BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS114D12

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADT91700.1|  dicer-like protein 2                                    246   1e-78   Nicotiana attenuata
gb|AFD22619.1|  dicer-like 2 protein                                    247   8e-72   Nicotiana attenuata
ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    245   4e-71   Nicotiana sylvestris
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    244   6e-71   
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    235   9e-68   
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    228   3e-65   
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    228   4e-65   Solanum lycopersicum
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    228   4e-65   Solanum lycopersicum
gb|KDP26899.1|  hypothetical protein JCGZ_18057                         217   6e-65   Jatropha curcas
gb|KDO45678.1|  hypothetical protein CISIN_1g0030622mg                  211   9e-64   Citrus sinensis [apfelsine]
ref|XP_007029214.1|  Dicer-like protein isoform 7                       221   1e-63   
ref|XP_007029212.1|  Dicer-like protein isoform 5                       222   2e-63   
ref|XP_007029213.1|  Dicer-like protein isoform 6                       221   3e-63   
ref|XP_007029210.1|  Dicer-like protein isoform 3                       222   4e-63   
ref|XP_007029209.1|  Dicer-like protein isoform 2                       221   6e-63   
ref|XP_007029208.1|  Dicer-like protein isoform 1                       222   6e-63   
gb|KJB14793.1|  hypothetical protein B456_002G143000                    221   1e-62   Gossypium raimondii
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g             220   2e-62   
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2        219   5e-62   Fragaria vesca subsp. vesca
emb|CBI17597.3|  unnamed protein product                                218   7e-62   Vitis vinifera
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    218   9e-62   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    218   9e-62   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    218   1e-61   Vitis vinifera
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    218   1e-61   Vitis vinifera
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    218   2e-61   Populus euphratica
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    218   2e-61   Populus euphratica
emb|CAN77284.1|  hypothetical protein VITISV_043738                     217   2e-61   Vitis vinifera
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g             218   2e-61   
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    217   2e-61   Populus euphratica
gb|KHG30500.1|  hypothetical protein F383_12835                         216   4e-61   Gossypium arboreum [tree cotton]
gb|KHG30499.1|  hypothetical protein F383_12835                         216   5e-61   Gossypium arboreum [tree cotton]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg             216   8e-61   Citrus clementina [clementine]
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    216   9e-61   Citrus sinensis [apfelsine]
gb|KJB61696.1|  hypothetical protein B456_009G374900                    213   3e-60   Gossypium raimondii
gb|KJB61693.1|  hypothetical protein B456_009G374900                    213   6e-60   Gossypium raimondii
gb|KJB61692.1|  hypothetical protein B456_009G374900                    213   6e-60   Gossypium raimondii
ref|XP_002514810.1|  ATP binding protein, putative                      213   8e-60   
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    213   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2        213   1e-59   
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg             212   2e-59   
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        211   2e-59   Prunus mume [ume]
emb|CDP04170.1|  unnamed protein product                                211   3e-59   Coffea canephora [robusta coffee]
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    211   4e-59   Fragaria vesca subsp. vesca
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    209   2e-58   Populus euphratica
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2        207   1e-57   
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    206   2e-57   Citrus sinensis [apfelsine]
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    206   2e-57   
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        205   4e-57   Sesamum indicum [beniseed]
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg             201   7e-57   
gb|KHN23014.1|  Endoribonuclease Dicer like 2                           204   1e-56   Glycine soja [wild soybean]
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    204   1e-56   Glycine max [soybeans]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    204   1e-56   Glycine max [soybeans]
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    204   1e-56   Glycine max [soybeans]
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg               203   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg             203   2e-56   Citrus clementina [clementine]
ref|NP_001131630.1|  uncharacterized protein LOC100192986               193   2e-56   
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    200   3e-56   Prunus mume [ume]
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    199   3e-56   Prunus mume [ume]
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    201   8e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    201   1e-55   Nelumbo nucifera [Indian lotus]
ref|NP_566199.4|  endoribonuclease Dicer-like 2                         199   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2        199   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                      199   4e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDP20270.1|  unnamed protein product                                189   4e-55   Coffea canephora [robusta coffee]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g             199   5e-55   Phaseolus vulgaris [French bean]
gb|AAF26098.1|AC012328_1  unknown protein                               199   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213             198   2e-54   
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg             194   2e-54   
gb|ABF19797.1|  dicer-like 2 spliceform 1                               197   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19798.1|  dicer-like 2 spliceform 2                               197   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42074.1|  endoribonuclease dicer-like protein                     197   3e-54   Medicago truncatula
gb|AFW68290.1|  hypothetical protein ZEAMMB73_539070                    193   3e-54   
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g             197   4e-54   Phaseolus vulgaris [French bean]
gb|AES64802.2|  endoribonuclease dicer-like protein                     196   5e-54   Medicago truncatula
ref|XP_003594551.1|  Endoribonuclease Dicer                             196   5e-54   
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    196   9e-54   Glycine max [soybeans]
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                     195   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2        195   2e-53   Eucalyptus grandis [rose gum]
emb|CDY50692.1|  BnaC05g47910D                                          194   3e-53   Brassica napus [oilseed rape]
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein              194   3e-53   
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    194   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    194   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004173421.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    183   4e-53   
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...    192   9e-53   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...    192   9e-53   Zea mays [maize]
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2        192   1e-52   
emb|CDY43132.1|  BnaA05g32540D                                          192   1e-52   Brassica napus [oilseed rape]
gb|ACE60552.1|  dicer-like protein 2                                    192   1e-52   Brassica rapa
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg             192   1e-52   
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    189   1e-52   
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    189   2e-52   
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg             191   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    187   4e-52   
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    187   5e-52   
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    191   5e-52   Cicer arietinum [garbanzo]
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg             187   7e-52   
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670          190   1e-51   
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500          189   2e-51   
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    188   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    188   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    188   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g             188   3e-51   Phaseolus vulgaris [French bean]
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    184   1e-50   Pyrus x bretschneideri [bai li]
emb|CDO96788.1|  unnamed protein product                                182   3e-50   Coffea canephora [robusta coffee]
emb|CDO96787.1|  unnamed protein product                                176   4e-50   Coffea canephora [robusta coffee]
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    185   5e-50   Setaria italica
emb|CDO96789.1|  unnamed protein product                                182   7e-50   Coffea canephora [robusta coffee]
emb|CAX18337.1|  dicel-like 2                                           171   2e-49   Nicotiana benthamiana
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    182   3e-49   Cucumis sativus [cucumbers]
gb|ABK24820.1|  unknown                                                 172   6e-49   Picea sitchensis
emb|CDP06207.1|  unnamed protein product                                178   9e-49   Coffea canephora [robusta coffee]
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    179   5e-48   
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    176   6e-47   
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    175   9e-47   
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    175   1e-46   
gb|EMS67761.1|  Endoribonuclease Dicer-like protein 2a                  171   1e-46   Triticum urartu
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    173   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    173   5e-46   Cucumis melo [Oriental melon]
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    173   5e-46   Cucumis melo [Oriental melon]
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    173   5e-46   
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    173   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    171   3e-45   Oryza brachyantha
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein              170   4e-45   
gb|KEH20231.1|  endoribonuclease dicer-like protein                     167   6e-44   Medicago truncatula
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...    164   3e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75643.1|  hypothetical protein OsI_12390                          164   6e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001050564.1|  Os03g0583900                                       164   7e-43   
gb|EEE59414.1|  hypothetical protein OsJ_11564                          164   7e-43   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...    163   3e-42   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34005.1|  CAF protein-like                                       163   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g             159   9e-42   Phaseolus vulgaris [French bean]
gb|AGT63299.1|  ribonuclease III                                        146   1e-40   Nicotiana tabacum [American tobacco]
gb|AFW68291.1|  hypothetical protein ZEAMMB73_565304                    153   2e-40   
ref|XP_008644683.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    153   2e-40   
ref|XP_008644682.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    153   3e-40   
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    152   9e-40   Zea mays [maize]
ref|XP_008644678.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    152   2e-39   Zea mays [maize]
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    152   2e-39   Zea mays [maize]
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    152   2e-39   Zea mays [maize]
ref|XP_008644680.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    151   3e-39   Zea mays [maize]
ref|XP_008644677.1|  PREDICTED: uncharacterized protein LOC103626...    151   4e-39   Zea mays [maize]
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    149   5e-38   Glycine max [soybeans]
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    149   6e-38   Glycine max [soybeans]
ref|XP_004982512.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    147   7e-38   
gb|KHN43108.1|  Endoribonuclease Dicer like 2                           149   8e-38   Glycine soja [wild soybean]
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    148   8e-38   Setaria italica
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    148   1e-37   Setaria italica
ref|XP_002464289.1|  hypothetical protein SORBIDRAFT_01g015666          144   4e-37   
gb|AJA90756.1|  Dicer-like 3                                            148   5e-37   Cycas revoluta
gb|ADT80932.1|  dicer-like protein                                      135   6e-37   Nicotiana attenuata
ref|XP_002961233.1|  hypothetical protein SELMODRAFT_74321              147   8e-37   
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    147   1e-36   Cucumis melo [Oriental melon]
ref|XP_002969464.1|  hypothetical protein SELMODRAFT_91347              146   1e-36   
ref|XP_010047157.1|  PREDICTED: dicer-like protein 4 isoform X2         145   4e-36   
gb|ABR17101.1|  unknown                                                 142   4e-36   Picea sitchensis
ref|XP_010047156.1|  PREDICTED: dicer-like protein 4 isoform X1         145   5e-36   Eucalyptus grandis [rose gum]
gb|AFD22621.1|  dicer-like 4 protein                                    144   1e-35   Nicotiana attenuata
ref|XP_008352221.1|  PREDICTED: dicer-like protein 4                    140   1e-35   
ref|XP_008337203.1|  PREDICTED: dicer-like protein 4                    140   1e-35   
ref|XP_010686530.1|  PREDICTED: endoribonuclease Dicer homolog 1        144   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009358497.1|  PREDICTED: dicer-like protein 4                    142   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_006343692.1|  PREDICTED: dicer-like protein 4-like isoform X3    142   4e-35   Solanum tuberosum [potatoes]
ref|XP_009411416.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    142   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343690.1|  PREDICTED: dicer-like protein 4-like isoform X1    142   6e-35   Solanum tuberosum [potatoes]
ref|XP_006343691.1|  PREDICTED: dicer-like protein 4-like isoform X2    142   6e-35   Solanum tuberosum [potatoes]
