BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS115G01

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365448.1|  PREDICTED: uncharacterized protein LOC102601...    122   1e-28   Solanum tuberosum [potatoes]
ref|XP_006365446.1|  PREDICTED: uncharacterized protein LOC102601...    122   1e-28   Solanum tuberosum [potatoes]
emb|CDP17927.1|  unnamed protein product                                118   2e-28   Coffea canephora [robusta coffee]
ref|XP_011088416.1|  PREDICTED: uncharacterized protein LOC105169651    114   6e-26   Sesamum indicum [beniseed]
ref|XP_009625453.1|  PREDICTED: uncharacterized protein LOC104116...    112   2e-25   Nicotiana tomentosiformis
ref|XP_009625452.1|  PREDICTED: uncharacterized protein LOC104116...    112   3e-25   
ref|XP_009625451.1|  PREDICTED: uncharacterized protein LOC104116...    112   3e-25   Nicotiana tomentosiformis
ref|XP_009625454.1|  PREDICTED: uncharacterized protein LOC104116...    110   2e-24   
ref|XP_007148971.1|  hypothetical protein PHAVU_005G029800g             105   1e-22   Phaseolus vulgaris [French bean]
ref|XP_006578482.1|  PREDICTED: uncharacterized protein LOC100812...    104   3e-22   Glycine max [soybeans]
ref|XP_006578476.1|  PREDICTED: uncharacterized protein LOC100812...    104   3e-22   Glycine max [soybeans]
ref|XP_006578483.1|  PREDICTED: uncharacterized protein LOC100812...    103   3e-22   Glycine max [soybeans]
ref|XP_003542832.1|  PREDICTED: uncharacterized protein LOC100781565    103   7e-22   Glycine max [soybeans]
ref|XP_006598114.1|  PREDICTED: uncharacterized protein LOC100793...    101   2e-21   Glycine max [soybeans]
ref|XP_003546724.1|  PREDICTED: uncharacterized protein LOC100793...    101   2e-21   Glycine max [soybeans]
ref|XP_009354450.1|  PREDICTED: uncharacterized protein LOC103945582  99.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008245415.1|  PREDICTED: uncharacterized protein LOC103343530  98.6    3e-20   Prunus mume [ume]
ref|XP_007011119.1|  Agglutinin-like protein ALA1, putative isofo...  96.7    9e-20   
ref|XP_007011120.1|  Agglutinin-like protein ALA1, putative isofo...  96.3    2e-19   
ref|XP_002269821.2|  PREDICTED: uncharacterized protein LOC100248068  96.3    2e-19   Vitis vinifera
ref|XP_007011118.1|  Agglutinin-like protein ALA1, putative isofo...  96.3    2e-19   
ref|XP_002303916.2|  hypothetical protein POPTR_0003s19960g           94.0    4e-19   
ref|XP_008348415.1|  PREDICTED: uncharacterized protein LOC103411...  94.7    5e-19   
ref|XP_006591191.1|  PREDICTED: uncharacterized protein LOC100800...  94.7    6e-19   Glycine max [soybeans]
ref|XP_006591194.1|  PREDICTED: uncharacterized protein LOC100800...  94.7    6e-19   Glycine max [soybeans]
ref|XP_008348404.1|  PREDICTED: uncharacterized protein LOC103411...  94.7    6e-19   
gb|KDP40512.1|  hypothetical protein JCGZ_24511                       94.4    9e-19   Jatropha curcas
ref|XP_009361981.1|  PREDICTED: uncharacterized protein LOC103952...  92.4    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009361983.1|  PREDICTED: uncharacterized protein LOC103952...  92.4    4e-18   
ref|XP_010999608.1|  PREDICTED: uncharacterized protein LOC105107...  91.7    6e-18   Populus euphratica
ref|XP_010999605.1|  PREDICTED: uncharacterized protein LOC105107...  91.7    6e-18   Populus euphratica
ref|XP_010999611.1|  PREDICTED: uncharacterized protein LOC105107...  91.7    6e-18   Populus euphratica
ref|XP_010999610.1|  PREDICTED: uncharacterized protein LOC105107...  91.7    6e-18   Populus euphratica
ref|XP_011042162.1|  PREDICTED: uncharacterized protein LOC105137...  91.3    9e-18   Populus euphratica
ref|XP_011042166.1|  PREDICTED: uncharacterized protein LOC105137...  91.3    9e-18   Populus euphratica
ref|XP_006368608.1|  hypothetical protein POPTR_0001s06240g           89.4    9e-18   
gb|EYU38268.1|  hypothetical protein MIMGU_mgv1a003852mg              90.9    9e-18   Erythranthe guttata [common monkey flower]
ref|XP_006368599.1|  hypothetical protein POPTR_0001s06240g           90.1    1e-17   
gb|KHN27322.1|  hypothetical protein glysoja_031930                   90.5    1e-17   Glycine soja [wild soybean]
ref|XP_006368609.1|  hypothetical protein POPTR_0001s06240g           89.7    2e-17   
ref|XP_006368606.1|  hypothetical protein POPTR_0001s06240g           90.1    2e-17   
ref|XP_006368607.1|  hypothetical protein POPTR_0001s06240g           90.1    2e-17   
ref|XP_006368600.1|  hypothetical protein POPTR_0001s06240g           90.1    2e-17   
ref|XP_006368598.1|  hypothetical protein POPTR_0001s06240g           89.7    2e-17   
ref|XP_002299214.2|  hypothetical protein POPTR_0001s06240g           89.7    2e-17   
gb|KHN15235.1|  hypothetical protein glysoja_041069                   86.3    4e-16   Glycine soja [wild soybean]
ref|XP_006420755.1|  hypothetical protein CICLE_v10004446mg           86.3    5e-16   Citrus clementina [clementine]
gb|KHN37651.1|  hypothetical protein glysoja_007354                   85.1    1e-15   Glycine soja [wild soybean]
ref|XP_004307129.1|  PREDICTED: uncharacterized protein LOC101312766  83.6    4e-15   Fragaria vesca subsp. vesca
gb|ACJ85857.1|  unknown                                               81.6    5e-15   Medicago truncatula
gb|KHN21308.1|  hypothetical protein glysoja_024808                   79.3    1e-14   Glycine soja [wild soybean]
gb|EPS58888.1|  hypothetical protein M569_15926                       76.6    1e-14   Genlisea aurea
gb|ABD28297.1|  conserved hypothetical protein                        82.0    1e-14   Medicago truncatula
ref|XP_010523384.1|  PREDICTED: uncharacterized protein LOC104801...  80.5    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010523380.1|  PREDICTED: uncharacterized protein LOC104801...  80.5    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_002513079.1|  conserved hypothetical protein                   78.2    2e-13   
gb|KJB60255.1|  hypothetical protein B456_009G296300                  78.2    3e-13   Gossypium raimondii
gb|KJB60254.1|  hypothetical protein B456_009G296300                  78.2    3e-13   Gossypium raimondii
ref|XP_007133787.1|  hypothetical protein PHAVU_011G2091001g          77.4    4e-13   Phaseolus vulgaris [French bean]
gb|KHG09240.1|  hypothetical protein F383_16006                       77.4    5e-13   Gossypium arboreum [tree cotton]
dbj|BAC41810.1|  unknown protein                                      74.7    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190089.1|  uncharacterized protein                          76.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAB77570.1|  putative protein                                     75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191014.2|  uncharacterized protein                             75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494919.1|  PREDICTED: uncharacterized protein LOC102616...  75.9    2e-12   Citrus sinensis [apfelsine]
ref|XP_006403566.1|  hypothetical protein EUTSA_v10010203mg           75.5    2e-12   
ref|XP_006403565.1|  hypothetical protein EUTSA_v10010203mg           75.5    2e-12   
ref|XP_008446935.1|  PREDICTED: uncharacterized protein LOC103489...  74.3    5e-12   Cucumis melo [Oriental melon]
ref|XP_010554475.1|  PREDICTED: uncharacterized protein LOC104824...  73.6    9e-12   Tarenaya hassleriana [spider flower]
ref|XP_011042160.1|  PREDICTED: uncharacterized protein LOC105137...  73.2    1e-11   Populus euphratica
ref|XP_011042158.1|  PREDICTED: uncharacterized protein LOC105137...  73.2    1e-11   Populus euphratica
ref|XP_011042161.1|  PREDICTED: uncharacterized protein LOC105137...  73.2    1e-11   Populus euphratica
ref|XP_011042163.1|  PREDICTED: uncharacterized protein LOC105137...  73.2    1e-11   Populus euphratica
ref|XP_004157548.1|  PREDICTED: uncharacterized LOC101219885          67.8    1e-10   
gb|KCW51729.1|  hypothetical protein EUGRSUZ_J01191                   68.9    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010032314.1|  PREDICTED: uncharacterized protein LOC104421...  69.3    2e-10   
ref|XP_010032315.1|  PREDICTED: uncharacterized protein LOC104421...  69.3    2e-10   
gb|KGN52307.1|  hypothetical protein Csa_5G623710                     68.9    2e-10   Cucumis sativus [cucumbers]
ref|XP_004142397.1|  PREDICTED: uncharacterized protein LOC101219885  68.9    2e-10   Cucumis sativus [cucumbers]
gb|KDO41931.1|  hypothetical protein CISIN_1g0050322mg                68.9    3e-10   Citrus sinensis [apfelsine]
ref|XP_010504256.1|  PREDICTED: uncharacterized protein LOC104781...  68.9    3e-10   
ref|XP_010504255.1|  PREDICTED: uncharacterized protein LOC104781...  68.9    3e-10   
gb|KDO41929.1|  hypothetical protein CISIN_1g0050322mg                68.6    3e-10   Citrus sinensis [apfelsine]
gb|KDO41924.1|  hypothetical protein CISIN_1g0050322mg                68.6    3e-10   Citrus sinensis [apfelsine]
gb|KDO41923.1|  hypothetical protein CISIN_1g0050322mg                68.6    4e-10   Citrus sinensis [apfelsine]
ref|XP_010515977.1|  PREDICTED: uncharacterized protein LOC104791...  67.8    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010515978.1|  PREDICTED: uncharacterized protein LOC104791...  67.8    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010427152.1|  PREDICTED: uncharacterized protein LOC104712...  67.4    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010427151.1|  PREDICTED: uncharacterized protein LOC104712...  67.4    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011016295.1|  PREDICTED: uncharacterized protein LOC105119...  63.9    1e-09   Populus euphratica
ref|XP_011016298.1|  PREDICTED: uncharacterized protein LOC105119...  63.9    1e-09   Populus euphratica
ref|XP_011016297.1|  PREDICTED: uncharacterized protein LOC105119...  63.9    1e-09   Populus euphratica
ref|XP_006290711.1|  hypothetical protein CARUB_v10016808mg           64.7    5e-09   Capsella rubella
ref|XP_010931991.1|  PREDICTED: uncharacterized protein LOC105052...  64.7    6e-09   Elaeis guineensis
ref|XP_010931993.1|  PREDICTED: uncharacterized protein LOC105052...  64.7    6e-09   Elaeis guineensis
ref|XP_010922163.1|  PREDICTED: uncharacterized protein LOC105045...  63.2    2e-08   
ref|XP_010922164.1|  PREDICTED: uncharacterized protein LOC105045...  62.8    2e-08   Elaeis guineensis
ref|XP_010922157.1|  PREDICTED: uncharacterized protein LOC105045...  62.8    2e-08   
ref|XP_010922162.1|  PREDICTED: uncharacterized protein LOC105045...  62.8    2e-08   
ref|XP_010922160.1|  PREDICTED: uncharacterized protein LOC105045...  62.8    3e-08   Elaeis guineensis
ref|XP_010922161.1|  PREDICTED: uncharacterized protein LOC105045...  62.8    3e-08   
ref|XP_002877982.1|  hypothetical protein ARALYDRAFT_485852           62.0    5e-08   
gb|KCW65935.1|  hypothetical protein EUGRSUZ_G03246                   61.6    6e-08   Eucalyptus grandis [rose gum]
emb|CDY07537.1|  BnaC06g15270D                                        61.2    8e-08   Brassica napus [oilseed rape]
gb|KCW65936.1|  hypothetical protein EUGRSUZ_G03246                   60.8    8e-08   Eucalyptus grandis [rose gum]
gb|KCW65934.1|  hypothetical protein EUGRSUZ_G03246                   60.8    1e-07   Eucalyptus grandis [rose gum]
gb|KCW65931.1|  hypothetical protein EUGRSUZ_G03246                   60.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_010067747.1|  PREDICTED: uncharacterized protein LOC104454...  60.8    1e-07   
ref|XP_006403569.1|  hypothetical protein EUTSA_v10010203mg           60.5    2e-07   
ref|XP_010273217.1|  PREDICTED: uncharacterized protein LOC104608821  58.9    5e-07   Nelumbo nucifera [Indian lotus]
emb|CDX67602.1|  BnaA07g16420D                                        58.5    6e-07   
ref|XP_009103923.1|  PREDICTED: uncharacterized protein LOC103829...  58.5    6e-07   Brassica rapa
ref|XP_009103922.1|  PREDICTED: uncharacterized protein LOC103829...  58.2    7e-07   Brassica rapa
ref|XP_010670452.1|  PREDICTED: uncharacterized protein LOC104887...  58.2    9e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670455.1|  PREDICTED: uncharacterized protein LOC104887...  57.8    9e-07   
ref|XP_008786901.1|  PREDICTED: uncharacterized protein LOC103705079  56.6    3e-06   Phoenix dactylifera
gb|ADN34208.1|  hypothetical protein                                  55.5    6e-06   Cucumis melo subsp. melo
ref|XP_008446936.1|  PREDICTED: uncharacterized protein LOC103489...  55.5    7e-06   Cucumis melo [Oriental melon]
ref|NP_001190088.1|  uncharacterized protein                          55.1    8e-06   
ref|XP_010554474.1|  PREDICTED: uncharacterized protein LOC104824...  54.7    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010032312.1|  PREDICTED: uncharacterized protein LOC104421...  52.4    7e-05   Eucalyptus grandis [rose gum]
ref|XP_010032316.1|  PREDICTED: uncharacterized protein LOC104421...  52.4    7e-05   
ref|XP_010032313.1|  PREDICTED: uncharacterized protein LOC104421...  52.4    7e-05   
gb|EPS67716.1|  hypothetical protein M569_07059                       50.8    2e-04   Genlisea aurea



