159  RKR  161



>ref|XP_007133316.1| hypothetical protein PHAVU_011G169400g [Phaseolus vulgaris]
 gb|ESW05310.1| hypothetical protein PHAVU_011G169400g [Phaseolus vulgaris]
Length=886

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 3/145 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G G+ G+ I +L NHFKV+V+  D  FF YSVA+  ED R V+SKGIGRKV+DR++
Sbjct  41   ISRNGVGTTGKHISLLVNHFKVSVNAPDTVFFQYSVAITLEDKRAVESKGIGRKVIDRLY  100

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDKK  497
              Y +EL GK F +DG K+L+T G LP NK EF V LEE    R+ G  + GS  E + K
Sbjct  101  QIYSSELGGKRFTHDGGKTLYTTGPLPLNKYEFKVFLEESFRKRSAG--ADGSLRE-ETK  157

Query  498  RLRRPYRSKTYKVEISFAAKIPMNA  572
            R +  ++SKT+ VEISFAAKIPM +
Sbjct  158  RSKNSFQSKTFTVEISFAAKIPMQS  182



>ref|XP_006594374.1| PREDICTED: protein argonaute 16-like isoform X5 [Glycine max]
Length=790

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G G+ G+ IP+L N F+V V+  D  FF YSVA+ +ED + V+SKGIGRKV+DR++
Sbjct  56   ISRNGVGTTGKHIPLLVNLFEVAVNVPDTVFFQYSVAITFEDKQAVESKGIGRKVIDRLY  115

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN--EGD  491
             TY +EL GK F YDG K+L+TVG LP NK EF V+LE+  + R++   SPG+      +
Sbjct  116  QTYSSELGGKRFVYDGGKTLYTVGPLPLNKYEFKVLLEKSFTKRSSAK-SPGANGSLHEE  174

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
             KR +  ++SKT+ VEISFA KIP+ +
Sbjct  175  TKRSKHSFQSKTFMVEISFATKIPLQS  201



>gb|KHN37722.1| Protein argonaute 16 [Glycine soja]
Length=843

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = +3

Query  138  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  317
            ++R G G+ G+ IP+L N F+V V+  D  FF YSVA+ +ED + V+SKGIGRKV+DR++
Sbjct  41   ISRNGVGTTGKHIPLLVNLFEVAVNVPDTVFFQYSVAITFEDKQAVESKGIGRKVIDRLY  100

Query  318  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN--EGD  491
             TY +EL GK F YDG K+L+TVG LP NK EF V+LE+  + R++   SPG+      +
Sbjct  101  QTYSSELGGKRFVYDGGKTLYTVGPLPLNKYEFKVLLEKSFTKRSSAK-SPGANGSLHEE  159

Query  492  KKRLRRPYRSKTYKVEISFAAKIPMNA  572
             KR +  ++SKT+ VEISFA KIP+ +
Sbjct  160  TKRSKHSFQSKTFMVEISFATKIPLQS  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515