ref|XP_009411415.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    142   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520559.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    142   6e-35   Tarenaya hassleriana [spider flower]
emb|CDP10524.1|  unnamed protein product                                140   2e-34   Coffea canephora [robusta coffee]
dbj|BAD94606.1|  CAF protein                                            138   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934025.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    140   3e-34   Elaeis guineensis
ref|XP_010934026.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    139   4e-34   
ref|XP_010323152.1|  PREDICTED: dicer-like protein 4 isoform X2         139   5e-34   
ref|XP_010323153.1|  PREDICTED: dicer-like protein 4 isoform X3         139   5e-34   
ref|XP_010323151.1|  PREDICTED: dicer-like protein 4 isoform X1         139   5e-34   Solanum lycopersicum
ref|NP_001266210.1|  dicer-like protein 4                               139   5e-34   
gb|AJA90772.1|  Dicer-like 3                                            139   6e-34   Ginkgo biloba [ginkgo]
ref|XP_006289431.1|  hypothetical protein CARUB_v10002936mg             139   6e-34   
ref|XP_002991516.1|  hypothetical protein SELMODRAFT_448444             139   8e-34   
ref|XP_010932228.1|  PREDICTED: endoribonuclease Dicer homolog 4        138   1e-33   
gb|KEH32166.1|  endoribonuclease dicer-like protein                     138   1e-33   Medicago truncatula
gb|AIO05700.1|  putative endoribonuclease dicer-like protein 1          138   1e-33   Cocos nucifera
ref|XP_009794783.1|  PREDICTED: endoribonuclease Dicer homolog 1        137   2e-33   Nicotiana sylvestris
gb|AFD22618.1|  dicer-like 1 protein                                    137   2e-33   Nicotiana attenuata
gb|KFK42493.1|  hypothetical protein AALP_AA1G000600                    137   2e-33   Arabis alpina [alpine rockcress]
gb|KDP28399.1|  hypothetical protein JCGZ_14170                         137   2e-33   Jatropha curcas
ref|XP_002448150.1|  hypothetical protein SORBIDRAFT_06g022180          135   3e-33   
ref|XP_008776225.1|  PREDICTED: endoribonuclease Dicer homolog 4        137   3e-33   
ref|XP_002979043.1|  hypothetical protein SELMODRAFT_444049             137   3e-33   
emb|CDX92469.1|  BnaA10g15080D                                          137   4e-33   
gb|EYU35897.1|  hypothetical protein MIMGU_mgv1a000073mg                136   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_007220573.1|  hypothetical protein PRUPE_ppa000070mg             136   5e-33   Prunus persica
ref|XP_011078684.1|  PREDICTED: dicer-like protein 4 isoform X2         136   5e-33   
ref|XP_008783544.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    136   5e-33   Phoenix dactylifera
ref|XP_011078683.1|  PREDICTED: dicer-like protein 4 isoform X1         136   5e-33   Sesamum indicum [beniseed]
ref|XP_008783545.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    136   6e-33   
ref|XP_009765936.1|  PREDICTED: dicer-like protein 4 isoform X3         135   8e-33   Nicotiana sylvestris
ref|XP_009765934.1|  PREDICTED: dicer-like protein 4 isoform X1         135   8e-33   Nicotiana sylvestris
ref|XP_009765935.1|  PREDICTED: dicer-like protein 4 isoform X2         135   8e-33   Nicotiana sylvestris
ref|XP_002515097.1|  dicer-1, putative                                  135   1e-32   
ref|XP_006650986.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    135   1e-32   
ref|XP_008243098.1|  PREDICTED: dicer-like protein 4                    135   1e-32   
ref|XP_010535851.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    135   1e-32   
gb|EPS58332.1|  hypothetical protein M569_16483                         132   1e-32   Genlisea aurea
ref|XP_010229289.1|  PREDICTED: endoribonuclease Dicer homolog 1        135   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_009120817.1|  PREDICTED: dicer-like protein 4                    135   1e-32   Brassica rapa
emb|CDY35811.1|  BnaC09g37430D                                          135   1e-32   Brassica napus [oilseed rape]
ref|XP_010054144.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    135   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010054145.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    135   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010474688.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    135   2e-32   
gb|AAF03534.1|AF187317_1  CAF protein                                   135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171612.1|  endoribonuclease Dicer-like 1                         135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184881.1|  endoribonuclease Dicer-like 1                      135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010656556.1|  PREDICTED: dicer-like protein 4 isoform X1         134   2e-32   Vitis vinifera
gb|AEZ02177.1|  Dicer                                                   135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474687.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    135   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011083770.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   
ref|XP_002264486.2|  PREDICTED: dicer-like protein 4 isoform X2         134   2e-32   Vitis vinifera
emb|CBI25610.3|  unnamed protein product                                134   2e-32   Vitis vinifera
ref|XP_011083691.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   
ref|XP_011083544.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   
ref|XP_008244191.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   2e-32   Prunus mume [ume]
ref|XP_011468880.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   2e-32   Fragaria vesca subsp. vesca
ref|XP_011083472.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   Sesamum indicum [beniseed]
ref|XP_011083398.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   
ref|XP_010424192.1|  PREDICTED: dicer-like protein 4                    134   2e-32   
ref|XP_007012010.1|  Dicer-like protein, putative isoform 1             134   2e-32   
ref|XP_007012011.1|  Dicer-like protein isoform 2                       134   2e-32   
ref|XP_004155270.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    134   2e-32   
ref|XP_011083615.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    134   2e-32   
ref|XP_004134274.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    134   3e-32   
ref|XP_007204799.1|  hypothetical protein PRUPE_ppa000144mg             134   3e-32   
ref|XP_010556639.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    134   3e-32   Tarenaya hassleriana [spider flower]
gb|KGN56328.1|  hypothetical protein Csa_3G116650                       134   3e-32   Cucumis sativus [cucumbers]
ref|XP_010556636.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    134   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_008437750.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   3e-32   Cucumis melo [Oriental melon]
ref|XP_009606996.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   3e-32   
gb|KHG02896.1|  Endoribonuclease Dicer -like protein                    134   3e-32   Gossypium arboreum [tree cotton]
ref|XP_011071730.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    134   3e-32   
ref|XP_010495321.1|  PREDICTED: dicer-like protein 4                    134   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010457181.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006352611.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    134   4e-32   Solanum tuberosum [potatoes]
ref|XP_010240123.1|  PREDICTED: endoribonuclease Dicer homolog 4        134   4e-32   Brachypodium distachyon [annual false brome]
ref|XP_010454337.1|  PREDICTED: dicer-like protein 4                    134   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010661522.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   4e-32   Vitis vinifera
ref|XP_006306578.1|  hypothetical protein CARUB_v10008073mg             134   4e-32   Capsella rubella
ref|XP_011071729.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    134   5e-32   Sesamum indicum [beniseed]
ref|XP_010241057.1|  PREDICTED: endoribonuclease Dicer homolog 1        134   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004508388.1|  PREDICTED: dicer-like protein 4-like               133   5e-32   
ref|XP_007139041.1|  hypothetical protein PHAVU_009G260000g             133   8e-32   Phaseolus vulgaris [French bean]
ref|XP_006386668.1|  Endoribonuclease Dicer family protein              133   8e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011025346.1|  PREDICTED: endoribonuclease Dicer homolog 1        133   8e-32   Populus euphratica
ref|NP_001289827.1|  endoribonuclease Dicer homolog 1                   133   8e-32   Solanum lycopersicum
ref|XP_006604922.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    133   8e-32   Glycine max [soybeans]
ref|XP_011469001.1|  PREDICTED: dicer-like protein 4                    132   9e-32   Fragaria vesca subsp. vesca
ref|XP_009597854.1|  PREDICTED: dicer-like protein 4                    132   9e-32   
gb|EYU31801.1|  hypothetical protein MIMGU_mgv1a000153mg                132   9e-32   Erythranthe guttata [common monkey flower]
gb|EYU31800.1|  hypothetical protein MIMGU_mgv1a000153mg                132   9e-32   Erythranthe guttata [common monkey flower]
gb|KHN11363.1|  Endoribonuclease Dicer like 1                           132   9e-32   Glycine soja [wild soybean]
ref|XP_009335261.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    132   9e-32   Pyrus x bretschneideri [bai li]
ref|XP_006846422.1|  hypothetical protein AMTR_s00018p00015000          132   1e-31   
ref|XP_010098282.1|  Dicer-like protein 4                               132   1e-31   
gb|KHG18654.1|  Dicer-like protein 4                                    132   1e-31   Gossypium arboreum [tree cotton]
gb|AIO05703.1|  putative endoribonuclease dicer 4-like protein 4        132   1e-31   Cocos nucifera
gb|KJB54891.1|  hypothetical protein B456_009G053300                    132   1e-31   Gossypium raimondii
gb|KJB54890.1|  hypothetical protein B456_009G053300                    132   1e-31   Gossypium raimondii
gb|EAZ25399.1|  hypothetical protein OsJ_09217                          132   1e-31   Oryza sativa Japonica Group [Japonica rice]
sp|Q8LMR2.1|DCL1_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...    132   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88320.1|  hypothetical protein OsI_09779                          132   1e-31   Oryza sativa Indica Group [Indian rice]
gb|KJB54892.1|  hypothetical protein B456_009G053300                    132   2e-31   Gossypium raimondii
ref|XP_002892088.1|  hypothetical protein ARALYDRAFT_333551             132   2e-31   
ref|XP_009366581.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    132   2e-31   
tpg|DAA43005.1|  TPA: hypothetical protein ZEAMMB73_941906              131   2e-31   
ref|XP_006577359.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    131   2e-31   Glycine max [soybeans]
ref|NP_001190348.1|  dicer-like protein 4                               131   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16394.1|  Endoribonuclease Dicer like 1                           131   2e-31   Glycine soja [wild soybean]
gb|KGN65222.1|  hypothetical protein Csa_1G267180                       131   2e-31   Cucumis sativus [cucumbers]
ref|XP_004146733.1|  PREDICTED: dicer-like protein 4-like               131   2e-31   
ref|XP_008358840.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    131   3e-31   
ref|NP_197532.3|  dicer-like protein 4                                  131   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162460.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    130   3e-31   
gb|EMT07624.1|  Endoribonuclease Dicer-1-like protein                   131   3e-31   
gb|EMS51466.1|  Endoribonuclease Dicer-like protein 4                   131   3e-31   
ref|XP_010107130.1|  Endoribonuclease Dicer-1-like protein              131   3e-31   
ref|XP_007155126.1|  hypothetical protein PHAVU_003G1757001g            131   3e-31   
ref|XP_008681621.1|  PREDICTED: uncharacterized protein LOC100381...    131   4e-31   
ref|XP_002873991.1|  predicted protein                                  131   4e-31   
gb|AES82838.2|  endoribonuclease dicer-like protein                     131   4e-31   
gb|ABD32724.1|  Helicase, C-terminal; Argonaute and Dicer protein...    131   4e-31   
ref|XP_003626620.1|  Endoribonuclease Dicer-like protein                130   4e-31   
gb|KEH24704.1|  endoribonuclease dicer-like protein                     130   5e-31   
ref|XP_006418369.1|  hypothetical protein EUTSA_v10006531mg             130   5e-31   
gb|EMT06391.1|  Endoribonuclease Dicer-4-like protein                   130   5e-31   
ref|XP_009418500.1|  PREDICTED: endoribonuclease Dicer homolog 4        130   5e-31   
ref|XP_006594227.1|  PREDICTED: dicer-like protein 4-like isoform X1    130   7e-31   
ref|XP_006594229.1|  PREDICTED: dicer-like protein 4-like isoform X3    130   7e-31   
ref|XP_006594228.1|  PREDICTED: dicer-like protein 4-like isoform X2    130   7e-31   
ref|XP_003603236.1|  Endoribonuclease Dicer-like protein                130   7e-31   
gb|KJB09575.1|  hypothetical protein B456_001G150400                    130   7e-31   
ref|XP_004976180.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    130   7e-31   
gb|KJB09576.1|  hypothetical protein B456_001G150400                    130   7e-31   
gb|AES73487.2|  endoribonuclease dicer-like protein                     130   7e-31   
gb|EMS58929.1|  Endoribonuclease Dicer-like protein 1                   130   8e-31   
ref|XP_004976179.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    130   8e-31   
gb|AAF26461.1|AC007323_2  T25K16.4                                      130   9e-31   
ref|XP_008443888.1|  PREDICTED: dicer-like protein 4 isoform X2         130   9e-31   
ref|XP_008443887.1|  PREDICTED: dicer-like protein 4 isoform X1         130   9e-31   
ref|XP_008443891.1|  PREDICTED: dicer-like protein 4 isoform X4         129   9e-31   
ref|XP_008443889.1|  PREDICTED: dicer-like protein 4 isoform X3         129   1e-30   
gb|AJA90765.1|  Dicer-like 3                                            129   1e-30   
ref|XP_007051387.1|  Helicase, C-terminal, Argonaute and Dicer pr...    129   1e-30   
ref|XP_007051386.1|  Dicer-like 1 isoform 1                             129   1e-30   
gb|ERL94289.1|  hypothetical protein D910_11570                         129   1e-30   
ref|XP_001757950.1|  dsRNA-specific nuclease dicer and related ri...    129   1e-30   
gb|ENN74155.1|  hypothetical protein YQE_09128                          129   1e-30   
gb|ABV31244.1|  dicer-like 1                                            129   1e-30   
ref|XP_010261807.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    129   2e-30   
ref|XP_010261808.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    129   2e-30   
ref|XP_011033477.1|  PREDICTED: dicer-like protein 4                    129   2e-30   
ref|XP_002308384.2|  hypothetical protein POPTR_0006s20310g             129   2e-30   
dbj|BAG90040.1|  unnamed protein product                                128   3e-30   
ref|NP_001053278.1|  Os04g0509300                                       128   3e-30   
ref|XP_001772316.1|  predicted protein                                  128   3e-30   