>ref|XP_006365448.1| PREDICTED: uncharacterized protein LOC102601920 isoform X3 [Solanum 
tuberosum]
Length=656

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MF+WNDEEL +IIWGETGESDDHIVP+PD S+GK PA + D++K++WD+EASN+K  DQK
Sbjct  1    MFNWNDEELNDIIWGETGESDDHIVPHPDGSEGKAPA-YGDNIKKKWDVEASNIKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
            KP  K    +IKL+ SSKH TD          +L  DLSL+N TK +Q SS
Sbjct  60   KPTTKMDLSNIKLDGSSKHDTDGPTMKAGCRIELGTDLSLTNATKSNQDSS  110



>ref|XP_006365446.1| PREDICTED: uncharacterized protein LOC102601920 isoform X1 [Solanum 
tuberosum]
 ref|XP_006365447.1| PREDICTED: uncharacterized protein LOC102601920 isoform X2 [Solanum 
tuberosum]
Length=662

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MF+WNDEEL +IIWGETGESDDHIVP+PD S+GK PA + D++K++WD+EASN+K  DQK
Sbjct  1    MFNWNDEELNDIIWGETGESDDHIVPHPDGSEGKAPA-YGDNIKKKWDVEASNIKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
            KP  K    +IKL+ SSKH TD          +L  DLSL+N TK +Q SS
Sbjct  60   KPTTKMDLSNIKLDGSSKHDTDGPTMKAGCRIELGTDLSLTNATKSNQDSS  110



>emb|CDP17927.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL+NIIWGE GE +DHIVPYPD ++ K   S+ D +K+E + EA +VK  +QK
Sbjct  1    MFDWNDEELSNIIWGEAGEGEDHIVPYPDANEEKSLGSYGDCIKKEKNQEAVDVKTAEQK  60

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
            KPA +S    +KL+ SS++ T+E L A+ FG D WPDLSL    K ++
Sbjct  61   KPATQSDLHGVKLQCSSQYDTNEDLSAMEFGVDSWPDLSLPGAAKANE  108



>ref|XP_011088416.1| PREDICTED: uncharacterized protein LOC105169651 [Sesamum indicum]
Length=704

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE GESDDHIVPYPD+ + KPP    D  K+E + + SNV   +QK
Sbjct  1    MFDWNDEELTNIIWGEGGESDDHIVPYPDQIEEKPPVLFGDPSKKETNQQISNVSPVEQK  60

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPD---LSLSNTTKMDQGS  557
            KP  KS  +++L+ SSK+   E  PA  FG D WP+    S SN  K DQGS
Sbjct  61   KPIIKSEHEVELDGSSKYDISE--PATGFGMDSWPEGPGPSSSNAAKADQGS  110



>ref|XP_009625453.1| PREDICTED: uncharacterized protein LOC104116328 isoform X3 [Nicotiana 
tomentosiformis]
Length=641

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELT+IIW +TG+SDDH VPYPD S+ + PA ++D++K+EWD+EAS+ K  DQK
Sbjct  1    MFDWNDEELTDIIWSDTGQSDDHTVPYPDGSEKEAPA-YKDNIKKEWDVEASSFKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  K+   +IKL+ SSKH T  A     +  +   D SL+N TK +Q S
Sbjct  60   KPTTKTDLSNIKLDGSSKHDTGGAAITAGYRVESSADFSLTNATKSNQDS  109



>ref|XP_009625452.1| PREDICTED: uncharacterized protein LOC104116328 isoform X2 [Nicotiana 
tomentosiformis]
Length=648

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELT+IIW +TG+SDDH VPYPD S+ + PA ++D++K+EWD+EAS+ K  DQK
Sbjct  1    MFDWNDEELTDIIWSDTGQSDDHTVPYPDGSEKEAPA-YKDNIKKEWDVEASSFKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  K+   +IKL+ SSKH T  A     +  +   D SL+N TK +Q S
Sbjct  60   KPTTKTDLSNIKLDGSSKHDTGGAAITAGYRVESSADFSLTNATKSNQDS  109



>ref|XP_009625451.1| PREDICTED: uncharacterized protein LOC104116328 isoform X1 [Nicotiana 
tomentosiformis]
Length=665

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELT+IIW +TG+SDDH VPYPD S+ + PA ++D++K+EWD+EAS+ K  DQK
Sbjct  1    MFDWNDEELTDIIWSDTGQSDDHTVPYPDGSEKEAPA-YKDNIKKEWDVEASSFKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  K+   +IKL+ SSKH T  A     +  +   D SL+N TK +Q S
Sbjct  60   KPTTKTDLSNIKLDGSSKHDTGGAAITAGYRVESSADFSLTNATKSNQDS  109



>ref|XP_009625454.1| PREDICTED: uncharacterized protein LOC104116328 isoform X4 [Nicotiana 
tomentosiformis]
Length=641

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELT+IIW +TG+SDDH VPYPD S+ + PA ++D++K+EWD+EAS+ K  DQK
Sbjct  1    MFDWNDEELTDIIWSDTGQSDDHTVPYPDGSEKEAPA-YKDNIKKEWDVEASSFKPTDQK  59

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQG  554
            KP  K+   +IKL+ SSKH T  A     +  +   D SL+N TK ++ 
Sbjct  60   KPTTKTDLSNIKLDGSSKHDTGGAAITAGYRVESSADFSLTNATKNERN  108



>ref|XP_007148971.1| hypothetical protein PHAVU_005G029800g [Phaseolus vulgaris]
 gb|ESW20965.1| hypothetical protein PHAVU_005G029800g [Phaseolus vulgaris]
Length=666

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPYP+ ++         S K+E++ EAS  KL + K
Sbjct  1    MFDWNDEELANIIWGEEGESDDHIVPYPEVNEDV-------SSKKEFNQEASTTKLTELK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSSK      LP L +G   WP LSLS++ K+DQ S
Sbjct  54   RPEAKTDFHERKLGSSSKFDNSVELPVLGYGTHAWPGLSLSSSAKIDQES  103



>ref|XP_006578482.1| PREDICTED: uncharacterized protein LOC100812174 isoform X7 [Glycine 
max]
Length=656

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPYP+ ++         S K+EW+ EA+  KL + K
Sbjct  1    MFDWNDEELANIIWGEGGESDDHIVPYPEVNEDV-------SNKKEWNQEAAATKLTELK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSS       LP   +G + WPDL+LS++ K+D GS
Sbjct  54   RPEAKTDFHERKLGSSSNLDNSGELPTSGYGTNAWPDLALSSSAKIDHGS  103



>ref|XP_006578476.1| PREDICTED: uncharacterized protein LOC100812174 isoform X1 [Glycine 
max]
 ref|XP_006578477.1| PREDICTED: uncharacterized protein LOC100812174 isoform X2 [Glycine 
max]
 ref|XP_006578478.1| PREDICTED: uncharacterized protein LOC100812174 isoform X3 [Glycine 
max]
 ref|XP_006578479.1| PREDICTED: uncharacterized protein LOC100812174 isoform X4 [Glycine 
max]
 ref|XP_006578480.1| PREDICTED: uncharacterized protein LOC100812174 isoform X5 [Glycine 
max]
 ref|XP_006578481.1| PREDICTED: uncharacterized protein LOC100812174 isoform X6 [Glycine 
max]
Length=657