ref|XP_009400626.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    128   3e-30   
dbj|BAF80150.1|  SHOOT ORGANIZATION1                                    128   4e-30   
sp|A7LFZ6.1|DCL4_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...    128   4e-30   
emb|CAE03362.1|  OSJNBb0065L13.5                                        128   4e-30   
gb|EEC77616.1|  hypothetical protein OsI_16596                          128   4e-30   
gb|KDP38631.1|  hypothetical protein JCGZ_03984                         127   5e-30   
ref|XP_006600705.1|  PREDICTED: dicer-like protein 4-like isoform X2    127   5e-30   
gb|AJA90780.1|  Dicer-like 3                                            127   6e-30   
ref|XP_003550797.1|  PREDICTED: dicer-like protein 4-like isoform X1    127   6e-30   
gb|KGB36779.1|  Endoribonuclease Dcr-1                                  127   6e-30   
ref|XP_009119662.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    127   6e-30   
gb|EPS69439.1|  hypothetical protein M569_05327                         127   8e-30   
ref|XP_009335262.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    127   8e-30   
emb|CDY15207.1|  BnaC05g00860D                                          127   1e-29   
emb|CDX90002.1|  BnaA10g00800D                                          127   1e-29   
ref|XP_004494884.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    126   1e-29   
ref|XP_004494885.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    126   1e-29   
ref|XP_006474519.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    126   2e-29   
ref|XP_006474520.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    126   2e-29   
ref|XP_002978277.1|  hypothetical protein SELMODRAFT_108314             126   2e-29   
ref|XP_008445598.1|  PREDICTED: endoribonuclease Dicer homolog 3        126   2e-29   
ref|XP_006452951.1|  hypothetical protein CICLE_v10007239mg             126   2e-29   
gb|ABV31246.1|  dicer-like 4                                            126   2e-29   
ref|XP_006653591.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    126   2e-29   
ref|XP_006452950.1|  hypothetical protein CICLE_v10007239mg             126   2e-29   
ref|XP_002966292.1|  hypothetical protein SELMODRAFT_86110              126   2e-29   
dbj|GAA53880.1|  endoribonuclease Dicer                                 126   2e-29   
ref|XP_004985932.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    125   2e-29   
gb|ADB44075.1|  dicer-1                                                 126   2e-29   
ref|XP_009167121.1|  hypothetical protein T265_13440                    126   2e-29   
ref|XP_002523532.1|  Ribonuclease III, putative                         125   3e-29   
ref|XP_002324204.2|  hypothetical protein POPTR_0018s08340g             125   3e-29   
gb|KHN22101.1|  Dicer-like protein 4                                    125   4e-29   
ref|XP_006444699.1|  hypothetical protein CICLE_v10018447mg             125   4e-29   
gb|KDO86652.1|  hypothetical protein CISIN_1g000174mg                   125   4e-29   
gb|EYU29223.1|  hypothetical protein MIMGU_mgv1a0001672mg               124   5e-29   
ref|XP_006491399.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    125   5e-29   
gb|AEC12444.1|  ribonuclease III family protein DCL3                    124   6e-29   
ref|XP_006848760.1|  hypothetical protein AMTR_s00026p00051870          124   6e-29   
ref|XP_010245537.1|  PREDICTED: dicer-like protein 4 isoform X3         124   7e-29   
gb|EEE61317.1|  hypothetical protein OsJ_15421                          124   7e-29   
gb|AJF15702.1|  dicer-1                                                 124   7e-29   
ref|XP_008796519.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    124   7e-29   
ref|XP_010245534.1|  PREDICTED: dicer-like protein 4 isoform X1         124   8e-29   
ref|XP_010245538.1|  PREDICTED: dicer-like protein 4 isoform X4         124   8e-29   
gb|KJB65397.1|  hypothetical protein B456_010G093100                    124   8e-29   
ref|XP_008187012.1|  PREDICTED: endoribonuclease Dcr-1-like             124   8e-29   
ref|XP_010245535.1|  PREDICTED: dicer-like protein 4 isoform X2         124   9e-29   
gb|KJB65396.1|  hypothetical protein B456_010G093100                    124   9e-29   
gb|KHG13242.1|  Endoribonuclease Dicera                                 124   9e-29   
gb|EEC67202.1|  hypothetical protein OsI_34085                          124   9e-29   
gb|KJB65395.1|  hypothetical protein B456_010G093100                    124   9e-29   
gb|KJB65398.1|  hypothetical protein B456_010G093100                    124   9e-29   
ref|XP_011002832.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    124   9e-29   
ref|XP_011002834.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    124   9e-29   
gb|ABB20894.1|  dicer-like protein                                      123   1e-28   
ref|XP_004144277.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    124   1e-28   
ref|NP_001064898.2|  Os10g0485600                                       124   1e-28   
ref|XP_004158269.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    124   1e-28   
gb|KGN47575.1|  hypothetical protein Csa_6G361370                       124   1e-28   
ref|XP_008364841.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    124   1e-28   
ref|XP_011002831.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    124   1e-28   
ref|XP_011002830.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    124   1e-28   
ref|XP_011002828.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    124   1e-28   
gb|EEE51167.1|  hypothetical protein OsJ_31945                          123   1e-28   
sp|Q7XD96.2|DCL3B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...    123   1e-28   
ref|XP_008376239.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    124   1e-28   
gb|ABR14013.1|  Dicer-1                                                 123   2e-28   
ref|XP_006661878.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    123   2e-28   
ref|XP_001944314.2|  PREDICTED: endoribonuclease Dcr-1-like             123   2e-28   
gb|KHN18588.1|  Dicer-like protein 4                                    123   2e-28   
ref|XP_010049290.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    123   2e-28   
ref|XP_010049291.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    123   2e-28   
gb|ABG74922.1|  Dicer-like 1b protein                                   122   3e-28   
ref|XP_008235739.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    122   3e-28   
ref|XP_004501416.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    122   3e-28   
ref|XP_009363041.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    122   3e-28   
ref|XP_008199044.1|  PREDICTED: endoribonuclease Dcr-1                  122   3e-28   
gb|KDO59383.1|  hypothetical protein CISIN_1g0003801mg                  120   3e-28   
ref|XP_001999145.1|  GI24348                                            122   3e-28   
ref|XP_010687747.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    122   3e-28   
gb|EFA11550.1|  dicer-1                                                 122   3e-28   
ref|XP_002032258.1|  GM23619                                            122   4e-28   
gb|ACC62400.2|  ribonuclease III                                        122   4e-28   
gb|AAK84929.1|  SD01621p                                                121   4e-28   
ref|XP_007201640.1|  hypothetical protein PRUPE_ppa021659mg             122   4e-28   
gb|ABD61609.1|  Dicer-1                                                 122   5e-28   
ref|XP_010906745.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    122   5e-28   
ref|XP_008220598.1|  PREDICTED: endoribonuclease Dicer homolog 3        122   5e-28   
ref|XP_010514744.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    122   5e-28   
ref|NP_001180543.1|  dicer-2                                            122   5e-28   
ref|XP_010514746.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    122   5e-28   
gb|EPS61362.1|  hypothetical protein M569_13434                         121   5e-28   
ref|XP_010514745.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    122   5e-28   
ref|XP_001982226.1|  GG12488                                            122   6e-28   
ref|XP_002104476.1|  Dicer-1                                            121   6e-28   
ref|NP_524453.1|  Dicer-1                                               121   7e-28   
gb|ABD61611.1|  Dicer-1                                                 121   7e-28   
gb|ABD61604.1|  Dicer-1                                                 121   7e-28   
gb|ABD61616.1|  Dicer-1                                                 121   7e-28   
gb|ABD61601.1|  Dicer-1                                                 121   7e-28   
gb|ABD61613.1|  Dicer-1                                                 121   7e-28   
ref|XP_002098342.1|  GE24009                                            121   7e-28   
gb|EFX86072.1|  hypothetical protein DAPPUDRAFT_309030                  121   7e-28   
gb|ABD61603.1|  Dicer-1                                                 121   7e-28   
ref|XP_001954492.1|  GF18290                                            121   7e-28   
gb|ABD61612.1|  Dicer-1                                                 121   8e-28   
gb|ABD61610.1|  Dicer-1                                                 121   8e-28   
gb|ABD61605.1|  Dicer-1                                                 121   8e-28   
ref|XP_007225476.1|  hypothetical protein PRUPE_ppa000165mg             121   8e-28   
gb|ABD61614.1|  Dicer-1                                                 121   8e-28   
gb|ABD61615.1|  Dicer-1                                                 121   8e-28   
gb|ABD61606.1|  Dicer-1                                                 121   8e-28   
gb|ABD61602.1|  Dicer-1                                                 121   8e-28   
ref|XP_008357238.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    121   8e-28   
ref|XP_008357237.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    121   9e-28   
gb|AIO05701.1|  putative endoribonuclease dicer 3a-like protein 3a      120   1e-27   
gb|ABD61608.1|  Dicer-1                                                 121   1e-27   
ref|XP_001989969.1|  GH18503                                            121   1e-27   
ref|XP_009359046.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    120   1e-27   
ref|XP_001766164.1|  dsRNA-specific nuclease dicer and related ri...    120   1e-27   
ref|XP_010503060.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    120   1e-27   
ref|XP_010503059.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    120   1e-27   
ref|XP_007012461.1|  Ribonuclease III, putative isoform 1               120   1e-27   
ref|XP_007012462.1|  Endoribonuclease Dicera, putative isoform 2        120   1e-27   
gb|ABQ02405.1|  dicer                                                   120   2e-27   
emb|CAZ36047.2|  dicer-1, putative                                      120   2e-27   
ref|XP_002516160.1|  Ribonuclease III, putative                         120   2e-27   
ref|XP_008469110.1|  PREDICTED: endoribonuclease Dcr-1-like             120   2e-27   
ref|XP_008664847.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    120   2e-27   
tpg|DAA49563.1|  TPA: hypothetical protein ZEAMMB73_299457              120   2e-27   
ref|XP_006453683.1|  hypothetical protein CICLE_v10007241mg             120   2e-27   
ref|XP_008664845.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    120   2e-27   
tpg|DAA49561.1|  TPA: hypothetical protein ZEAMMB73_299457              120   2e-27   
tpg|DAA49562.1|  TPA: hypothetical protein ZEAMMB73_299457              120   2e-27   
ref|XP_009777737.1|  PREDICTED: endoribonuclease Dicer homolog 3a       120   2e-27   
ref|XP_008664848.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    120   2e-27   
ref|XP_001358121.1|  GA18437                                            120   2e-27   
ref|XP_008664844.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    120   2e-27   
ref|XP_002012751.1|  GL23778                                            120   2e-27   
ref|XP_006473957.1|  PREDICTED: dicer-like protein 4-like isoform X1    120   2e-27   
ref|XP_006473958.1|  PREDICTED: dicer-like protein 4-like isoform X2    120   2e-27   
gb|KHN37228.1|  Endoribonuclease Dicer like 3a                          114   2e-27   
emb|CDW54888.1|  Dicer dimer and Helicase C and PAZ and Ribonucle...    120   2e-27   
gb|ABD61607.1|  Dicer-1                                                 120   2e-27   
ref|XP_006473959.1|  PREDICTED: dicer-like protein 4-like isoform X3    120   3e-27   
gb|ABV31245.1|  dicer-like 3                                            119   3e-27   
ref|XP_011185943.1|  PREDICTED: endoribonuclease Dcr-1 isoform X1       119   3e-27   
ref|XP_011185944.1|  PREDICTED: endoribonuclease Dcr-1 isoform X2       119   3e-27   
gb|AHY18681.1|  Dicer                                                   119   4e-27   
ref|XP_010427121.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    119   4e-27   
ref|XP_009381868.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    119   5e-27   
emb|CCF23094.1|  Dicer 2                                                119   5e-27   
ref|XP_004970995.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    119   5e-27   
ref|NP_001289826.1|  endoribonuclease Dicer homolog 3a                  119   6e-27   
ref|XP_011458182.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    118   7e-27   
ref|NP_001062844.1|  Os09g0315100                                       112   7e-27   
ref|XP_010231294.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    118   7e-27   
gb|ACF96960.1|  dicer-1                                                 119   7e-27   
ref|XP_010231293.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    118   8e-27   
ref|XP_009588925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    118   8e-27   
gb|AGL08684.1|  dicer 2                                                 118   9e-27   
ref|XP_011212659.1|  PREDICTED: endoribonuclease Dcr-1                  118   9e-27   
ref|XP_009588920.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    118   9e-27   
ref|XP_005179923.1|  PREDICTED: endoribonuclease Dcr-1                  118   9e-27   
ref|XP_010932925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    118   9e-27   
gb|KFB46099.1|  AGAP002836-PB-like protein                              118   1e-26   
ref|XP_002425109.1|  dicer-1, putative                                  115   1e-26   
ref|XP_006290500.1|  hypothetical protein CARUB_v10016574mg             118   1e-26   
ref|XP_008393569.1|  PREDICTED: endoribonuclease Dicer homolog 3a       118   1e-26   
gb|EMS52805.1|  Endoribonuclease Dicer-like protein 3a                  118   1e-26   
ref|XP_002054279.1|  GJ24359                                            118   1e-26   
ref|XP_006293341.1|  hypothetical protein CARUB_v100165770mg            117   1e-26   
ref|XP_009046342.1|  hypothetical protein LOTGIDRAFT_111015             118   1e-26   
dbj|BAM37458.1|  Dicer-2                                                117   1e-26   
ref|XP_006361520.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    117   1e-26   
emb|CDW55659.1|  endoribonuclease Dicer                                 117   1e-26   
ref|XP_010236618.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    117   1e-26   



>gb|ADT91700.1| dicer-like protein 2 [Nicotiana attenuata]
Length=239

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 151/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  47   FDEELLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGVDIDFVD  106

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
            AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  107  APTPRHFPMNAEKLVNVRYLE--SLLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  164

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GDAVLDYAVT H Y +YPGLSPG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  165  GDAVLDYAVTAHLYFKYPGLSPGFITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  224

Query  543  SIADFV  560
             I + V
Sbjct  225  QIVNTV  230



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score =   247 bits (630),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 151/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  1082  FDEELLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGVDIDFVD  1141

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APTPRHFPMNAEKLVNVRYLE--SLLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDYAVT H Y +YPGLSPG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGFITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  1259

Query  543   SIADFV  560
              I + V
Sbjct  1260  QIVNTV  1265



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 150/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E ++ S K+YSRGR+KM ++ +ADV EALIGAFLS+ GE+AALSF++WLG+ IDF+D
Sbjct  1082  FDEEVLMPSVKMYSRGRQKMKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIGIDFVD  1141

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APSPRHFPMNAEKLVNVRYLE--SLLHYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDYAVT H Y +YPGLSPG +T+LRS SVNN CYA ++V+AGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGLITDLRSASVNNECYAQAAVRAGLHKHILHASQDLQR  1259

Query  543   SIADFV  560
              I + V
Sbjct  1260  QIVNTV  1265



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 151/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+ 
Sbjct  1082  FDEEVLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIDIDFVA  1141

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             AP + +FP+NAE++VN++ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APTLRHFPMNAEKLVNIRYLE--SLLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDYAVT H Y +YPGLSPG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGLITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  1259

Query  543   SIADFV  560
              + + V
Sbjct  1260  QMVNTV  1265



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score =   235 bits (600),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+  + +S K+YSR ++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1082  FDEVLLTSSDKMYSRVKQKIRSKRVADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1141

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             AP+  +FP+NAE++VNV+ LES  LL+Y F DPSLLVEALTHGSY IP   + YQRLEFL
Sbjct  1142  APMSRHFPMNAEKLVNVRYLES--LLHYKFNDPSLLVEALTHGSYMIPEIPRCYQRLEFL  1199

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY VT H Y +YPGL+PG +T+LRS SVNN CYA S+VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYVVTAHLYFKYPGLTPGLITDLRSASVNNECYAQSAVKAGLHKHILHASQDLQR  1259

Query  543   SIADFV  560
              I   V
Sbjct  1260  QICSTV  1265



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1049  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1108

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  362
             AP   + P+NAE++VNV+ LE  SLL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1109  APTSRHLPVNAEKLVNVRYLE--SLLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1166

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY VT H Y +YPGL+PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1167  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1226

Query  543   SIADFV  560
              I+  V
Sbjct  1227  HISSTV  1232



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1085  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1144

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  362
             AP   + P+NAE++VNV+ LE  SLL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1145  APTSRHLPVNAEKLVNVRYLE--SLLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1202

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY VT H Y +YPGL+PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1203  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1262

Query  543   SIADFV  560
              I+  V
Sbjct  1263  HISSTV  1268



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1112  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1171

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  362
             AP   + P+NAE++VNV+ LE  SLL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1172  APTSRHLPVNAEKLVNVRYLE--SLLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1229

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY VT H Y +YPGL+PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1230  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1289

Query  543   SIADFV  560
              I+  V
Sbjct  1290  HISSTV  1295



>gb|KDP26899.1| hypothetical protein JCGZ_18057 [Jatropha curcas]
Length=424

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 135/183 (74%), Gaps = 3/183 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +  + K+Y  GRRK+  + +ADV EALIGA+LST GEIA L FL W+G+  +F +
Sbjct  97   LNEEFLSNTRKIYVTGRRKLKEKVVADVVEALIGAYLSTGGEIAGLLFLDWIGIKAEFDN  156

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P V +F + AE++VNV  LES  LLNY FRDPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  157  IPYVRHFEVKAERLVNVSYLES--LLNYQFRDPSLLVEALTHGSYMLPEVPRCYQRLEFL  214

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GD+VLDY +T + Y QYPG+SPG LT++RS SVNN CYA S+V+ GLH YI H+S  L  
Sbjct  215  GDSVLDYLITVYLYKQYPGMSPGLLTDMRSASVNNDCYAQSAVRGGLHKYICHASQKLHK  274

Query  543  SIA  551
             IA
Sbjct  275  DIA  277



>gb|KDO45678.1| hypothetical protein CISIN_1g0030622mg, partial [Citrus sinensis]
Length=346

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 135/183 (74%), Gaps = 3/183 (2%)
 Frame = +3

Query  3    ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
            EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  24   ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  83

Query  183  DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
            + P    F + AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  84   NVPYERQFQVQAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  141

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
            LGDAVLDY +T + Y++YP LSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  142  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  201

Query  540  SSI  548
              I
Sbjct  202  KWI  204



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  683  LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  742

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  743  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  800

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  801  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  860

Query  543  SIADFV  560
             IA+ V
Sbjct  861  EIAETV  866



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  753  LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  812

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  813  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  870

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  871  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  930

Query  543  SIADFV  560
             IA+ V
Sbjct  931  EIAETV  936



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  790  LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  849

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  850  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  907

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  908  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  967

Query  543  SIADFV  560
             IA+ V
Sbjct  968  EIAETV  973



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  878   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  937

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  938   IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  995

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  996   GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1055

Query  543   SIADFV  560
              IA+ V
Sbjct  1056  EIAETV  1061



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score =   221 bits (564),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  983   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  1042

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  1043  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  1100

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  1101  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1160

Query  543   SIADFV  560
              IA+ V
Sbjct  1161  EIAETV  1166



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  1094  LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  1153

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  1154  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  1211

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y +YP +SPG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  1212  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1271

Query  543   SIADFV  560
              IA+ V
Sbjct  1272  EIAETV  1277



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN  203
             L + K+Y  GRRK+ ++ +ADV EALIGA+LST GE+AAL F+ W+G+ IDF + P   +
Sbjct  1079  LNTRKIYVSGRRKLKSKKVADVVEALIGAYLSTGGEVAALLFMNWIGITIDFRNIPYERH  1138

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLD  380
             F + AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +      YQRLEFLGD+VLD
Sbjct  1139  FEVQAEKIVNVQHLES--LLNYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFLGDSVLD  1196

Query  381   YAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y +TRH Y++YPG+SPG LT+LRS SVNN CYALS+VKAGLH +IL SS  L   I + V
Sbjct  1197  YLITRHLYNKYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYKHIKETV  1256



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y RGRRK+ ++T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1079  LSEEPLSECRKIYVRGRRKVKSKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1138

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1139  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYQRLEFL  1196

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VK  LH +ILH+S  L  
Sbjct  1197  GDAVLDYLITMHLYKEYPGMSPGLLTDLRSASVNNDCYAQSAVKGDLHKHILHTSQDLHK  1256

Query  543   SIAD  554
              I +
Sbjct  1257  HIVE  1260



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E + +   +Y RG RK+ +++IADV EALIGAFLST GE AA+ F+ W+G+ +DF  
Sbjct  1077  LKEEFLSSERNIYIRGTRKIKSKSIADVVEALIGAFLSTGGETAAVYFMNWVGIKVDFTY  1136

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   NFP+  E++VNVK LE   LLNY+F DPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1137  IPYERNFPVQPEKLVNVKHLEG--LLNYSFHDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1194

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T + YD+YPG+SPG LT++RS SVNN CYA S+VKAGLH +ILH+S  L  
Sbjct  1195  GDAVLDYLITVYLYDKYPGMSPGVLTDMRSASVNNDCYARSAVKAGLHKHILHASQKLHK  1254

Query  543   SIADFV  560
              I   +
Sbjct  1255  DIVQTI  1260



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1021  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1080

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1081  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1138

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1139  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1198

Query  549   A  551
              
Sbjct  1199  V  1199



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score =   218 bits (556),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  549   A  551
              
Sbjct  1262  V  1262



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score =   218 bits (556),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  549   A  551
              
Sbjct  1262  V  1262



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  549   A  551
              
Sbjct  1262  V  1262



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1076  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1135

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1136  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1193

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1194  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1253

Query  549   A  551
              
Sbjct  1254  V  1254



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1079  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1138

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1139  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1196

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y +YP +SPG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1197  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1256

Query  543   SIAD  554
              I +
Sbjct  1257  QIVE  1260



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1080  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1139

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1140  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1197

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y +YP +SPG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1198  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1257

Query  543   SIAD  554
              I +
Sbjct  1258  QIVE  1261



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  977   EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1036

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVE+LTHGSY +P   + YQRLEFLGD
Sbjct  1037  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVESLTHGSYMLPEIPRCYQRLEFLGD  1094

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1095  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1154

Query  549   A  551
              
Sbjct  1155  V  1155



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 136/183 (74%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y RGRRK+ ++TIADV EALIGA+LST GE+ AL F+ W+G+ +DF++
Sbjct  1140  LSEEPLSKGRKIYIRGRRKVKSKTIADVVEALIGAYLSTGGEVTALLFMDWIGIKVDFMN  1199

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +  L AE+ VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1200  TPYERHIQLQAEKFVNVRYLES--LLNYSFNDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1257

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y +YPG+SPG LT+LRS SVNN CYALS+VK GL  +ILH+S  L  
Sbjct  1258  GDAVLDYLITLHMYKEYPGMSPGLLTDLRSASVNNDCYALSAVKVGLDRHILHASHDLHK  1317

Query  543   SIA  551
              I 
Sbjct  1318  HIV  1320



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1078  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1137

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1138  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1195

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y +YP +SPG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1196  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1255

Query  543   SIAD  554
              I +
Sbjct  1256  QIVE  1259



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 4/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             LD+E  L + K+Y  GRRK+ ++ +ADV EALIGA+LS  GE AAL FL W+G+ IDF +
Sbjct  971   LDEE-TLNTRKIYVSGRRKLKSKKVADVVEALIGAYLSMGGEAAALLFLNWIGITIDFRN  1029

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F + AE+ VNV+ LES  LLNY+F+DPS LVEALTHGSY +      YQRLEFL
Sbjct  1030  IPYERHFEVQAEKFVNVQHLES--LLNYSFQDPSFLVEALTHGSYMLAEIPGCYQRLEFL  1087

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +TRH Y+ YPG+SPG LT+LRS SVNN CYALS+VKAGLH +IL SS  L  
Sbjct  1088  GDSVLDYLITRHLYNNYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYK  1147

Query  543   SIADFV  560
              I + V
Sbjct  1148  HIKETV  1153



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 4/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             LD+E  L + K+Y  GRRK+ ++ +ADV EALIGA+LS  GE AAL FL W+G+ IDF +
Sbjct  1039  LDEE-TLNTRKIYVSGRRKLKSKKVADVVEALIGAYLSMGGEAAALLFLNWIGITIDFRN  1097

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F + AE+ VNV+ LES  LLNY+F+DPS LVEALTHGSY +      YQRLEFL
Sbjct  1098  IPYERHFEVQAEKFVNVQHLES--LLNYSFQDPSFLVEALTHGSYMLAEIPGCYQRLEFL  1155

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +TRH Y+ YPG+SPG LT+LRS SVNN CYALS+VKAGLH +IL SS  L  
Sbjct  1156  GDSVLDYLITRHLYNNYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYK  1215

Query  543   SIADFV  560
              I + V
Sbjct  1216  HIKETV  1221



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             EL+ + +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDDSLFNGRKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
             + P    F ++AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYQRQFQVHAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGDAVLDY +T + Y++YPGLSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPGLSPGYLTDMRSASVNNDCYALSSVKHGLHKHILHASHELY  1251

Query  540   SSI  548
               I
Sbjct  1252  KRI  1254



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             EL+ + +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDDSLFNGRKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
             + P    F ++AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYQRQFQVHAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGDAVLDY +T + Y++YPGLSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPGLSPGYLTDMRSASVNNDCYALSSVKHGLHKHILHASHELY  1251

Query  540   SSI  548
               I
Sbjct  1252  KRI  1254



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  756  LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  815

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  816  IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  873

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GD+VLDY +T H Y++YPG++PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  874  GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  933

Query  543  SIADFV  560
             I + V
Sbjct  934  DIKETV  939



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  986   LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  1045

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  1046  IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  1103

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y++YPG++PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  1104  GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  1163

Query  543   SIADFV  560
              I + V
Sbjct  1164  DIKETV  1169



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  1075  LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  1134

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  1135  IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  1192

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y++YPG++PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  1193  GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  1252

Query  543   SIADFV  560
              I + V
Sbjct  1253  DIKETV  1258



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score =   213 bits (542),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y + RRK+  + IADV EALIGA+LST GEIA L FL W+G+  DF++
Sbjct  1067  LSEEILSNGRKMYIKRRRKLKEKMIADVVEALIGAYLSTGGEIAGLLFLDWIGIKADFLN  1126

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P    F +N E+ VN+  LES  LL Y+FRDP LLVEALTHGSY +P   + YQRLEFL
Sbjct  1127  MPYERGFEMNPEKYVNICHLES--LLKYSFRDPCLLVEALTHGSYMLPEIPRCYQRLEFL  1184