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPYP+ ++         S K+EW+ EA+  KL + K
Sbjct  1    MFDWNDEELANIIWGEGGESDDHIVPYPEVNEDV-------SNKKEWNQEAAATKLTELK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSS       LP   +G + WPDL+LS++ K+D GS
Sbjct  54   RPEAKTDFHERKLGSSSNLDNSGELPTSGYGTNAWPDLALSSSAKIDHGS  103



>ref|XP_006578483.1| PREDICTED: uncharacterized protein LOC100812174 isoform X8 [Glycine 
max]
Length=638

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPYP+ ++         S K+EW+ EA+  KL + K
Sbjct  1    MFDWNDEELANIIWGEGGESDDHIVPYPEVNEDV-------SNKKEWNQEAAATKLTELK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSS       LP   +G + WPDL+LS++ K+D GS
Sbjct  54   RPEAKTDFHERKLGSSSNLDNSGELPTSGYGTNAWPDLALSSSAKIDHGS  103



>ref|XP_003542832.1| PREDICTED: uncharacterized protein LOC100781565 [Glycine max]
Length=652

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NI+WGE GESDDHIVPYP+       AS   + K+EW+ EAS  KL +Q+
Sbjct  1    MFDWNDEELANIVWGEAGESDDHIVPYPE-------ASEDLNDKKEWNQEASATKLIEQR  53

Query  411  KPAPKSGFDI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +   K+ F   KL SSSK    E   A   G   WPDLSLSN  K DQGS
Sbjct  54   RIEAKTDFHQGKLGSSSKLDIIEGSSASESGTKSWPDLSLSNAAKTDQGS  103



>ref|XP_006598114.1| PREDICTED: uncharacterized protein LOC100793985 isoform X2 [Glycine 
max]
Length=654

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NI+WGE GE DDHIVPYP+       AS   + K+EW  EAS  KL DQK
Sbjct  1    MFDWNDEELANIVWGEVGEGDDHIVPYPE-------ASEDLNDKKEWSQEASATKLIDQK  53

Query  411  KPAPKSGFDI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +   K+ F   KL SSSK    E   A   G + WPDLSLS   K DQGS
Sbjct  54   RIEAKTDFHQGKLGSSSKLDIIEGQSASESGTNSWPDLSLSTAAKTDQGS  103



>ref|XP_003546724.1| PREDICTED: uncharacterized protein LOC100793985 isoform X1 [Glycine 
max]
Length=655

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NI+WGE GE DDHIVPYP+       AS   + K+EW  EAS  KL DQK
Sbjct  1    MFDWNDEELANIVWGEVGEGDDHIVPYPE-------ASEDLNDKKEWSQEASATKLIDQK  53

Query  411  KPAPKSGFDI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +   K+ F   KL SSSK    E   A   G + WPDLSLS   K DQGS
Sbjct  54   RIEAKTDFHQGKLGSSSKLDIIEGQSASESGTNSWPDLSLSTAAKTDQGS  103



>ref|XP_009354450.1| PREDICTED: uncharacterized protein LOC103945582 [Pyrus x bretschneideri]
Length=698

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPY + SD           K+EW  E+ N+K  +QK
Sbjct  1    MFDWNDEELANIIWGEAGESDDHIVPYNEASDDY-------CNKKEWKQESHNMKPTEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D KLESSS     E +    FG D WPDLSLSN  K +Q
Sbjct  54   IHGSKIDLQDTKLESSSNFDMGEGISTSEFGMDSWPDLSLSNVAKSEQ  101



>ref|XP_008245415.1| PREDICTED: uncharacterized protein LOC103343530 [Prunus mume]
Length=693

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GE+DDHIVPYP+ SD           K+EW  E+  +K  ++K
Sbjct  1    MFDWNDEELANIIWGEAGENDDHIVPYPEASDDY-------CNKKEWGQESHTIKPTERK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
             P  K    I L SSS   T E +    FG D WPDLSLS+  K +Q
Sbjct  54   TPVAK----IDLHSSSNFDTIEGISTSEFGMDSWPDLSLSDVAKTEQ  96



>ref|XP_007011119.1| Agglutinin-like protein ALA1, putative isoform 2 [Theobroma cacao]
 gb|EOY19929.1| Agglutinin-like protein ALA1, putative isoform 2 [Theobroma cacao]
Length=606

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE GESDDHIVPY + S+      H    K+EW  E + +K  DQK
Sbjct  1    MFDWNDEELTNIIWGEDGESDDHIVPYQEGSEN----CHS---KKEWSQETATIKSTDQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K      K+E SS    +  +    FG   WP+LSLSN  K DQ S
Sbjct  54   TPGDKVDLHGRKVEGSSNFNANGGIATSGFGMVSWPELSLSNAAKTDQDS  103



>ref|XP_007011120.1| Agglutinin-like protein ALA1, putative isoform 3 [Theobroma cacao]
 gb|EOY19930.1| Agglutinin-like protein ALA1, putative isoform 3 [Theobroma cacao]
Length=679

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE GESDDHIVPY + S+      H    K+EW  E + +K  DQK
Sbjct  1    MFDWNDEELTNIIWGEDGESDDHIVPYQEGSEN----CHS---KKEWSQETATIKSTDQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K      K+E SS    +  +    FG   WP+LSLSN  K DQ S
Sbjct  54   TPGDKVDLHGRKVEGSSNFNANGGIATSGFGMVSWPELSLSNAAKTDQDS  103



>ref|XP_002269821.2| PREDICTED: uncharacterized protein LOC100248068 [Vitis vinifera]
 emb|CBI35150.3| unnamed protein product [Vitis vinifera]
Length=704

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWG+ GESDDH VPYP+E++ KPPA+   + K +W+ E ++VK  +Q 
Sbjct  1    MFDWNDEELANIIWGDAGESDDHTVPYPNENEKKPPATFGVNNK-DWNQEVTDVKPTEQT  59

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K  F   K E S+    +E LP   F    W DLS SN  K +Q S
Sbjct  60   ASGAKIQFHGNKQEHSTNLDINEGLPGTGFSMGSWSDLSSSNAAKTNQDS  109



>ref|XP_007011118.1| Agglutinin-like protein ALA1, putative isoform 1 [Theobroma cacao]
 ref|XP_007011121.1| Agglutinin-like protein ALA1, putative isoform 1 [Theobroma cacao]
 gb|EOY19928.1| Agglutinin-like protein ALA1, putative isoform 1 [Theobroma cacao]
 gb|EOY19931.1| Agglutinin-like protein ALA1, putative isoform 1 [Theobroma cacao]
Length=705

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE GESDDHIVPY + S+      H    K+EW  E + +K  DQK
Sbjct  1    MFDWNDEELTNIIWGEDGESDDHIVPYQEGSEN----CHS---KKEWSQETATIKSTDQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K      K+E SS    +  +    FG   WP+LSLSN  K DQ S
Sbjct  54   TPGDKVDLHGRKVEGSSNFNANGGIATSGFGMVSWPELSLSNAAKTDQDS  103



>ref|XP_002303916.2| hypothetical protein POPTR_0003s19960g [Populus trichocarpa]
 gb|EEE78895.2| hypothetical protein POPTR_0003s19960g [Populus trichocarpa]
Length=453

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 65/110 (59%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE  +SDDHIVPYP+       AS     K+E + EAS +K  +QK
Sbjct  1    MFDWNDEELTNIIWGEADDSDDHIVPYPE-------ASEDYCKKKESNEEASTIKSSEQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K   D  KLES S   T E   +L    D WP+LS SN  K +Q S
Sbjct  54   APGAKVDTDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSSNAAKTEQDS  103



>ref|XP_008348415.1| PREDICTED: uncharacterized protein LOC103411552 isoform X2 [Malus 
domestica]
 ref|XP_008344589.1| PREDICTED: uncharacterized protein LOC103407428 isoform X2 [Malus 
domestica]
Length=678

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPY + SD           K+EW  E+  +K   QK
Sbjct  1    MFDWNDEELANIIWGEAGESDDHIVPYNEASDDY-------XNKKEWKQESHTIKPTXQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D KLE+SS     E +    FG D WPDLSLSN  K +Q
Sbjct  54   IHGSKIDLQDRKLENSSNFDXGEGISTSEFGMDSWPDLSLSNVAKSEQ  101



>ref|XP_006591191.1| PREDICTED: uncharacterized protein LOC100800977 isoform X1 [Glycine 
max]
 ref|XP_006591192.1| PREDICTED: uncharacterized protein LOC100800977 isoform X2 [Glycine 
max]
 ref|XP_006591193.1| PREDICTED: uncharacterized protein LOC100800977 isoform X3 [Glycine 
max]
Length=661

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GES DHIVPYP+ ++         S  +EW+ EA+  KL   K
Sbjct  1    MFDWNDEELANIIWGEGGESVDHIVPYPEVNEDV-------SNIKEWNQEAAATKLTKLK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSS       L    +G + WPDLSLS +  +DQGS
Sbjct  54   RPEAKTDFHERKLGSSSNLDNSGELLTSGYGTNAWPDLSLSTSANIDQGS  103



>ref|XP_006591194.1| PREDICTED: uncharacterized protein LOC100800977 isoform X4 [Glycine 
max]
Length=660

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GES DHIVPYP+ ++         S  +EW+ EA+  KL   K
Sbjct  1    MFDWNDEELANIIWGEGGESVDHIVPYPEVNEDV-------SNIKEWNQEAAATKLTKLK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  K+ F + KL SSS       L    +G + WPDLSLS +  +DQGS
Sbjct  54   RPEAKTDFHERKLGSSSNLDNSGELLTSGYGTNAWPDLSLSTSANIDQGS  103



>ref|XP_008348404.1| PREDICTED: uncharacterized protein LOC103411552 isoform X1 [Malus 
domestica]
 ref|XP_008344588.1| PREDICTED: uncharacterized protein LOC103407428 isoform X1 [Malus 
domestica]
Length=704

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE GESDDHIVPY + SD           K+EW  E+  +K   QK
Sbjct  1    MFDWNDEELANIIWGEAGESDDHIVPYNEASDDY-------XNKKEWKQESHTIKPTXQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D KLE+SS     E +    FG D WPDLSLSN  K +Q
Sbjct  54   IHGSKIDLQDRKLENSSNFDXGEGISTSEFGMDSWPDLSLSNVAKSEQ  101