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y++YPG+SPG LT++RS SVNN CYA S+V+ GLH YILH+S  L  
Sbjct  1185  GDSVLDYLITVHLYEKYPGMSPGLLTDMRSASVNNDCYAQSAVREGLHKYILHASQKLHK  1244

Query  543   SIADFV  560
              I   V
Sbjct  1245  DIVSTV  1250



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y+R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+ 
Sbjct  1073  LYEELLYDGRKIYTRERRKVKSKSVADVVEALIGAFLSTGGEVAAIYFMNWVGIKVDFVH  1132

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L  E++VNV  LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1133  IPCERHFQLQPEKLVNVGHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1190

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T + Y++YPG+SPG LT++RS SVNN CYA S++KA L+ +ILH+S  L  
Sbjct  1191  GDAVLDYLITIYLYNEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHK  1250

Query  543   SIA  551
              I 
Sbjct  1251  DIV  1253



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y+R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+ 
Sbjct  1073  LYEELLYDGRKIYTRERRKVKSKSVADVVEALIGAFLSTGGEVAAMYFMNWVGIKVDFVH  1132

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F L  E++VNV R+ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1133  IPCERHFQLQPEKLVNVGRIES--LLKYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1190

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T + Y++YPG+SPG LT++RS SVNN CYA S++KA L+ +ILH+S  L  
Sbjct  1191  GDAVLDYLITIYLYNEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHK  1250

Query  543   SIA  551
              I 
Sbjct  1251  DIV  1253



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E +    ++Y R RRK+ ++++ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  1097  LNEELLSNERRIYFRERRKVKSKSVADVVEALIGAFLSTGGEIAAMYFMNWVGIKVDSVH  1156

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F +  E++VNV+ +ES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1157  IPYGRHFQVQPEKLVNVRHVES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1214

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLD+ +T + Y++YPG+SPG LT++RS SVNN CYA S++KAGLH +ILH+S  L  
Sbjct  1215  GDAVLDHLITIYLYNKYPGMSPGILTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHK  1274

Query  543   SIA  551
              I 
Sbjct  1275  DIV  1277



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y R RRK+ ++++ADV EALIGAFL T GEIAA+ F+ W+G+ +D + 
Sbjct  1078  LTEELLSNERKIYFRERRKVKSKSVADVVEALIGAFLITGGEIAAMYFMNWVGIKVDSVH  1137

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   +F +  E++VNV+R+ES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1138  IPSDRHFQVQPEKLVNVRRVES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1195

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLD+ +T + Y++YPG+SPG LT++RS SVNN CYA S++KAGLH +ILH+S  L  
Sbjct  1196  GDAVLDHLITIYLYNKYPGMSPGVLTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHK  1255

Query  543   SIA  551
              I 
Sbjct  1256  DIV  1258



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +3

Query  39    LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  218
             +Y+R +RK+ ++ +ADV EALIGAFLST GEIAAL FL WLG+ +DF+D P      +N 
Sbjct  1039  VYAREKRKIKSKRVADVVEALIGAFLSTVGEIAALLFLEWLGIKVDFVDVPYTMPLQVNP  1098

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  395
             EQ+VNVK LES  LLNY+FRD SLLVEALTHGSY +P   + YQRLEFLGDAVLDY +T 
Sbjct  1099  EQLVNVKFLES--LLNYSFRDASLLVEALTHGSYMLPEIPRCYQRLEFLGDAVLDYLITM  1156

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             H Y +YP LSPG LT+LRS S +N CYA S+VKAGL+ +IL++S  L+  I   V
Sbjct  1157  HLYAKYPELSPGLLTDLRSASASNDCYAQSAVKAGLYKHILYASQELQRHIVSAV  1211



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E + +  K+Y RG R++ ++ IAD+ EALIGAFL T GE+AA+ F+ W+G+ +DF  
Sbjct  1071  LKEELLSSERKIYIRGTRRIKSKRIADIVEALIGAFLVTGGEMAAVYFMNWVGIKVDFTY  1130

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P   NFP+  E+++NVK LE    LNY+F DPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1131  IPYDRNFPVQPEKLINVKVLEKK--LNYSFHDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1188

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T + Y++YPG+SPG LT++RS SVNN CYA SSVKA LH +ILH+S  L  
Sbjct  1189  GDAVLDYLITIYLYNKYPGMSPGVLTDMRSASVNNDCYARSSVKAELHKHILHASQKLHR  1248

Query  543   SIADFV  560
              I   V
Sbjct  1249  EIVHTV  1254



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L +E +    K+Y +GRRK+ ++TIADV EALIGA+LST GE+ AL F+ W+G+ +DF++
Sbjct  1078  LGEEPLSEGRKIYIKGRRKVKSKTIADVVEALIGAYLSTGGEVTALLFMDWIGIKVDFMN  1137

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFL  362
              P   +  L AE+ VNV+ LES  LLNY+F DPSLLVEALTHGSY+ P   +  QRLEFL
Sbjct  1138  TPYERHIQLQAEKFVNVRYLES--LLNYSFNDPSLLVEALTHGSYLLPEIPRCXQRLEFL  1195

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T H Y +YPG+SPG LT+LRS SVNN CYA S+VK GL  +ILH+S  L  
Sbjct  1196  GDSVLDYLITLHMYKEYPGMSPGLLTDLRSASVNNDCYAQSAVKVGLDRHILHASHDLHK  1255

Query  543   SIA  551
              I 
Sbjct  1256  HIV  1258



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +3

Query  48    RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
             R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+  P   +F L  E++
Sbjct  1100  RERRKVKSKSVADVVEALIGAFLSTGGEVAAIYFMNWVGIKVDFVHIPCERHFQLQPEKL  1159

Query  228   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
             VNV  LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFLGDAVLDY +T + Y
Sbjct  1160  VNVGHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFLGDAVLDYLITIYLY  1217

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  551
             ++YPG+SPG LT++RS SVNN CYA S++KA L+ +ILH+S  L   I 
Sbjct  1218  NEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHKDIV  1266



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 133/183 (73%), Gaps = 3/183 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
             + P    F +  E++VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLES--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGDAVLDY +T + Y++YP LSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  540   SSI  548
               I
Sbjct  1252  KWI  1254



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 133/183 (73%), Gaps = 3/183 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
             + P    F +  E++VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLES--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGDAVLDY +T + Y++YP LSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  540   SSI  548
               I
Sbjct  1252  KWI  1254



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E +L+S K+Y  G  K+ ++T+ADV EALIGAFLS  GE+AALSF+ WLG+ +DF++ P
Sbjct  1078  KEELLSSTKVYIGGSMKIKSKTVADVIEALIGAFLSAGGEVAALSFMTWLGISVDFVNVP  1137

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                N  +N E  VNV  L+S  LLNY+FRD SLLVEALTHGSY +P     YQRLEFLGD
Sbjct  1138  YTRNVAVNPELHVNVPHLQS--LLNYSFRDVSLLVEALTHGSYMLPEIPGCYQRLEFLGD  1195

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             A+LDY +T H Y ++PGLSPG LT+LRS SVNN CYA ++VKA L+ ++LH+S  L   I
Sbjct  1196  ALLDYLITVHLYHKHPGLSPGLLTDLRSASVNNDCYAQAAVKAELYKHVLHASPELHRHI  1255

Query  549   ADFV  560
                V
Sbjct  1256  VHAV  1259



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 132/186 (71%), Gaps = 2/186 (1%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L+++       +Y RG RK+  + +ADV EALIGAFLST GEIAA+ F+ W+G+ +D   
Sbjct  439  LNEKLPFNEKNIYIRGTRKIKGKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLFH  498

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P   +F +  E++++V+ LES  L NY+FRDPSLL+EALTHGSY +P     Y+RLEFL
Sbjct  499  IPYERHFQVQPEKLIDVRHLES-LLNNYSFRDPSLLLEALTHGSYMLPQIPGCYERLEFL  557

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GDAVLDY +T H Y +YP +SPG LT++RS SVNN CYA ++V+AGLH +IL S   L +
Sbjct  558  GDAVLDYVITAHLYHKYPDMSPGLLTDMRSASVNNICYARTAVRAGLHKHILASDCVLHT  617

Query  543  SIADFV  560
             IA+ V
Sbjct  618  DIANTV  623



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1007  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1066

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1067  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1124

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y++YPG+SPG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1125  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1184

Query  549   A  551
             A
Sbjct  1185  A  1185



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1070  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1129

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1130  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1187

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y++YPG+SPG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1188  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1247

Query  549   A  551
             A
Sbjct  1248  A  1248



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1104  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1163

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1164  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1221

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y++YPG+SPG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1222  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1281

Query  549   A  551
             A
Sbjct  1282  A  1282



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1103  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1162

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1163  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1220

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y++YPG+SPG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1221  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1280

Query  549   A  551
             A
Sbjct  1281  A  1281



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 126/182 (69%), Gaps = 3/182 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L  E   ++ K+Y  G RK+  +T+ADV EALIGAFLS  GEI ALSF+ WLG+D+DF+ 
Sbjct  824   LQNELFSSTKKIYINGSRKIKGKTVADVAEALIGAFLSAGGEIPALSFIAWLGIDVDFVS  883

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFL  362
              P      L  E  VN+  LES  +LNY+F+D SLLVEALTHGSY+ P     YQRLEFL
Sbjct  884   IPYTRGLFLKPELHVNIGHLES--ILNYSFKDVSLLVEALTHGSYMRPEIPGCYQRLEFL  941

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLDY +T H Y + P LSPG LT+LRS SVNN CYA S+VKAGLH +ILH S  L  
Sbjct  942   GDAVLDYIITVHLYQENPSLSPGLLTDLRSASVNNDCYANSAVKAGLHKHILHLSPELHR  1001

Query  543   SI  548
              I
Sbjct  1002  HI  1003



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
             + P    F +  E++VNV+ LE   LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLEL--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGDAVLDY +T + Y++YP LSPG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  540   SSI  548
               I
Sbjct  1252  KWI  1254



>ref|NP_001131630.1| uncharacterized protein LOC100192986 [Zea mays]
 gb|ACF80129.1| unknown [Zea mays]
Length=365

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +3

Query  48   RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
            R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  50   RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  109

Query  228  VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
            +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  110  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  167

Query  405  DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             QYP  +P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++
Sbjct  168  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYL  219



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E       +Y RGRRK+ ++ +ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  463  LNEELPFNKRNIYIRGRRKVKSKRVADVVEALIGAFLSTGGEIAAIHFMNWVGIKVDLVH  522

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P   +F +  E++++V+ LES  L NY+FR P LL+EALTH SY +P     Y+RLEFL
Sbjct  523  TPYERHFQVQPEKLIDVRHLES-LLNNYSFRHPHLLLEALTHRSYMLPQIPGCYERLEFL  581

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GDAVLDYA+T + Y++YPG+SPG LT++RS SVNN CYALS+VKA LH +IL +S  + S
Sbjct  582  GDAVLDYAITVYLYNKYPGMSPGVLTDMRSASVNNNCYALSAVKARLHEHIL-ASDNVHS  640

Query  543  SIADFV  560
            +IA+ V
Sbjct  641  NIANTV  646



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 133/186 (72%), Gaps = 2/186 (1%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L+++       +Y RG RK+  + +ADV EALIGAFLST GEIAA+ F+ W+G+ +D   
Sbjct  485  LNEKLRFNEKNIYIRGTRKVKGKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLAH  544

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P   +F +  E++++++ LES  L NY+FRDPSLL+EALTHGSY +P     Y+RLEFL
Sbjct  545  IPYERHFQVQPEKLIDIRHLES-LLNNYSFRDPSLLLEALTHGSYMLPQIPGCYERLEFL  603

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GDAVLDY +T H Y++YP +SP  LT++RS SVNN CYA ++V+AGLH +IL S + L +
Sbjct  604  GDAVLDYVITAHLYNKYPDMSPELLTDMRSASVNNVCYARTAVRAGLHKHILASDSVLHT  663

Query  543  SIADFV  560
             IA+ V
Sbjct  664  DIANTV  669



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             E  +E +  + K+Y RG+R+M N+ +AD  EALIGA+L T GE+AAL F+ WLG+++ F+
Sbjct  866   EFGEELLSDTRKIYFRGKRRMKNKVVADAVEALIGAYLETGGEVAALIFMDWLGIEVTFV  925

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
               P    F  + +  +N++ +ES  LL Y+FRDPSLLVEALTHGSY IP   + YQRLEF
Sbjct  926   HIPHEKPFLGDPKMHINIRHIES--LLKYSFRDPSLLVEALTHGSYMIPEIPRCYQRLEF  983