>gb|KDP40512.1| hypothetical protein JCGZ_24511 [Jatropha curcas]
Length=698

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELT+IIW E  ESDDHIVPYP+       AS     K++W  EA+N+K  +QK
Sbjct  1    MFDWNDEELTDIIWDEAAESDDHIVPYPE-------ASGDFCKKKKWSQEANNIKSNEQK  53

Query  411  KPAPKSGFDI---KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   DI   KL+SSS   + E    L FG D WP+LSLS   K  Q S
Sbjct  54   ATGTK--IDIHGRKLQSSSNFDSSEGASTLGFGIDSWPNLSLSTAAKTHQES  103



>ref|XP_009361981.1| PREDICTED: uncharacterized protein LOC103952161 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009361982.1| PREDICTED: uncharacterized protein LOC103952161 isoform X1 [Pyrus 
x bretschneideri]
Length=697

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 65/108 (60%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NI+W E  ESDDHIVPY + S+      +R+  K++W  E+  +K  +QK
Sbjct  1    MFDWNDEELANIVWSEAVESDDHIVPYNEASE-----DYRN--KKQWKQESHTIKPTEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
               PK    D KLESS    T E +    FG D WPDLSL+N  K +Q
Sbjct  54   THGPKIDLQDRKLESSPNFDTSEGISTSEFGMDSWPDLSLANVAKSEQ  101



>ref|XP_009361983.1| PREDICTED: uncharacterized protein LOC103952161 isoform X2 [Pyrus 
x bretschneideri]
Length=671

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 65/108 (60%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NI+W E  ESDDHIVPY + S+      +R+  K++W  E+  +K  +QK
Sbjct  1    MFDWNDEELANIVWSEAVESDDHIVPYNEASE-----DYRN--KKQWKQESHTIKPTEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
               PK    D KLESS    T E +    FG D WPDLSL+N  K +Q
Sbjct  54   THGPKIDLQDRKLESSPNFDTSEGISTSEFGMDSWPDLSLANVAKSEQ  101



>ref|XP_010999608.1| PREDICTED: uncharacterized protein LOC105107397 isoform X2 [Populus 
euphratica]
Length=649

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEE+TNIIWGET  SDDHIVP+PD       AS     K+E   EA  +  G QK
Sbjct  1    MFDWNDEEITNIIWGETDNSDDHIVPFPD-------ASEDYCKKKESSGEAGTINSGAQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  + DQ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAETDQDS  103



>ref|XP_010999605.1| PREDICTED: uncharacterized protein LOC105107397 isoform X1 [Populus 
euphratica]
 ref|XP_010999606.1| PREDICTED: uncharacterized protein LOC105107397 isoform X1 [Populus 
euphratica]
 ref|XP_010999607.1| PREDICTED: uncharacterized protein LOC105107397 isoform X1 [Populus 
euphratica]
Length=650

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEE+TNIIWGET  SDDHIVP+PD       AS     K+E   EA  +  G QK
Sbjct  1    MFDWNDEEITNIIWGETDNSDDHIVPFPD-------ASEDYCKKKESSGEAGTINSGAQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  + DQ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAETDQDS  103



>ref|XP_010999611.1| PREDICTED: uncharacterized protein LOC105107397 isoform X4 [Populus 
euphratica]
Length=634

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEE+TNIIWGET  SDDHIVP+PD       AS     K+E   EA  +  G QK
Sbjct  1    MFDWNDEEITNIIWGETDNSDDHIVPFPD-------ASEDYCKKKESSGEAGTINSGAQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  + DQ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAETDQDS  103



>ref|XP_010999610.1| PREDICTED: uncharacterized protein LOC105107397 isoform X3 [Populus 
euphratica]
Length=647

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEE+TNIIWGET  SDDHIVP+PD       AS     K+E   EA  +  G QK
Sbjct  1    MFDWNDEEITNIIWGETDNSDDHIVPFPD-------ASEDYCKKKESSGEAGTINSGAQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  + DQ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAETDQDS  103



>ref|XP_011042162.1| PREDICTED: uncharacterized protein LOC105137914 isoform X4 [Populus 
euphratica]
Length=687

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK
Sbjct  1    MFDWNDEELTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K   D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  54   APGAKVDTDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  103



>ref|XP_011042166.1| PREDICTED: uncharacterized protein LOC105137914 isoform X7 [Populus 
euphratica]
Length=685

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK
Sbjct  1    MFDWNDEELTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P  K   D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  54   APGAKVDTDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  103



>ref|XP_006368608.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65177.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=381

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>gb|EYU38268.1| hypothetical protein MIMGU_mgv1a003852mg [Erythranthe guttata]
Length=560

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGE  ESDDHIVPYP + + KP     D  K+E + + +N+   +QK
Sbjct  1    MFDWNDEELTNIVWGEARESDDHIVPYPGQIEEKPAVLFGDPSKKEINQQTTNISSVEQK  60

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
            KP  KS + ++L+SS K+ T E  P    G     + S SN  K D
Sbjct  61   KPTVKSEYAVELDSSPKYDTCE--PVTGVGP--HSETSSSNAAKAD  102



>ref|XP_006368599.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65168.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=543

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>gb|KHN27322.1| hypothetical protein glysoja_031930 [Glycine soja]
Length=594

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +3

Query  228  AMFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            +  +W +++L NI+WGE GE DDHIVPYP+       AS   + K+EW  EAS  KL DQ
Sbjct  2    SAINWQEQKLANIVWGEVGEGDDHIVPYPE-------ASEDLNDKKEWSQEASATKLIDQ  54

Query  408  KKPAPKSGFDI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K+   K+ F   KL SSSK    E   A   G + WPDLSLS   K DQGS
Sbjct  55   KRIEAKTDFHQGKLRSSSKLDIIEGQSASESGTNSWPDLSLSTAAKTDQGS  105



>ref|XP_006368609.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65178.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=488

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>ref|XP_006368606.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65175.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=634

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>ref|XP_006368607.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65176.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=638

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>ref|XP_006368600.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65169.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=649

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>ref|XP_006368598.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 ref|XP_006368601.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 ref|XP_006368602.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 ref|XP_006368603.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 ref|XP_006368604.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 ref|XP_006368605.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65167.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65170.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65171.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65172.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65173.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|ERP65174.1| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=650

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>ref|XP_002299214.2| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
 gb|EEE84019.2| hypothetical protein POPTR_0001s06240g [Populus trichocarpa]
Length=647

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNI+WGET  SDDHIVP+PD S+           K+E   EA  +  G QK
Sbjct  1    MFDWNDEELTNILWGETDNSDDHIVPFPDTSEDY-------CKKKESSGEAGTINSGVQK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
                K   D  KLESSS   T E   A     D WP LSLSN  K D+ S
Sbjct  54   AAGAKVDIDGRKLESSSNFDTSEGTSASGVDIDRWPSLSLSNAAKTDRDS  103



>gb|KHN15235.1| hypothetical protein glysoja_041069 [Glycine soja]
Length=654

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +L NIIWGE GESDDHIVPYP+ ++         S K+EW+ EA+  KL + K+P  K+ 
Sbjct  5    QLANIIWGEGGESDDHIVPYPEVNEDV-------SNKKEWNQEAAATKLTELKRPEAKTD  57

Query  432  F-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            F + KL SSS       LP   +G + WPDL+LS++ K+D GS
Sbjct  58   FHERKLGSSSNLDNSGELPTSGYGTNAWPDLALSSSAKIDHGS  100



>ref|XP_006420755.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
 ref|XP_006420756.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
 ref|XP_006420757.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
 gb|ESR33995.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
 gb|ESR33996.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
 gb|ESR33997.1| hypothetical protein CICLE_v10004446mg [Citrus clementina]
Length=715

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE G+SDDHIVPY ++++           K+EW  EA+ +K  ++K
Sbjct  1    MFDWNDEELTNIIWGENGKSDDHIVPYQEKNEDY-------GNKKEWSQEATAIKPAERK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
             P  K  F+  KLE SS   + E       G   W DLS SN  K D+
Sbjct  54   MPEVKIDFNGRKLECSSNFNSCERNSVSGIGMGSWSDLSSSNAAKTDE  101



>gb|KHN37651.1| hypothetical protein glysoja_007354 [Glycine soja]
Length=649

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +L NI+WGE GESDDHIVPYP+       AS   + K+EW+ EAS  KL +Q++   K+ 
Sbjct  5    QLANIVWGEAGESDDHIVPYPE-------ASEDLNDKKEWNQEASATKLIEQRRIEAKTD  57

Query  432  FDI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            F   KL SSSK    E   A   G   WPDLSLSN  K DQGS
Sbjct  58   FHQGKLGSSSKLDIIEGSSASESGTKSWPDLSLSNAAKTDQGS  100



>ref|XP_004307129.1| PREDICTED: uncharacterized protein LOC101312766 [Fragaria vesca 
subsp. vesca]
 ref|XP_011469384.1| PREDICTED: uncharacterized protein LOC101312766 [Fragaria vesca 
subsp. vesca]
 ref|XP_011469386.1| PREDICTED: uncharacterized protein LOC101312766 [Fragaria vesca 
subsp. vesca]
Length=687

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWND+EL NIIWGE  ESDDHIVPYP+ +D      ++D  K+E + E+  +K  +QK
Sbjct  1    MFDWNDQELANIIWGEACESDDHIVPYPEATD-----DYQD--KKERNQESDTIKPTEQK  53

Query  411  KPAPKSGFDIKL-ESSSKHATDEALPALAFGKDLWPDLS  524
             P  K     +  ESSS   T E +    F  D WPDLS
Sbjct  54   APGAKVDLHGREPESSSNFETGEGISTSGFRTDTWPDLS  92



>gb|ACJ85857.1| unknown [Medicago truncatula]
Length=369

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 7/109 (6%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIW E GE DDHIVP+P+       AS     K+E + E +  KL  +K
Sbjct  1    MFDWNDEELANIIWDEGGEGDDHIVPFPE-------ASEDLKNKKEVNQEPAVCKLNKRK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  ++ FD KL SSS    +    A  +  +   DLSLS+  K+DQ S
Sbjct  54   QPETQTDFDGKLGSSSNLDNNGGQLASGYVANSCSDLSLSSAAKIDQDS  102



>gb|KHN21308.1| hypothetical protein glysoja_024808 [Glycine soja]
Length=254

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +L NIIWGE GESDDHIVPYP+        +   S  +EW+ EA+  KL   K+P  K+ 
Sbjct  6    QLANIIWGEGGESDDHIVPYPE-------VNEDVSNIKEWNQEAAATKLTKLKRPEAKTD  58