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGD+VLDY +T + Y++YPG SPG LT+LRS SVNN  YA +++KAGLH +ILH+S  L 
Sbjct  984   LGDSVLDYLITTYLYNKYPGASPGLLTDLRSASVNNDSYANAALKAGLHKHILHASPKLH  1043

Query  540   SSIADFV  560
               I+  +
Sbjct  1044  QQISSIL  1050



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             E  +E +  + K+Y RG+R+M N+ +AD  EALIGA+L T GE+AAL F+ WLG+++ F+
Sbjct  1072  EFGEELLSDTRKIYFRGKRRMKNKVVADAVEALIGAYLETGGEVAALIFMDWLGIEVTFV  1131

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
               P    F  + +  +N++ +ES  LL Y+FRDPSLLVEALTHGSY IP   + YQRLEF
Sbjct  1132  HIPHEKPFLGDPKMHINIRHIES--LLKYSFRDPSLLVEALTHGSYMIPEIPRCYQRLEF  1189

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGD+VLDY +T + Y++YPG SPG LT+LRS SVNN  YA +++KAGLH +ILH+S  L 
Sbjct  1190  LGDSVLDYLITTYLYNKYPGASPGLLTDLRSASVNNDSYANAALKAGLHKHILHASPKLH  1249

Query  540   SSIADFV  560
               I+  +
Sbjct  1250  QQISSIL  1256



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1081  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1140

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1141  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1198

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V
Sbjct  1199  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTV  1256



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 135/183 (74%), Gaps = 3/183 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L++E + ++ K+Y+ G RK+ ++ +ADV EALIGAFLS  GE+A+L F+ WLG++++F  
Sbjct  1112  LEKEFLSSTYKIYNGGTRKIKSKRVADVVEALIGAFLSAGGEVASLMFMNWLGIEVEFSC  1171

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
                  N P+N   ++NV  +ES  +LNY+F+DPSL+VEALTHGSY +P   + YQRLEFL
Sbjct  1172  ITYQRNVPMNPRMILNVNHIES--VLNYSFKDPSLVVEALTHGSYMLPEIPRCYQRLEFL  1229

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GDAVLD+ +T H Y ++P +SPG LT+LRS SVNN CY L +++AGLH +ILH+S  L  
Sbjct  1230  GDAVLDHLITIHLYTKHPEMSPGLLTDLRSASVNNECYGLCAIRAGLHKHILHASQILYK  1289

Query  543   SIA  551
              +A
Sbjct  1290  QMA  1292



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1067  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1126

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1127  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1184

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V
Sbjct  1185  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTV  1242



>emb|CDP20270.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 4/187 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L +E + T   +Y+R +R + N+T+ADV EALIG F+ T  E AAL+F++W+G ++DFI 
Sbjct  34   LRKEVLSTRIIVYAREKRTIKNKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFIY  93

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  359
             P     P N E++V++K  +   LLN Y+FRD SLLVEALTHGSY+ P    SY+RL+F
Sbjct  94   VPYKRPVPANPEKLVDLKFFKK--LLNQYSFRDASLLVEALTHGSYVRPESPTSYERLKF  151

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
            LGDAVL+Y +T HFY+++P LS G LT+LRS SVNN  YA +++K GLH +ILH S  L+
Sbjct  152  LGDAVLEYLITMHFYNKHPNLSSGLLTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQ  211

Query  540  SSIADFV  560
              I   V
Sbjct  212  RRILAIV  218



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 3/180 (2%)
 Frame = +3

Query  15    ECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI  194
             E V    K Y  G+RK+  + +ADV EALIGAFLST GE AAL F+ W+G+ + F   P 
Sbjct  1070  ELVTKGKKNYVYGKRKLKRKIVADVVEALIGAFLSTGGEKAALMFMDWVGIKVSFDKIPY  1129

Query  195   VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDA  371
               +F +  +++VNVK LES   L Y+FRD SLLVEALTHGSY +P   + YQRLEFLGD+
Sbjct  1130  ERHFDIQPDKLVNVKFLESQ--LKYSFRDRSLLVEALTHGSYMLPEVPRCYQRLEFLGDS  1187

Query  372   VLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  551
             VLDY +T H Y++YPG+SPG LT++RS SVNN CYA  ++K GLH ++LH+S  L   IA
Sbjct  1188  VLDYLITWHLYNKYPGMSPGQLTDMRSASVNNDCYAWCTIKHGLHKHVLHASQELHMHIA  1247



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1735  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1794

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1795  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1852

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V
Sbjct  1853  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTV  1910



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE++AL F+ W+G+ +DF    I    P
Sbjct  1726  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELSALMFMNWVGIKVDFTTTKIERESP  1785

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1786  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1843

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VK  LH +ILH+S  L   I+  V
Sbjct  1844  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKENLHKHILHASHVLHKHISRTV  1901



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y RGRRK+ ++ +ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  434  LNEELLFNKRNIYIRGRRKVKSKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLVH  493

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
             P   +F +  E++++V+ LES  L NY+FR P LL+EALTH SY +P     Y+RLEFL
Sbjct  494  IPYERHFQVQPEKLIDVRHLES-LLNNYSFRHPHLLLEALTHRSYMLPQIPGCYERLEFL  552

Query  363  GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            GDAVLDY +T + Y++YPG+SPG LT++RS SVNN CYALS+VK  LH +IL +   + S
Sbjct  553  GDAVLDYVITVYLYNKYPGMSPGVLTDMRSASVNNNCYALSAVKHRLHEHIL-APDNVHS  611

Query  543  SIADFV  560
            +IA+ V
Sbjct  612  NIANTV  617



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +D     I  + P
Sbjct  1079  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDLTTTKIQRDSP  1138

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1139  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1196

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V
Sbjct  1197  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTV  1254



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +D     I  + P
Sbjct  1067  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDLTTTKIQRDSP  1126

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1127  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1184

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP LSPG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V
Sbjct  1185  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTV  1242



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 129/181 (71%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y+RG RK+  +  ADV EALIGAFLST GE+AAL FL W+G+ ++F   P
Sbjct  1065  EETVFKGTKIYTRGNRKLKRKIAADVVEALIGAFLSTGGEMAALLFLDWVGIKVNFNITP  1124

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                 F    + ++NV  LES  LL ++FRD SLLVEA+THGSY +P   + YQRLE+LGD
Sbjct  1125  YERQFDACPDNLINVSFLES--LLKHSFRDRSLLVEAMTHGSYMLPDVPRCYQRLEYLGD  1182

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             AVLDY +T H Y+++PG++PG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1183  AVLDYLITTHLYNEHPGMTPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1242

Query  549   A  551
             A
Sbjct  1243  A  1243



>gb|AFW68290.1| hypothetical protein ZEAMMB73_539070 [Zea mays]
Length=707

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +3

Query  48   RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
            R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  392  RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  451

Query  228  VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
            +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  452  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  509

Query  405  DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             QYP  +P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++
Sbjct  510  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYL  561



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y  G RK++ + IADV EALIGAFLS+ GE AAL F+ W+G+ + F   P
Sbjct  1068  KELVSGEKKIYVIGERKLNRKIIADVVEALIGAFLSSGGEKAALLFMDWVGIKMSFNKIP  1127

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E++V+V  LES   L Y+F D +LLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1128  YKRHFDIQPEKLVHVSHLESQ--LKYSFHDRTLLVEALTHGSYMLPEIPRCYQRLEFLGD  1185

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +TRH Y++YPG+SPG LT++RS SVNN CYA S++  GLH ++LH+S  L   I
Sbjct  1186  SVLDYLITRHLYNEYPGMSPGQLTDMRSASVNNDCYAWSAINHGLHKHVLHASQELHKHI  1245

Query  549   A  551
             A
Sbjct  1246  A  1246



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y+RG RK+  + +ADV EALIGAFLS  GE+AAL F+ W+G+ ++F   P
Sbjct  1063  EETVFNGRKIYTRGDRKLKRKVVADVVEALIGAFLSAGGEMAALLFMDWIGIKVNFNIIP  1122

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                 F    + +VNV+ LES  LL Y+FRD SLLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1123  YERQFIACPDNLVNVRFLES--LLKYSFRDRSLLVEALTHGSYMLPDVPRCYQRLEYLGD  1180

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y  YPG+SPG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1181  SVLDYLITMHLYRVYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1240

Query  549   A  551
              
Sbjct  1241  V  1241



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y+RG RK+  + +ADV EALIGAFLS  GE+AAL F+ W+G+ ++F   P
Sbjct  1104  EETVFNGRKIYTRGDRKLKRKVVADVVEALIGAFLSAGGEMAALLFMDWIGIKVNFNIIP  1163

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                 F    + +VNV+ LES  LL Y+FRD SLLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1164  YERQFIACPDNLVNVRFLES--LLKYSFRDRSLLVEALTHGSYMLPDVPRCYQRLEYLGD  1221

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y  YPG+SPG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1222  SVLDYLITMHLYRVYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1281

Query  549   A  551
              
Sbjct  1282  V  1282



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V     +Y  G+RK+  + +ADV EALIGAFLST GE AAL F+ W+G+ + F   P
Sbjct  1071  KELVAKGKTIYVSGKRKLRQKIVADVVEALIGAFLSTGGEKAALLFMDWVGIKVSFNKIP  1130

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E++VNV  LES   LNY+F D SLLVEA+THGSY +P   + YQRLEFLGD
Sbjct  1131  YDRHFDIQPEKLVNVSFLESQ--LNYSFHDRSLLVEAVTHGSYMLPEVPRCYQRLEFLGD  1188

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H Y++YPG++PG LT++RS SVNN CYA S++K GLH ++LH+S  L   +
Sbjct  1189  SVLDYLITWHLYNKYPGMTPGQLTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHMHV  1248

Query  549   A  551
             +
Sbjct  1249  S  1249



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = +3

Query  36    KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLN  215
             K+Y+  RRK+  +T+ADV EAL+GA +S  GE A L F+ WLG+++DF   P   N   N
Sbjct  883   KMYTMQRRKIKRKTVADVVEALLGACVSDGGENAGLFFVHWLGIEVDFGIRPSNRNLLAN  942

Query  216   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVT  392
              E+ +N++ +ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFLGD+VLDY VT
Sbjct  943   PERFINIRDIES--LLGYSFRDPSLLVEALTHGSYMLPEVPTCYQRLEFLGDSVLDYLVT  1000

Query  393   RHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD  554
              H Y ++PGLSPG LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD
Sbjct  1001  IHLYRKHPGLSPGVLTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIAD  1054



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = +3

Query  36    KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLN  215
             K+Y+  RRK+  +T+ADV EAL+GA +S  GE A L F+ WLG+++DF   P   N   N
Sbjct  1092  KMYTMQRRKIKRKTVADVVEALLGACVSDGGENAGLFFVHWLGIEVDFGIRPSNRNLLAN  1151

Query  216   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVT  392
              E+ +N++ +ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFLGD+VLDY VT
Sbjct  1152  PERFINIRDIES--LLGYSFRDPSLLVEALTHGSYMLPEVPTCYQRLEFLGDSVLDYLVT  1209

Query  393   RHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD  554
              H Y ++PGLSPG LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD
Sbjct  1210  IHLYRKHPGLSPGVLTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIAD  1263



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1077  SRSMYIARRRNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1136

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1137  IQAEKLVNVSYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1194

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H Y +YP LSPG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V
Sbjct  1195  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTV  1252



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 137/214 (64%), Gaps = 32/214 (15%)
 Frame = +3

Query  15    ECVLTSGKL-YSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             E VL + K+ Y +G +KM ++ +ADV EALIGAFLST GEI A+ F+ WLG+++D    P
Sbjct  1078  EDVLPNEKIIYIKGTKKMKSKRVADVVEALIGAFLSTGGEIPAVKFMNWLGIEVDLEFKP  1137

Query  192   IVGNFPLNAEQMVNVKRLE------------------------------SDSLLNYTFRD  281
                +F + +++++N+K LE                                 LLNYTFRD
Sbjct  1138  YETHFQVQSDRLLNIKHLEFLLNYTFRDRSLLVEALTHGSYMLPEIPRCYQFLLNYTFRD  1197

Query  282   PSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSES  458
              SLLVEALTHGSY +P   + YQRLEFLGDAVLDY +T HFY+ YPG+SP  LT++RS S
Sbjct  1198  HSLLVEALTHGSYMLPEIPRCYQRLEFLGDAVLDYVITMHFYNTYPGMSPEKLTDMRSAS  1257

Query  459   VNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             VNN CYALS+VKAGL  +IL++S  L   IA+ +
Sbjct  1258  VNNDCYALSAVKAGLQKHILYTSHQLHKEIANTI  1291



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  39    LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  218
             +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ A
Sbjct  1088  IYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQA  1147

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  395
             E++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+
Sbjct  1148  EKLVNVGYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITK  1205

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             H YD+YP ++PG LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V
Sbjct  1206  HLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTV  1260



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  39    LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  218
             +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ A
Sbjct  1085  IYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQA  1144

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  395
             E++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+
Sbjct  1145  EKLVNVGYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITK  1202

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             H YD+YP ++PG LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V
Sbjct  1203  HLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTV  1257



>ref|XP_004173421.1| PREDICTED: endoribonuclease Dicer homolog 2-like, partial [Cucumis 
sativus]
Length=307

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
            +L +E + +  K+Y + +RK+ ++ IADV EALIGA+LST GE AA+ FL  +G++++F 
Sbjct  94   QLREEVLFSGRKVYVQRKRKIKSKRIADVVEALIGAYLSTGGEKAAMQFLNRIGIEVNFD  153

Query  183  DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
              P    F ++  +++NV  LES  LL YTF D SLL+EA+THGSY +P   + YQRLEF
Sbjct  154  FVPYERPFRVDVHKLINVGHLES--LLKYTFNDRSLLLEAMTHGSYMLPEIPRCYQRLEF  211

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
            LGD+VLDYA+T H Y++YPG++P  LT++RS SV+N CY+ +++KA LH  ILH S  L 
Sbjct  212  LGDSVLDYAITVHLYNKYPGMTPELLTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLH  271

Query  540  SSIADFV  560
              I+  V
Sbjct  272  KHISSAV  278



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +3

Query  48    RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  1093  RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  1152

Query  228   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  1153  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  1210

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              QYP  +P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++
Sbjct  1211  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYL  1262



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +3

Query  48    RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  1086  RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  1145

Query  228   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  1146  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  1203

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              QYP  +P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++
Sbjct  1204  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYL  1255



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1076  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1135

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1136  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1193

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H Y +YP LSPG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V
Sbjct  1194  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTV  1251



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1076  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1135

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1136  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1193

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H Y +YP LSPG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V
Sbjct  1194  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTV  1251



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1080  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1139

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1140  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1197

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H Y +YP LSPG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V
Sbjct  1198  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTV  1255



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 127/186 (68%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L+ + +  SG +Y    R +  + +ADV EALIGA+LS  GE+AAL F+ W+G+ IDF  
Sbjct  1073  LNNDTLPESGNVYVASIRNLKRKCVADVVEALIGAYLSEGGELAALVFMNWVGIKIDFTT  1132

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
               I     + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFL
Sbjct  1133  TKIERESLIQAEKLVNVGYIES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFL  1190

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T+H YD++P LSPG LT++RS SVNN CYA  +VKA LH +ILH+S  L  
Sbjct  1191  GDSVLDYLITKHLYDKFPSLSPGLLTDMRSASVNNDCYAQVAVKANLHKHILHASHDLHK  1250

Query  543   SIADFV  560
              I+  V
Sbjct  1251  HISRTV  1256



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 128/180 (71%), Gaps = 6/180 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y  G RK+D + +ADV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  458  LNEELLFDKRSIYVGGTRKIDAKIVADVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  517

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  365
                 +  + +E  V+V  LE  SLL+Y F+DPSLLVEAL+HGSYIP G   YQRLEFLG
Sbjct  518  IRYERHLQVQSEIPVDVGHLE--SLLDYKFQDPSLLVEALSHGSYIPGG---YQRLEFLG  572

Query  366  DAVLDYAVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            DAVLDY +T +FYD+YP  +SPG LT LRS SVNN CYALS+VKAGLH +IL S    R+
Sbjct  573  DAVLDYMITTYFYDKYPEMMSPGILTILRSASVNNKCYALSAVKAGLHKHILASDIVHRN  632



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 128/180 (71%), Gaps = 6/180 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y  G RK+D + +ADV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  457  LNEELLFDKRSIYVGGTRKIDAKIVADVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  516

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  365
                 +  + +E  V+V  LE  SLL+Y F+DPSLLVEAL+HGSYIP G   YQRLEFLG
Sbjct  517  IRYERHLQVQSEIPVDVGHLE--SLLDYKFQDPSLLVEALSHGSYIPGG---YQRLEFLG  571

Query  366  DAVLDYAVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            DAVLDY +T +FYD+YP  +SPG LT LRS SVNN CYALS+VKAGLH +IL S    R+
Sbjct  572  DAVLDYMITTYFYDKYPEMMSPGILTILRSASVNNKCYALSAVKAGLHKHILASDIVHRN  631



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1079  SRNIYIARRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKIDFTTTMIQRESS  1138

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  + ++SLLNY F D SLLVEALTHGSY IP   + YQRLEFLGDAVLDY 
Sbjct  1139  IQAEKLVNV--VYTESLLNYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDAVLDYL  1196

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +T+H Y +YP LSPG LT++RS SVNN CYA  +VK+ LH +ILH+S  L   I
Sbjct  1197  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHILHASHDLHKHI  1250



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 127/180 (71%), Gaps = 6/180 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y  G RK+D + + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  461  LNEELLFNKRSIYVGGTRKIDTKVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDXDH  520

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  365
                 + P+  E++++V  LE  SLL Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  521  IRYERHLPVQPEKLIDVGHLE--SLLGYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  575

Query  366  DAVLDYAVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            DAVLDY +T +FY +YPG +SPG LT++RS SVNN CYA S+VKAGLH +IL S    R+
Sbjct  576  DAVLDYMITTYFYYKYPGMMSPGFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHRN  635



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 127/180 (71%), Gaps = 6/180 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y  G RK+D + + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  461  LNEELLFNKRSIYVGGTRKIDTKVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDXDH  520

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  365
                 + P+  E++++V  LE  SLL Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  521  IRYERHLPVQPEKLIDVGHLE--SLLGYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  575

Query  366  DAVLDYAVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            DAVLDY +T +FY +YPG +SPG LT++RS SVNN CYA S+VKAGLH +IL S    R+
Sbjct  576  DAVLDYMITTYFYYKYPGMMSPGFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHRN  635



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 6/182 (3%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y+RG R +  + +ADV EALIGAFL+  GE AAL F+ W+G+ ++F   P
Sbjct  1081  KETVYKGTKIYTRGDRNLKRKIVADVVEALIGAFLTAGGEKAALLFMDWIGIKVNFNIMP  1140

Query  192   IVGNFPLNA-EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  365
                   LNA E +VNV  LES  LL Y+FR+PSLLVEA+THGSY +P     YQRLE+LG
Sbjct  1141  YERQ--LNAPENVVNVGFLES--LLKYSFRNPSLLVEAMTHGSYMLPEVPTCYQRLEYLG  1196

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLDY +T H Y +YPG+SPG LT++RS SVNN CYA+S++K  LH ++LH+S  L   
Sbjct  1197  DSVLDYLITMHLYKEYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKH  1256

Query  546   IA  551
             I 
Sbjct  1257  IV  1258



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L ++       +Y RGRRK+ +ET+ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  461  LSEDLPFNERNIYIRGRRKVTDETVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLVH  520

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  362
             P   +F +  E++++V+ L+  SLLNY+F DPSLL+EALTH S  +P     Y+RLEFL
Sbjct  521  IPYKRHFQVQPEKLIDVRYLK--SLLNYSFHDPSLLLEALTHSSCMLPKIPGCYERLEFL  578

Query  363  GDAVLDYAVTRHFYDQYPGL-SPGCLTELRSESVNNACYALSSVKAGLHNYILHS  524
            GDAVLDY +T + Y++Y  + SPG +T++RS SVNN CYALS+VKAGLH +IL S
Sbjct  579  GDAVLDYVITFYLYNKYRDMSSPGFITDMRSASVNNDCYALSAVKAGLHKHILAS  633



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  48    RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  227
             R  RK+ ++ IAD  EALIGA+LS AGE AA  FL+ LG+DI+F   P+     +NAE  
Sbjct  1070  RSLRKLKSKRIADSVEALIGAYLSAAGEQAAYLFLKSLGMDIEFHKMPVERKITINAENF  1129

Query  228   VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLGDAVLDYAVTRHFY  404
             +N++ LE   +L+Y F DPSLL+EALTHGSY   GT + YQRLEFLGDAVLD+  T +FY
Sbjct  1130  INLRSLEL--MLDYNFSDPSLLLEALTHGSYQIAGTTACYQRLEFLGDAVLDHIFTDYFY  1187

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              QYP  +P  LT+LRS SVNN+CYA ++VKAGLH +ILHSS+AL   +AD++
Sbjct  1188  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHILHSSSALHKKMADYL  1239



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN  203
             L+S K Y +G++K   + +ADV EALIGAFLST GE AAL F+ W+G+ +D    P++  
Sbjct  1106  LSSKKTYVKGQKKFKAKVVADVVEALIGAFLSTNGEQAALLFMDWMGIKVDIFKDPLIER  1165

Query  204   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT-QSYQRLEFLGDAVL  377
                L  E+ VNV  +E+  LL Y F D SLLVEALTHGSY    T  SYQRLEFLGD+VL
Sbjct  1166  PHLLQPERFVNVSLIET--LLKYKFHDCSLLVEALTHGSYQVEDTLASYQRLEFLGDSVL  1223

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  551
             DY +T+HFY+ YP +SP  LT+LRS SVNN CYA  +VKAGLH +IL++S+ L S IA
Sbjct  1224  DYLLTKHFYNMYPRISPQLLTDLRSASVNNYCYAHVAVKAGLHKHILYASSELHSQIA  1281



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1042  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1101

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1102  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1159

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP ++PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V
Sbjct  1160  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTV  1217



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1083  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1142

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1143  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1200

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP ++PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V
Sbjct  1201  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTV  1258



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +3

Query  30    SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  209
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1086  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1145

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  386
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1146  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1203

Query  387   VTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T+H YD+YP ++PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V
Sbjct  1204  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTV  1261



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E +    K+Y  G+RK+  + IADV EALIGAFLS+ GE AAL F+  +G+ ++F   P
Sbjct  1102  EEFISKGKKIYISGQRKLKRKLIADVVEALIGAFLSSGGEKAALLFMDCVGIKVNFNKIP  1161

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                +F +  E++++V  LES   LNY+F D +LLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1162  YERHFDIQPEKLIHVTFLESQ--LNYSFHDRTLLVEALTHGSYMLPEVPRCYQRLEYLGD  1219

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLDY +T H + +YPG+SPG LT++RS SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1220  SVLDYLITWHLFKKYPGMSPGQLTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1279

Query  549   A  551
             A
Sbjct  1280  A  1280



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 6/180 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +     +Y  G RK+D E + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  460  LNEELLFNKRSIYVGGTRKIDTEVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  519

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  365
                 +  +  E++++V  LE  SLL+Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  520  IRYERHLQVQPEKLIDVGHLE--SLLDYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  574

Query  366  DAVLDYAVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
            DAVLDY +T +FY  YPG +SP  LT++RS SVNN CYA S+VKAGLH +IL S    R+
Sbjct  575  DAVLDYMITDYFYHTYPGMMSPRFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHRN  634



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L +E + T   +Y+R +R + N+T+ADV EALIG F+ T  E AAL+F++W+G ++DF+ 
Sbjct  414  LRKEVLSTRIIVYAREKRTIKNKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFVY  473

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  359
                     N E++V+++  +S  LLN Y+FRD SLLVEALTHGSY+ P    SY+ LEF
Sbjct  474  VQYKRPVAANPEKLVDLRFFKS--LLNQYSFRDASLLVEALTHGSYVRPESPTSYEHLEF  531

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
            LGDAVLDY +T+HF++++P LS G LT+LRS SVNN C A ++++AGLH +ILH S  L+
Sbjct  532  LGDAVLDYLITKHFHNEHPNLSSGLLTDLRSASVNNDCCARTAIRAGLHKHILHDSQDLQ  591

Query  540  SSI  548
              I
Sbjct  592  RRI  594



>emb|CDO96787.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = +3

Query  69   NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRLE  248
            ++T+ADV EALIG F+ T  E AAL+F++W+G ++DFI  P     P N E++V++K  +
Sbjct  51   SKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFIYVPYKRPVPANPEKLVDLKFFK  110

Query  249  SDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL  422
               LLN Y+FRD SLLVEALTHGSY+ P    SY+RL+FLGDAVL+Y +T HFY+++P L
Sbjct  111  K--LLNQYSFRDASLLVEALTHGSYVRPERPTSYKRLKFLGDAVLEYLITMHFYNKHPNL  168

Query  423  SPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
            S G LT+LRS SVNN  YA +++K GLH +ILH S  L+  I   V
Sbjct  169  SSGLLTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQRRILAIV  214



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = +3

Query  9     DQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  188
             D + +L S  +YS  +  + ++ IAD  EALIGA+LS  GE AA  FL  LG+DI+F   
Sbjct  1085  DSKLILLSPNMYSVRKMSIKSKRIADSVEALIGAYLSAGGEQAAYLFLISLGMDIEFHKM  1144