Query  432  F-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            F + KL SSS       L    +G + WPDLSLS +  +DQGS
Sbjct  59   FHERKLGSSSNLDNSGELLTSGYGTNAWPDLSLSTSANIDQGS  101



>gb|EPS58888.1| hypothetical protein M569_15926, partial [Genlisea aurea]
Length=101

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  210  FLFSFSAMFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASN  389
            FL     MFDWNDEELTN++WGE GE +DHIVPYPD+ D K      D  K+E + ++S+
Sbjct  15   FLRDLGEMFDWNDEELTNVLWGEAGERNDHIVPYPDQIDDKRAVLFEDDFKKEANRQSSS  74

Query  390  VKLGDQKKPAPKSG  431
            +    Q K   KS 
Sbjct  75   ISSVHQNKSTIKSA  88



>gb|ABD28297.1| conserved hypothetical protein [Medicago truncatula]
Length=654

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 7/109 (6%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIW E GE DDHIVP+P+       AS     K+E + E +  KL  +K
Sbjct  1    MFDWNDEELANIIWDEGGEGDDHIVPFPE-------ASEDLKNKKEVNQEPAVCKLNKRK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            +P  ++ FD KL SSS    +    A  +  +   DLSLS+  K+DQ S
Sbjct  54   QPETQTDFDGKLGSSSNLDNNGGQLASGYVANSCSDLSLSSAAKIDQDS  102



>ref|XP_010523384.1| PREDICTED: uncharacterized protein LOC104801739 isoform X2 [Tarenaya 
hassleriana]
Length=664

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWG+ GE+DDHIVP  + S  +         ++EW  E++  K  +QK
Sbjct  1    MFDWNDEELTNIIWGDDGEADDHIVPLKERSGLQ-------LNRKEWSEESNIHKPAEQK  53

Query  411  KPAPKSGFDI---KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                K   D+   K+ESSS +  +E + +  +G   WP+ SLS  T++DQ SS
Sbjct  54   TIGAK--IDLHGKKVESSSNYNVNEGISSSDYGFSTWPEPSLSKPTRVDQESS  104



>ref|XP_010523380.1| PREDICTED: uncharacterized protein LOC104801739 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523381.1| PREDICTED: uncharacterized protein LOC104801739 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523382.1| PREDICTED: uncharacterized protein LOC104801739 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523383.1| PREDICTED: uncharacterized protein LOC104801739 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWG+ GE+DDHIVP  + S  +         ++EW  E++  K  +QK
Sbjct  1    MFDWNDEELTNIIWGDDGEADDHIVPLKERSGLQ-------LNRKEWSEESNIHKPAEQK  53

Query  411  KPAPKSGFDI---KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                K   D+   K+ESSS +  +E + +  +G   WP+ SLS  T++DQ SS
Sbjct  54   TIGAK--IDLHGKKVESSSNYNVNEGISSSDYGFSTWPEPSLSKPTRVDQESS  104



>ref|XP_002513079.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49582.1| conserved hypothetical protein [Ricinus communis]
Length=735

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 70/130 (54%), Gaps = 17/130 (13%)
 Frame = +3

Query  177  VGDRRFGVGIFFLFSFSAMFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDS  356
            V +RR  + + +     A  D    +LTNIIW E GESDDHIVPYP        A    S
Sbjct  41   VMNRRRAILMRY-----AAEDLGFRKLTNIIWDEAGESDDHIVPYPG-------AVEDHS  88

Query  357  VKEEWDLEASNVKLGDQKKPAPKSGFDI---KLESSSKHATDEALPALAFGKDLWPDLSL  527
             ++EW  E +N+K  +QK P PK   DI   KLESSS   + E   A  FG D WP+LSL
Sbjct  89   KEKEWSQETNNIKSEEQKAPGPK--VDIHGRKLESSSNFNSSEGASASGFGIDSWPNLSL  146

Query  528  SNTTKMDQGS  557
            S   K DQ S
Sbjct  147  STAAKTDQDS  156



>gb|KJB60255.1| hypothetical protein B456_009G296300 [Gossypium raimondii]
Length=705

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIW ++GE+D  IVPY +        S     K+EW    + +K  +QK
Sbjct  1    MFDWNDEELKNIIWDDSGETDSLIVPYQE-------GSENCCSKKEWSQATAVIKPNEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  +    + KL+ SS   T   +     G   WP+LSLSN  K DQ S
Sbjct  54   KPGDEVDLCERKLDGSSNFNTKGGIDTSGVGIGSWPELSLSNAAKTDQNS  103



>gb|KJB60254.1| hypothetical protein B456_009G296300 [Gossypium raimondii]
Length=704

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIW ++GE+D  IVPY +        S     K+EW    + +K  +QK
Sbjct  1    MFDWNDEELKNIIWDDSGETDSLIVPYQE-------GSENCCSKKEWSQATAVIKPNEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  +    + KL+ SS   T   +     G   WP+LSLSN  K DQ S
Sbjct  54   KPGDEVDLCERKLDGSSNFNTKGGIDTSGVGIGSWPELSLSNAAKTDQNS  103



>ref|XP_007133787.1| hypothetical protein PHAVU_011G2091001g, partial [Phaseolus vulgaris]
 gb|ESW05781.1| hypothetical protein PHAVU_011G2091001g, partial [Phaseolus vulgaris]
Length=645

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 8/102 (8%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            L NI+WGE GESDDHIVPY +       AS     +++W+ EAS  KL +QK+   K+ F
Sbjct  1    LANIVWGEAGESDDHIVPYQE-------ASEDLHDEKKWNQEASPSKLIEQKRTETKTDF  53

Query  435  DI-KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
               KL SSSK  T +   A   G + WPDLSLS+  K DQGS
Sbjct  54   HKEKLGSSSKFDTIQGQSASESGTNSWPDLSLSSAAKTDQGS  95



>gb|KHG09240.1| hypothetical protein F383_16006 [Gossypium arboreum]
Length=739

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIW ++GE+D  +VPY +        S     K+EW    + +K  +QK
Sbjct  1    MFDWNDEELKNIIWDDSGETDSFVVPYQE-------GSENCCSKKEWSQATTVIKPDEQK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            KP  +    + KL+ SS   T   +     G   WP+LSLSN  K DQ S
Sbjct  54   KPGDEVDLCERKLDGSSNFNTKGGIDTSGVGIGSWPELSLSNAAKTDQNS  103



>dbj|BAC41810.1| unknown protein [Arabidopsis thaliana]
Length=271

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+  E+ DHIVP+   S+     + ++ ++E         K  +QK
Sbjct  1    MFDWEEEELTNMIWGDDAETGDHIVPFKVRSE---QLNKKEQIEES--------KTAEQK  49

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D  L SSS H  DE LP   F    WPD SL+N TK+DQ
Sbjct  50   ITGTKIDLHDKNLGSSSSHNVDEGLPQPDFCMSSWPDTSLTNATKVDQ  97



>ref|NP_001190089.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79242.1| uncharacterized protein AT3G54500 [Arabidopsis thaliana]
Length=663

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+  E+ DHIVP+   S         + + ++  +E S  K  +QK
Sbjct  1    MFDWEEEELTNMIWGDDAETGDHIVPFKVRS---------EQLNKKEQIEES--KTAEQK  49

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D  L SSS H  DE LP   F    WPD SL+N TK+DQ
Sbjct  50   ITGTKIDLHDKNLGSSSSHNVDEGLPQPDFCMSSWPDTSLTNATKVDQ  97



>emb|CAB77570.1| putative protein [Arabidopsis thaliana]
Length=649

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+  E+ DHIVP+   S         + + ++  +E S  K  +QK
Sbjct  1    MFDWEEEELTNMIWGDDAETGDHIVPFKVRS---------EQLNKKEQIEES--KTAEQK  49

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D  L SSS H  DE LP   F    WPD SL+N TK+DQ
Sbjct  50   ITGTKIDLHDKNLGSSSSHNVDEGLPQPDFCMSSWPDTSLTNATKVDQ  97



>ref|NP_191014.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79239.1| uncharacterized protein AT3G54500 [Arabidopsis thaliana]
Length=648

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+  E+ DHIVP+   S         + + ++  +E S  K  +QK
Sbjct  1    MFDWEEEELTNMIWGDDAETGDHIVPFKVRS---------EQLNKKEQIEES--KTAEQK  49

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
                K    D  L SSS H  DE LP   F    WPD SL+N TK+DQ
Sbjct  50   ITGTKIDLHDKNLGSSSSHNVDEGLPQPDFCMSSWPDTSLTNATKVDQ  97



>ref|XP_006494919.1| PREDICTED: uncharacterized protein LOC102616093 isoform X1 [Citrus 
sinensis]
 ref|XP_006494920.1| PREDICTED: uncharacterized protein LOC102616093 isoform X2 [Citrus 
sinensis]
 ref|XP_006494921.1| PREDICTED: uncharacterized protein LOC102616093 isoform X3 [Citrus 
sinensis]
Length=694

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 11/107 (10%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEELTNIIWGE G+SDDHIVPY +E++           K+EW  EA+ +K  ++K
Sbjct  1    MFDWNDEELTNIIWGENGKSDDHIVPYQEENEDY-------GNKKEWSQEATAIKPAERK  53

Query  411  KPAPKSGFD-IKLESSSKHATDEALPALAFGKDL---WPDLSLSNTT  539
             P  K  F+  KLE SS   + E       G ++     +++ SN+T
Sbjct  54   MPEVKIDFNGGKLECSSNFNSCERNSVSGIGTNVSNRIAEIAKSNST  100



>ref|XP_006403566.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 gb|ESQ45019.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
Length=620

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 9/111 (8%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW++EELTN+IWG+ GE+DDHIVP+   S+           K+E   ++  VK  +Q+
Sbjct  1    MFDWDEEELTNMIWGDDGETDDHIVPFKLRSE--------QLNKKERSEDSKTVKPAEQE  52

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                K+   + KL SSS H  DE +P   F    WPD SLSN  + D  SS
Sbjct  53   ITGTKNDLHESKLGSSSGHNVDEKIPQPDFCISSWPDSSLSNAREADPDSS  103



>ref|XP_006403565.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 ref|XP_006403567.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 ref|XP_006403568.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 gb|ESQ45018.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 gb|ESQ45020.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 gb|ESQ45021.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
Length=621

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (57%), Gaps = 9/111 (8%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW++EELTN+IWG+ GE+DDHIVP+   S+           K+E   ++  VK  +Q+
Sbjct  1    MFDWDEEELTNMIWGDDGETDDHIVPFKLRSE--------QLNKKERSEDSKTVKPAEQE  52

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                K+   + KL SSS H  DE +P   F    WPD SLSN  + D  SS
Sbjct  53   ITGTKNDLHESKLGSSSGHNVDEKIPQPDFCISSWPDSSLSNAREADPDSS  103



>ref|XP_008446935.1| PREDICTED: uncharacterized protein LOC103489500 isoform X1 [Cucumis 
melo]
Length=699

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (57%), Gaps = 11/109 (10%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE  +SDDHIVPY +  +     ++ D  K+EW+ +    KL +QK
Sbjct  1    MFDWNDEELANIIWGEAADSDDHIVPYREAGE-----NYYD--KKEWNQDTLYTKLMEQK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P    G   KLE+S     +E   A     D   D+SLS  +++DQ S
Sbjct  54   SPGDNHGR--KLETSP--GNEEGTSASNLSNDPVADISLSKPSRIDQDS  98



>ref|XP_010554475.1| PREDICTED: uncharacterized protein LOC104824187 isoform X2 [Tarenaya 
hassleriana]
Length=671

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWG+ GE+DDHIVP+ + S  +         ++EW  ++ + K  +QK
Sbjct  1    MFDWNDEELNNIIWGDDGETDDHIVPFKERSGLQ-------LNRKEWSEKSKSHKPAEQK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
              A K     K  +SS + ++E + +  FG D WP+ S+S  T+++Q SS
Sbjct  54   TLAAKIDLHGKKVASSYNDSEE-ISSSDFGLDSWPETSVSLDTRVNQDSS  102



>ref|XP_011042160.1| PREDICTED: uncharacterized protein LOC105137914 isoform X2 [Populus 
euphratica]
Length=679

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK P  K  
Sbjct  2    QLTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQKAPGAKVD  54

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  55   TDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  97



>ref|XP_011042158.1| PREDICTED: uncharacterized protein LOC105137914 isoform X1 [Populus 
euphratica]
 ref|XP_011042159.1| PREDICTED: uncharacterized protein LOC105137914 isoform X1 [Populus 
euphratica]
Length=681

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK P  K  
Sbjct  2    QLTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQKAPGAKVD  54

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  55   TDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  97



>ref|XP_011042161.1| PREDICTED: uncharacterized protein LOC105137914 isoform X3 [Populus 
euphratica]
Length=677

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK P  K  
Sbjct  2    QLTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQKAPGAKVD  54

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  55   TDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  97



>ref|XP_011042163.1| PREDICTED: uncharacterized protein LOC105137914 isoform X5 [Populus 
euphratica]
Length=675

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +SDDHIVPYP+       AS     K+E   EAS +K  +QK P  K  
Sbjct  2    QLTNIIWGEAEDSDDHIVPYPE-------ASEDYCKKKESSEEASTIKSSEQKAPGAKVD  54

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S   T E   +L    D WP+LS  N  K +Q S
Sbjct  55   TDGRKLESISNVDTSEGTSSLGLDMDRWPNLSSPNAAKTEQDS  97



>ref|XP_004157548.1| PREDICTED: uncharacterized LOC101219885 [Cucumis sativus]
Length=262

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 59/112 (53%), Gaps = 16/112 (14%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE  ++DDHIVPY +       A      K+EW+ +    KL +QK
Sbjct  1    MFDWNDEELANIIWGEAADTDDHIVPYRE-------AGENYYDKKEWNQDTLYTKLMEQK  53

Query  411  KPAPKSGFD---IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P    G D    KLESS     +    A     D   D+SLS  +++DQ S
Sbjct  54   SP----GIDNHGRKLESSP--GNEGGTSASNLSNDPVADISLSKPSRIDQDS  99



>gb|KCW51729.1| hypothetical protein EUGRSUZ_J01191 [Eucalyptus grandis]
Length=527

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K
Sbjct  1    MFDWNDEELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
                K    D K  SS+           AF  D WP++S SN    D
Sbjct  54   ILGLKIDLNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  100



>ref|XP_010032314.1| PREDICTED: uncharacterized protein LOC104421875 isoform X3 [Eucalyptus 
grandis]
 gb|KCW51728.1| hypothetical protein EUGRSUZ_J01191 [Eucalyptus grandis]
Length=694

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K
Sbjct  1    MFDWNDEELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
                K    D K  SS+           AF  D WP++S SN    D
Sbjct  54   ILGLKIDLNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  100



>ref|XP_010032315.1| PREDICTED: uncharacterized protein LOC104421875 isoform X4 [Eucalyptus 
grandis]
 gb|KCW51725.1| hypothetical protein EUGRSUZ_J01191 [Eucalyptus grandis]
 gb|KCW51726.1| hypothetical protein EUGRSUZ_J01191 [Eucalyptus grandis]
 gb|KCW51727.1| hypothetical protein EUGRSUZ_J01191 [Eucalyptus grandis]
Length=693

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K
Sbjct  1    MFDWNDEELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEK  53

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
                K    D K  SS+           AF  D WP++S SN    D
Sbjct  54   ILGLKIDLNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  100



>gb|KGN52307.1| hypothetical protein Csa_5G623710 [Cucumis sativus]
Length=669

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 10/109 (9%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE  ++DDHIVPY +  +     ++ D  K+EW+ +    KL +QK
Sbjct  1    MFDWNDEELANIIWGEAADTDDHIVPYREAGE-----NYYD--KKEWNQDTLYTKLMEQK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P        KLESS     +    A     D   D+SLS  +++DQ S
Sbjct  54   SPG-TDNHGRKLESSP--GNEGGTSASNLSNDPVADISLSKPSRIDQDS  99



>ref|XP_004142397.1| PREDICTED: uncharacterized protein LOC101219885 [Cucumis sativus]
Length=699

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 10/109 (9%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDWNDEEL NIIWGE  ++DDHIVPY +  +     ++ D  K+EW+ +    KL +QK
Sbjct  1    MFDWNDEELANIIWGEAADTDDHIVPYREAGE-----NYYD--KKEWNQDTLYTKLMEQK  53

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             P        KLESS     +    A     D   D+SLS  +++DQ S
Sbjct  54   SPG-TDNHGRKLESSP--GNEGGTSASNLSNDPVADISLSKPSRIDQDS  99



>gb|KDO41931.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
Length=618

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            LTNIIWGE G+SDDHIVPY +E++           K+EW  EA+ +K  ++K P  K  F
Sbjct  1    LTNIIWGENGKSDDHIVPYQEENEDY-------GNKKEWSQEATAIKPAERKMPEVKIDF  53

Query  435  D-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
            +  KLE SS   + E       G   W DLS SN  K D+
Sbjct  54   NGGKLECSSNFNSCERNSVSGIGMGSWSDLSSSNAAKTDE  93



>ref|XP_010504256.1| PREDICTED: uncharacterized protein LOC104781316 isoform X2 [Camelina 
sativa]
 ref|XP_010504257.1| PREDICTED: uncharacterized protein LOC104781316 isoform X2 [Camelina 
sativa]
Length=651

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+ GE+ DHIVP+  +S+           K+E   E+   K  +QK
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKSE--------QLNKKEQSEESKTAKPAEQK  52

Query  411  KPAPKSGF--DIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
                      D KL SSS H  D  +P  +F    WP D SLSN  K D  SS
Sbjct  53   ITGTTVDLHDDDKLGSSSGHNVDAGIPQPSFCMTSWPVDSSLSNARKDDPDSS  105



>ref|XP_010504255.1| PREDICTED: uncharacterized protein LOC104781316 isoform X1 [Camelina 
sativa]
Length=652

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+ GE+ DHIVP+  +S+           K+E   E+   K  +QK
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKSE--------QLNKKEQSEESKTAKPAEQK  52

Query  411  KPAPKSGF--DIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
                      D KL SSS H  D  +P  +F    WP D SLSN  K D  SS
Sbjct  53   ITGTTVDLHDDDKLGSSSGHNVDAGIPQPSFCMTSWPVDSSLSNARKDDPDSS  105



>gb|KDO41929.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
Length=710

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            LTNIIWGE G+SDDHIVPY +E++           K+EW  EA+ +K  ++K P  K  F
Sbjct  1    LTNIIWGENGKSDDHIVPYQEENEDY-------GNKKEWSQEATAIKPAERKMPEVKIDF  53

Query  435  D-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
            +  KLE SS   + E       G   W DLS SN  K D+
Sbjct  54   NGGKLECSSNFNSCERNSVSGIGMGSWSDLSSSNAAKTDE  93



>gb|KDO41924.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
 gb|KDO41925.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
 gb|KDO41926.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
 gb|KDO41927.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
 gb|KDO41928.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
Length=707

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            LTNIIWGE G+SDDHIVPY +E++           K+EW  EA+ +K  ++K P  K  F
Sbjct  1    LTNIIWGENGKSDDHIVPYQEENEDY-------GNKKEWSQEATAIKPAERKMPEVKIDF  53

Query  435  D-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
            +  KLE SS   + E       G   W DLS SN  K D+
Sbjct  54   NGGKLECSSNFNSCERNSVSGIGMGSWSDLSSSNAAKTDE  93



>gb|KDO41923.1| hypothetical protein CISIN_1g0050322mg, partial [Citrus sinensis]
Length=678

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            LTNIIWGE G+SDDHIVPY +E++           K+EW  EA+ +K  ++K P  K  F
Sbjct  1    LTNIIWGENGKSDDHIVPYQEENEDY-------GNKKEWSQEATAIKPAERKMPEVKIDF  53

Query  435  D-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
            +  KLE SS   + E       G   W DLS SN  K D+
Sbjct  54   NGGKLECSSNFNSCERNSVSGIGMGSWSDLSSSNAAKTDE  93



>ref|XP_010515977.1| PREDICTED: uncharacterized protein LOC104791720 isoform X1 [Camelina 
sativa]
Length=652

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 21/118 (18%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKE-------EWDLEASN  389
            MFDW +EELTN+IWG+ GE+ DHIVP+  +S+     + +D+ +E       E  +  + 
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKSEQ---LNKKDTSEESKTAKSAEQKISVTT  57

Query  390  VKLGDQKKPAPKSGFDIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
            V L D          D KL SSS H  D+ +P   F    WP D SLSN  K D  SS
Sbjct  58   VDLAD----------DDKLGSSSGHNVDDGIPQPGFCMPSWPVDSSLSNARKDDPDSS  105



>ref|XP_010515978.1| PREDICTED: uncharacterized protein LOC104791720 isoform X2 [Camelina 
sativa]
Length=651

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 21/118 (18%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKE-------EWDLEASN  389
            MFDW +EELTN+IWG+ GE+ DHIVP+  +S+     + +D+ +E       E  +  + 
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKSEQ---LNKKDTSEESKTAKSAEQKISVTT  57

Query  390  VKLGDQKKPAPKSGFDIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
            V L D          D KL SSS H  D+ +P   F    WP D SLSN  K D  SS
Sbjct  58   VDLAD----------DDKLGSSSGHNVDDGIPQPGFCMPSWPVDSSLSNARKDDPDSS  105



>ref|XP_010427152.1| PREDICTED: uncharacterized protein LOC104712050 isoform X2 [Camelina 
sativa]
Length=640

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 59/120 (49%), Gaps = 28/120 (23%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY---------PDESDGKPPASHRDSVKEEWDLEA  383
            MFDW +EELTN+IWG+ GE+ DHIVP+          D+S+   PA  +        +  
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKGEQLNKKDQSEESKPADQK--------ITG  52

Query  384  SNVKLGDQKKPAPKSGFDIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
            + V L D          D KL SSS H  D+ +P   F    WP D SLSN  K D  SS
Sbjct  53   TTVDLHD----------DDKLGSSSSHNVDDGIPQPGFCMTSWPVDSSLSNARKDDPDSS  102



>ref|XP_010427151.1| PREDICTED: uncharacterized protein LOC104712050 isoform X1 [Camelina 
sativa]
Length=641

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 59/120 (49%), Gaps = 28/120 (23%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY---------PDESDGKPPASHRDSVKEEWDLEA  383
            MFDW +EELTN+IWG+ GE+ DHIVP+          D+S+   PA  +        +  
Sbjct  1    MFDWEEEELTNMIWGDNGETGDHIVPFKVKGEQLNKKDQSEESKPADQK--------ITG  52

Query  384  SNVKLGDQKKPAPKSGFDIKLESSSKHATDEALPALAFGKDLWP-DLSLSNTTKMDQGSS  560
            + V L D          D KL SSS H  D+ +P   F    WP D SLSN  K D  SS
Sbjct  53   TTVDLHD----------DDKLGSSSSHNVDDGIPQPGFCMTSWPVDSSLSNARKDDPDSS  102



>ref|XP_011016295.1| PREDICTED: uncharacterized protein LOC105119807 isoform X1 [Populus 
euphratica]
Length=171

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 54/103 (52%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +S+DHIVPYP+       AS     K+E   +AS +K  +QK P  K  
Sbjct  14   QLTNIIWGEAEDSNDHIVPYPE-------ASEDYCKKKESSEDASTIKSSEQKAPGAKVD  66

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S     E   +L    D W +LS  N  K +Q S
Sbjct  67   TDGRKLESISNVDASEGTSSLGLDMDRWHNLSSPNAAKTEQDS  109



>ref|XP_011016298.1| PREDICTED: uncharacterized protein LOC105119807 isoform X3 [Populus 
euphratica]
Length=169

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 54/103 (52%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +S+DHIVPYP+       AS     K+E   +AS +K  +QK P  K  
Sbjct  14   QLTNIIWGEAEDSNDHIVPYPE-------ASEDYCKKKESSEDASTIKSSEQKAPGAKVD  66

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S     E   +L    D W +LS  N  K +Q S
Sbjct  67   TDGRKLESISNVDASEGTSSLGLDMDRWHNLSSPNAAKTEQDS  109



>ref|XP_011016297.1| PREDICTED: uncharacterized protein LOC105119807 isoform X2 [Populus 
euphratica]
Length=171

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 54/103 (52%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            +LTNIIWGE  +S+DHIVPYP+       AS     K+E   +AS +K  +QK P  K  
Sbjct  14   QLTNIIWGEAEDSNDHIVPYPE-------ASEDYCKKKESSEDASTIKSSEQKAPGAKVD  66

Query  432  FD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
             D  KLES S     E   +L    D W +LS  N  K +Q S
Sbjct  67   TDGRKLESISNVDASEGTSSLGLDMDRWHNLSSPNAAKTEQDS  109



>ref|XP_006290711.1| hypothetical protein CARUB_v10016808mg [Capsella rubella]
 gb|EOA23609.1| hypothetical protein CARUB_v10016808mg [Capsella rubella]
Length=653

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW ++ELTN+IW + GE+ DHIVP+   S+       + + KE+ D E+   K  +QK
Sbjct  1    MFDWEEDELTNMIWADDGETGDHIVPFKVRSE-------QLNKKEQSD-ESKTAKPAEQK  52

Query  411  KPAPKSGF--DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                 +    D  L S+S H  D+ +P   F    WPD SLSN  K D  SS
Sbjct  53   ITGTTAEIQDDDILGSTSGHNVDDGIPQPDFCMTSWPDSSLSNARKDDTDSS  104



>ref|XP_010931991.1| PREDICTED: uncharacterized protein LOC105052752 isoform X1 [Elaeis 
guineensis]
 ref|XP_010931992.1| PREDICTED: uncharacterized protein LOC105052752 isoform X1 [Elaeis 
guineensis]
Length=658

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ +IIWGE  ES+DHIVPYP  ++     +  D  K++ + EAS V    +
Sbjct  1    MFDWNDQDQVGDIIWGELSESEDHIVPYPKGTEDSTLLNFGDYNKKQKNEEASTVLRSTE  60

Query  408  KKPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDL  521
                 K  F    LE+ S   T+E L A     D WPDL
Sbjct  61   HTAGTKHDFAGCNLENHSTFKTNEELSAPRLDMDSWPDL  99



>ref|XP_010931993.1| PREDICTED: uncharacterized protein LOC105052752 isoform X2 [Elaeis 
guineensis]
Length=652

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ +IIWGE  ES+DHIVPYP  ++     +  D  K++ + EAS V    +
Sbjct  1    MFDWNDQDQVGDIIWGELSESEDHIVPYPKGTEDSTLLNFGDYNKKQKNEEASTVLRSTE  60

Query  408  KKPAPKSGF-DIKLESSSKHATDEALPALAFGKDLWPDL  521
                 K  F    LE+ S   T+E L A     D WPDL
Sbjct  61   HTAGTKHDFAGCNLENHSTFKTNEELSAPRLDMDSWPDL  99



>ref|XP_010922163.1| PREDICTED: uncharacterized protein LOC105045541 isoform X5 [Elaeis 
guineensis]
Length=628

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_010922164.1| PREDICTED: uncharacterized protein LOC105045541 isoform X6 [Elaeis 
guineensis]
Length=622

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_010922157.1| PREDICTED: uncharacterized protein LOC105045541 isoform X1 [Elaeis 
guineensis]
 ref|XP_010922159.1| PREDICTED: uncharacterized protein LOC105045541 isoform X1 [Elaeis 
guineensis]
Length=660

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_010922162.1| PREDICTED: uncharacterized protein LOC105045541 isoform X4 [Elaeis 
guineensis]
Length=631

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_010922160.1| PREDICTED: uncharacterized protein LOC105045541 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_010922161.1| PREDICTED: uncharacterized protein LOC105045541 isoform X3 [Elaeis 
guineensis]
Length=634

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWNDE-ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND+ ++ + IWGE  ES+DHIVPYP  ++     +  D  K++   EAS V    +
Sbjct  1    MFDWNDQDQVGDTIWGELSESEDHIVPYPKGTEQSTFLNFGDYYKKQKSEEASTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
            +    K+      LE+ S   T+E +  L    D WPDL
Sbjct  61   QTAGAKNDLSRCNLENDSTFKTNEEISTLRLDMDSWPDL  99



>ref|XP_002877982.1| hypothetical protein ARALYDRAFT_485852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54241.1| hypothetical protein ARALYDRAFT_485852 [Arabidopsis lyrata subsp. 
lyrata]
Length=642

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 54/113 (48%), Gaps = 20/113 (18%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW +EELTN+IWG+ GE+ DHIVP+            +   K+E   E    K  +QK
Sbjct  1    MFDWEEEELTNMIWGDDGETGDHIVPF------------KQLNKKEQSEETKTAKPAEQK  48

Query  411  KPAPKSGF-DIKLESSSKHATDEALPALAFGKDLW-------PDLSLSNTTKM  545
                K+   D KL S+S H  D+  P   F    W       PDLS +  +K 
Sbjct  49   ITGTKTDLHDDKLGSTSGHNVDDGTPQPDFCMSSWSDSTKDDPDLSATQLSKC  101



>gb|KCW65935.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
Length=570

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY-PDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWNDEELT+IIWGE GE+ +HIVPY   + D +P     + ++ E   + + +K  +Q
Sbjct  1    MFDWNDEELTSIIWGEAGENGEHIVPYQAGKEDDRP-----NKIQNE---DITTLKPSEQ  52

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K    K     +KLE  ++   +  +       D WP+LS S   K +QGS
Sbjct  53   KLLGAKLDLHGMKLECFNRSNKNGGIAVSRL--DSWPNLSSSEAAKDEQGS  101



>emb|CDY07537.1| BnaC06g15270D [Brassica napus]
Length=547

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 53/108 (49%), Gaps = 21/108 (19%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW+DEELTN+IWG+ GE+ DHIVP+   +            KE+ D     VK  +QK
Sbjct  1    MFDWDDEELTNMIWGDDGETGDHIVPFKVRNR-----------KEQGDESNKAVKPAEQK  49

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQG  554
                    D KL  SS     E + +       WPD S+SN  K D G
Sbjct  50   T---THLHDSKLGGSSSGQNIECMSS-------WPDSSVSNARKADPG  87



>gb|KCW65936.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
Length=499

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 12/111 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY-PDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWNDEELT+IIWGE GE+ +HIVPY   + D +P     + +        + +K  +Q
Sbjct  1    MFDWNDEELTSIIWGEAGENGEHIVPYQAGKEDDRPNKIQNEDI--------TTLKPSEQ  52

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K    K     +KLE  ++   +  +       D WP+LS S   K +QGS
Sbjct  53   KLLGAKLDLHGMKLECFNRSNKNGGIAVSRL--DSWPNLSSSEAAKDEQGS  101



>gb|KCW65934.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
Length=664

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY-PDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWNDEELT+IIWGE GE+ +HIVPY   + D +P     + ++ E   + + +K  +Q
Sbjct  1    MFDWNDEELTSIIWGEAGENGEHIVPYQAGKEDDRP-----NKIQNE---DITTLKPSEQ  52

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K    K     +KLE  ++   +  +       D WP+LS S   K +QGS
Sbjct  53   KLLGAKLDLHGMKLECFNRSNKNGGIAVSRL--DSWPNLSSSEAAKDEQGS  101



>gb|KCW65931.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
Length=663

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY-PDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWNDEELT+IIWGE GE+ +HIVPY   + D +P     + ++ E   + + +K  +Q
Sbjct  1    MFDWNDEELTSIIWGEAGENGEHIVPYQAGKEDDRP-----NKIQNE---DITTLKPSEQ  52

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K    K     +KLE  ++   +  +       D WP+LS S   K +QGS
Sbjct  53   KLLGAKLDLHGMKLECFNRSNKNGGIAVSRL--DSWPNLSSSEAAKDEQGS  101



>ref|XP_010067747.1| PREDICTED: uncharacterized protein LOC104454552 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010067748.1| PREDICTED: uncharacterized protein LOC104454552 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65932.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
 gb|KCW65933.1| hypothetical protein EUGRSUZ_G03246 [Eucalyptus grandis]
Length=664

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPY-PDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWNDEELT+IIWGE GE+ +HIVPY   + D +P     + ++ E   + + +K  +Q
Sbjct  1    MFDWNDEELTSIIWGEAGENGEHIVPYQAGKEDDRP-----NKIQNE---DITTLKPSEQ  52

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
            K    K     +KLE  ++   +  +       D WP+LS S   K +QGS
Sbjct  53   KLLGAKLDLHGMKLECFNRSNKNGGIAVSRL--DSWPNLSSSEAAKDEQGS  101



>ref|XP_006403569.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
 gb|ESQ45022.1| hypothetical protein EUTSA_v10010203mg [Eutrema salsugineum]
Length=625

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 55/103 (53%), Gaps = 9/103 (9%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            LTN+IWG+ GE+DDHIVP+   S+           K+E   ++  VK  +Q+    K+  
Sbjct  13   LTNMIWGDDGETDDHIVPFKLRSE--------QLNKKERSEDSKTVKPAEQEITGTKNDL  64

Query  435  -DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
             + KL SSS H  DE +P   F    WPD SLSN  + D  SS
Sbjct  65   HESKLGSSSGHNVDEKIPQPDFCISSWPDSSLSNAREADPDSS  107



>ref|XP_010273217.1| PREDICTED: uncharacterized protein LOC104608821 [Nelumbo nucifera]
Length=740

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MF+WN+EEL +IIWG+  E  + IVPYP ES+ K   +  D  K++ + + S +K  +Q 
Sbjct  1    MFEWNEEELADIIWGDASEDGNQIVPYPKESEEKSVVTFGDDNKQQNE-DYSTIKPAEQN  59

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDLWPDLSLS  530
                K+      + SS       L A     D WPDL LS
Sbjct  60   ISENKNVVPDSKQGSSSDFEKSGLSAPGLDIDSWPDLPLS  99



>emb|CDX67602.1| BnaA07g16420D [Brassica napus]
Length=548

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (48%), Gaps = 32/109 (29%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW+DEELTN+IWG+ GE+ DHIVP+                           K+ ++K
Sbjct  1    MFDWDDEELTNMIWGDEGETGDHIVPF---------------------------KVRNRK  33

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDL-----WPDLSLSNTTK  542
            +   +S   +K   S  H  D  L   + G+++     WPD S+SN  +
Sbjct  34   EQGDESNKAVKPAESKTHLHDSKLGGSSSGQNIECMSSWPDSSVSNNAR  82



>ref|XP_009103923.1| PREDICTED: uncharacterized protein LOC103829982 isoform X2 [Brassica 
rapa]
Length=580

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (48%), Gaps = 32/109 (29%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW+DEELTN+IWG+ GE+ DHIVP+                           K+ ++K
Sbjct  1    MFDWDDEELTNMIWGDEGETGDHIVPF---------------------------KVRNRK  33

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDL-----WPDLSLSNTTK  542
            +   +S   +K   S  H  D  L   + G+++     WPD S+SN  +
Sbjct  34   EQGDESNKAVKPAESKTHLHDSKLGGSSSGQNIECMSSWPDSSVSNNAR  82



>ref|XP_009103922.1| PREDICTED: uncharacterized protein LOC103829982 isoform X1 [Brassica 
rapa]
Length=613

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (48%), Gaps = 32/109 (29%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQK  410
            MFDW+DEELTN+IWG+ GE+ DHIVP+                           K+ ++K
Sbjct  1    MFDWDDEELTNMIWGDEGETGDHIVPF---------------------------KVRNRK  33

Query  411  KPAPKSGFDIKLESSSKHATDEALPALAFGKDL-----WPDLSLSNTTK  542
            +   +S   +K   S  H  D  L   + G+++     WPD S+SN  +
Sbjct  34   EQGDESNKAVKPAESKTHLHDSKLGGSSSGQNIECMSSWPDSSVSNNAR  82



>ref|XP_010670452.1| PREDICTED: uncharacterized protein LOC104887504 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670453.1| PREDICTED: uncharacterized protein LOC104887504 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=685

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGK  332
            MFDW+D+E+ NI+WGE  E+DDHIVPYP++ D K
Sbjct  1    MFDWDDQEIANILWGENREADDHIVPYPEDIDKK  34



>ref|XP_010670455.1| PREDICTED: uncharacterized protein LOC104887504 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=661

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  231  MFDWNDEELTNIIWGETGESDDHIVPYPDESDGK  332
            MFDW+D+E+ NI+WGE  E+DDHIVPYP++ D K
Sbjct  1    MFDWDDQEIANILWGENREADDHIVPYPEDIDKK  34



>ref|XP_008786901.1| PREDICTED: uncharacterized protein LOC103705079 [Phoenix dactylifera]
 ref|XP_008786902.1| PREDICTED: uncharacterized protein LOC103705079 [Phoenix dactylifera]
Length=647

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  MFDWND-EELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQ  407
            MFDWND +++ + IWGE  E++DHIVPY   ++     +  D  K++   EA+ V    +
Sbjct  1    MFDWNDPDQVGHTIWGELSENEDHIVPYTKGTEDNTLLNFGDYNKKQKSEEANTVLRSTE  60

Query  408  KKPAPKSGFD-IKLESSSKHATDEALPALAFGKDLWPDL  521
                 K+ F    LE+ S   T+E L A     D WPDL
Sbjct  61   HTAGVKNDFTGCNLENHSTFETNEELSAPRLDMDSWPDL  99



>gb|ADN34208.1| hypothetical protein [Cucumis melo subsp. melo]
Length=673

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            L NIIWGE  +SDDHIVPY +  +     ++ D  K+EW+ +    KL +QK P    G 
Sbjct  2    LANIIWGEAADSDDHIVPYREAGE-----NYYD--KKEWNQDTLYTKLMEQKSPGDNHGR  54

Query  435  DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
              KLE+S     +E   A     D   D+SLS  +++DQ S
Sbjct  55   --KLETSP--GNEEGTSASNLSNDPVADISLSKPSRIDQDS  91



>ref|XP_008446936.1| PREDICTED: uncharacterized protein LOC103489500 isoform X2 [Cucumis 
melo]
Length=698

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  255  LTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF  434
            L NIIWGE  +SDDHIVPY +  +     ++ D  K+EW+ +    KL +QK P    G 
Sbjct  8    LANIIWGEAADSDDHIVPYREAGE-----NYYD--KKEWNQDTLYTKLMEQKSPGDNHGR  60

Query  435  DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGS  557
              KLE+S     +E   A     D   D+SLS  +++DQ S
Sbjct  61   --KLETSP--GNEEGTSASNLSNDPVADISLSKPSRIDQDS  97



>ref|NP_001190088.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79241.1| uncharacterized protein AT3G54500 [Arabidopsis thaliana]
Length=669

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (51%), Gaps = 12/97 (12%)
 Frame = +3

Query  264  IIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSGF-DI  440
            +IWG+  E+ DHIVP+   S+          + ++  +E S  K  +QK    K    D 
Sbjct  1    MIWGDDAETGDHIVPFKVRSE---------QLNKKEQIEES--KTAEQKITGTKIDLHDK  49

Query  441  KLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQ  551
             L SSS H  DE LP   F    WPD SL+N TK+DQ
Sbjct  50   NLGSSSSHNVDEGLPQPDFCMSSWPDTSLTNATKVDQ  86



>ref|XP_010554474.1| PREDICTED: uncharacterized protein LOC104824187 isoform X1 [Tarenaya 
hassleriana]
Length=677

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = +3

Query  249  EELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKS  428
            ++L NIIWG+ GE+DDHIVP+ + S  +         ++EW  ++ + K  +QK  A K 
Sbjct  13   DKLNNIIWGDDGETDDHIVPFKERSGLQ-------LNRKEWSEKSKSHKPAEQKTLAAKI  65

Query  429  GFDIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMDQGSS  560
                K  +SS + ++E + +  FG D WP+ S+S  T+++Q SS
Sbjct  66   DLHGKKVASSYNDSEE-ISSSDFGLDSWPETSVSLDTRVNQDSS  108



>ref|XP_010032312.1| PREDICTED: uncharacterized protein LOC104421875 isoform X1 [Eucalyptus 
grandis]
Length=714

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            EL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K    K  
Sbjct  28   ELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEKILGLKID  80

Query  432  F-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
              D K  SS+           AF  D WP++S SN    D
Sbjct  81   LNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  120



>ref|XP_010032316.1| PREDICTED: uncharacterized protein LOC104421875 isoform X5 [Eucalyptus 
grandis]
Length=685

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            EL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K    K  
Sbjct  28   ELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEKILGLKID  80

Query  432  F-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
              D K  SS+           AF  D WP++S SN    D
Sbjct  81   LNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  120



>ref|XP_010032313.1| PREDICTED: uncharacterized protein LOC104421875 isoform X2 [Eucalyptus 
grandis]
Length=713

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +3

Query  252  ELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLEASNVKLGDQKKPAPKSG  431
            EL +IIWGE+ E+DDHIVP+P+ ++      H+   K+EW+ E + +K  D+K    K  
Sbjct  28   ELASIIWGESKETDDHIVPHPEGNE-----DHQK--KKEWNEENAPIKPTDEKILGLKID  80

Query  432  F-DIKLESSSKHATDEALPALAFGKDLWPDLSLSNTTKMD  548
              D K  SS+           AF  D WP++S SN    D
Sbjct  81   LNDSKTGSSANINKKRCSDVSAFDLDSWPNISPSNAVTND  120



>gb|EPS67716.1| hypothetical protein M569_07059 [Genlisea aurea]
Length=596

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 40/78 (51%), Gaps = 7/78 (9%)
 Frame = +3

Query  201  GIFFLFSFSAMFDWNDEELTNIIWGETGESDDHIVPYPDESDGKPPASHRDSVKEEWDLE  380
            G  FL+SF         +LT+IIWG  G+SDD +V YP + +G       D  K + + +
Sbjct  49   GAVFLYSFMC-------QLTSIIWGVAGQSDDGVVQYPCQIEGGDTVLFEDQFKYQSNRQ  101

Query  381  ASNVKLGDQKKPAPKSGF  434
             S++    QKK   KS F
Sbjct  102  ISDISSAQQKKSMYKSAF  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880