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLG  365
             P+     + +E+ +N++ LE   +L Y F DPSLLVEA+THGSY   GT + YQRLEFLG
Sbjct  1145  PVERKITIKSEEFINLRSLEV--MLGYDFNDPSLLVEAMTHGSYQIAGTTACYQRLEFLG  1202

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             DAVLD+  T +FY QYP  +P  LT+LRS SVNN CYA ++VKAGLH +ILHSS+AL   
Sbjct  1203  DAVLDHIFTDYFYRQYPECTPELLTDLRSASVNNNCYAHAAVKAGLHKHILHSSSALHKR  1262

Query  546   IADFV  560
             +AD++
Sbjct  1263  MADYL  1267



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 130/187 (70%), Gaps = 4/187 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L +E + T   +Y+R +R +  +T+ADV EALIG F+ T  E AAL+F++W+G ++DF+ 
Sbjct  446  LREEVLSTRTIVYAREKRMIKIKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFVY  505

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  359
                     N E++V+++  +S  LLN Y+FRD SLLVEALTHGSY+ P    SY+RLEF
Sbjct  506  VQYKRPVAANPEKLVDLRFFKS--LLNQYSFRDASLLVEALTHGSYVRPESPTSYKRLEF  563

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
            LGDAVLDY +T H ++++P LS G LT+LRS SVNN CYA ++++AGLH +ILH S  L+
Sbjct  564  LGDAVLDYLITMHLHNEHPNLSSGLLTDLRSASVNNDCYARTAIRAGLHKHILHGSQDLQ  623

Query  540  SSIADFV  560
              I   V
Sbjct  624  RRILAIV  630



>emb|CAX18337.1| dicel-like 2 [Nicotiana benthamiana]
Length=224

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 3/127 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             D+E ++ S K+YSRGR+K  ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  100  FDEEVLMPSVKMYSRGRQKTKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIDIDFVD  159

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
            AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  160  APSPRHFPMNAEKLVNVRYLE--SLLHYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  217

Query  363  GDAVLDY  383
            GD VLDY
Sbjct  218  GDVVLDY  224



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  3     ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  182
             +L +E + +  K+Y + +RK+ ++ IADV EALIGA+LST GE AA+ FL  +G++++F 
Sbjct  1069  QLREEVLFSGRKVYVQRKRKIKSKRIADVVEALIGAYLSTGGEKAAMQFLNRIGIEVNFD  1128

Query  183   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  359
               P    F ++  +++NV  LES  LL YTF D SLL+EA+THGSY +P   + YQRLEF
Sbjct  1129  FVPYERPFRVDVHKLINVGHLES--LLKYTFNDRSLLLEAMTHGSYMLPEIPRCYQRLEF  1186

Query  360   LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  539
             LGD+VLDYA+T H Y++YPG++P  LT++RS SV+N CY+ +++KA LH  ILH S  L 
Sbjct  1187  LGDSVLDYAITVHLYNKYPGMTPELLTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLH  1246

Query  540   SSIADFV  560
               I+  V
Sbjct  1247  KHISSAV  1253



>gb|ABK24820.1| unknown [Picea sitchensis]
Length=330

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 115/172 (67%), Gaps = 4/172 (2%)
 Frame = +3

Query  48   RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI-DAPIVGNFPLNAEQ  224
            +G R M  + +ADV EALIGA L T GE  ALSF++WLG+DID   + P           
Sbjct  19   KGYRMMKTKNVADVVEALIGACLETGGETVALSFVKWLGMDIDIPQEMPFTRKLDTGFVS  78

Query  225  MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYAVTRHF  401
             VNV+ LES  LL Y+FR  +L+VE++TH SY  P  +  YQRLEFLGDAVLDY +T +F
Sbjct  79   NVNVRYLES--LLKYSFRVHTLVVESVTHASYKEPSFSGCYQRLEFLGDAVLDYLITLYF  136

Query  402  YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
            Y  YPGLSPG LT+LRS +VNN CYA ++VK  LH  + H+S+ L + I +F
Sbjct  137  YKTYPGLSPGLLTDLRSAAVNNDCYAQAAVKCNLHQQLRHASSELHNQITEF  188



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L++E +  S  +Y R +R ++ +T+ADV EALIG FL +  EIAAL+F+ WLG+++D I 
Sbjct  432  LEKEQLSPSRTIYDRKKRMIEMKTVADVIEALIGVFLCSTSEIAALAFMEWLGIEVDSIY  491

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  359
             P +   P N  ++V+++  E+  LLN Y+F D SLLVEALTHGSY  P   + Y+RLEF
Sbjct  492  VPYIRPLPANPGEVVDLRFFET--LLNQYSFHDASLLVEALTHGSYKRPENPRCYKRLEF  549

Query  360  LGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI-LHSSTAL  536
            LGDAVLDY +T H ++++P LS   LT+LRS SVNN CYA +++KAGLH +I LH S  L
Sbjct  550  LGDAVLDYLITMHLHNEHPNLSSRLLTDLRSASVNNDCYARAAIKAGLHQHILLHDSQHL  609

Query  537  RSSIADFV  560
            +  I   V
Sbjct  610  KPRILAIV  617



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = +3

Query  93    EALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRLESDSLLNYT  272
             E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ AE++VNV  +ES  LL Y 
Sbjct  1064  ESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQAEKLVNVGYMES--LLKYK  1121

Query  273   FRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELR  449
             F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+H YD+YP ++PG LT++R
Sbjct  1122  FEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITKHLYDKYPCMTPGLLTDMR  1181

Query  450   SESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             S SVNN CYA  +VKA LH +ILH+S  L   I+  V
Sbjct  1182  SASVNNECYAQVAVKANLHKHILHASHDLHKHISRTV  1218



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA-PIVG  200
             L+S  +YS     + ++ IAD  EALIGA+LS AGE AA  FL+ LG+DI++    PI  
Sbjct  1085  LSSNDMYSLRTLSLRSKRIADTVEALIGAYLSAAGEQAAFLFLKSLGMDIEYHSKIPIER  1144

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLGDAVL  377
                + +E+ +NVK LE   +L Y F+DP LL+EALTHGSY   GT S YQRLEFLGDAVL
Sbjct  1145  EIGIKSEEFINVKSLEI--ILGYDFKDPLLLMEALTHGSYQTAGTTSCYQRLEFLGDAVL  1202

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T +FY+QYP  +P  LT+LRS SVNN+CYA ++VKAGL+ +ILHSS+ L   +A +
Sbjct  1203  DHIFTLYFYNQYPECTPALLTDLRSASVNNSCYAHAAVKAGLNKHILHSSSELHRKMAYY  1262

Query  558   V  560
             +
Sbjct  1263  L  1263



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  24   LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
            L+S  +YS  +  + ++ IAD  EALIGA+LS AGE AA  F+  LG+DI F  + PI  
Sbjct  815  LSSNGMYSLRKISIKSKRIADTVEALIGAYLSAAGEQAAFLFINSLGMDIGFHSEIPIER  874

Query  201  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVL  377
            N  +  E+ +N++ LE   +L Y F+DP LL+EALTHGSY I   T  YQRLEFLGDAVL
Sbjct  875  NIVIKPEEFINIRSLEI--ILGYNFKDPLLLIEALTHGSYQIAGPTACYQRLEFLGDAVL  932

Query  378  DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
            D+ VT ++Y+ YP  +P  LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +
Sbjct  933  DHLVTVYYYNTYPECTPALLTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYY  992

Query  558  V  560
            +
Sbjct  993  L  993



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L+S  +YS  +  + ++ IAD  EALIGA+LS AGE AA  F+  LG+DI F  + PI  
Sbjct  919   LSSNGMYSLRKISIKSKRIADTVEALIGAYLSAAGEQAAFLFINSLGMDIGFHSEIPIER  978

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVL  377
             N  +  E+ +N++ LE   +L Y F+DP LL+EALTHGSY I   T  YQRLEFLGDAVL
Sbjct  979   NIVIKPEEFINIRSLEI--ILGYNFKDPLLLIEALTHGSYQIAGPTACYQRLEFLGDAVL  1036

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+ VT ++Y+ YP  +P  LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +
Sbjct  1037  DHLVTVYYYNTYPECTPALLTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYY  1096

Query  558   V  560
             +
Sbjct  1097  L  1097



>gb|EMS67761.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=537

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = +3

Query  24   LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
            L+S  +++  +  + ++ IAD  EALIGA+L  AGE AA  FL+ LGLDI+F  + P+  
Sbjct  224  LSSNDMHTLRKMSVRSKRIADTVEALIGAYLGAAGEQAAFVFLKSLGLDIEFHSNIPLER  283

Query  201  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
               L +E+ +NV+ LE   +L Y F+D SLLVEALTHGSY   G T  YQRLEFLGDAVL
Sbjct  284  KIVLKSEKFINVRSLEM--ILGYEFKDTSLLVEALTHGSYQTAGATACYQRLEFLGDAVL  341

Query  378  DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  551
            DY  T +FY+QYP  +P  LT+LRS SVNN CYA ++ KAGL+ +ILHSS  L   +A
Sbjct  342  DYLFTIYFYNQYPECTPELLTDLRSASVNNNCYAHAAAKAGLNKHILHSSLQLHGRMA  399



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L ++ +  S  +Y   +R +  +++AD  EALIGA+L   GE+ A+ F+ W+G++++F +
Sbjct  1028  LTEDSLSDSRNIYVVRKRNVKRKSVADAVEALIGAYLCEGGEVQAVMFMDWVGINVNFAN  1087

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P       +AE+++NV  +ES  LLNY F+D SLLVEALTHGSY +P   + YQRLEFL
Sbjct  1088  VPYQRELLPSAEKLLNVFYIES--LLNYKFQDRSLLVEALTHGSYMLPEIPRCYQRLEFL  1145

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T++ YD+YP LSPG LT++RS SVNN  YA +++KA LH +ILH+S  L  
Sbjct  1146  GDSVLDYVITKYLYDKYPFLSPGLLTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHK  1205

Query  543   SIADFV  560
              +   V
Sbjct  1206  HMTRTV  1211



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = +3

Query  12    QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  188
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  984   REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1043

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  365
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1044  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1101

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLDYA+T H Y++YPG++P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1102  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1161

Query  546   IA  551
             I+
Sbjct  1162  IS  1163



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = +3

Query  12    QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  188
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  1071  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1130

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  365
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1131  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1188

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLDYA+T H Y++YPG++P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1189  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1248

Query  546   IA  551
             I+
Sbjct  1249  IS  1250



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = +3

Query  12    QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  188
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  1024  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1083

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  365
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1084  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1141

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLDYA+T H Y++YPG++P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1142  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1201

Query  546   IA  551
             I+
Sbjct  1202  IS  1203



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = +3

Query  6     LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             L ++ +  S  +Y   +R +  +++AD  EALIGA+L   GE+ A+ F+ W+G++++F +
Sbjct  1073  LTEDSLSDSRNIYVVRKRNVKRKSVADAVEALIGAYLCEGGEVQAVMFMDWVGINVNFAN  1132

Query  186   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  362
              P       +AE+++NV  +ES  LLNY F+D SLLVEALTHGSY +P   + YQRLEFL
Sbjct  1133  VPYQRELLPSAEKLLNVFYIES--LLNYKFQDRSLLVEALTHGSYMLPEIPRCYQRLEFL  1190

Query  363   GDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  542
             GD+VLDY +T++ YD+YP LSPG LT++RS SVNN  YA +++KA LH +ILH+S  L  
Sbjct  1191  GDSVLDYVITKYLYDKYPFLSPGLLTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHK  1250

Query  543   SIADFV  560
              +   V
Sbjct  1251  HMTRTV  1256



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 125/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    LYS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1027  LAPNGLYSQRKISIKSKRIADSVEALIGAYLSTAGEKAAFLMMKSLGMNIEFYTEIPVER  1086

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ +NV+ LE   +L Y F DPSLL+EALTHGSY   G T  YQRLEFLGDAVL
Sbjct  1087  KLSIKAEEFINVRTLEV--MLGYKFNDPSLLLEALTHGSYQTSGPTACYQRLEFLGDAVL  1144

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ YILHSS+ L   ++ +
Sbjct  1145  DHLFTVYYYSKYPECTPELLTDLRSASVNNNCYAHAAVKSGLNKYILHSSSELHRKMSYY  1204

Query  558   V  560
             +
Sbjct  1205  L  1205



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 124/177 (70%), Gaps = 9/177 (5%)
 Frame = +3

Query  39   LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  218
            +Y  GRR++  +T+ADV EALIGA L+T GE+ AL F+  +G+++DF   P   +  +++
Sbjct  764  VYISGRREVGYKTVADVVEALIGALLTTGGELPALKFMSLIGMEVDFNQVPYETHISMHS  823

Query  219  EQMVNVKR----LESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDY  383
            E++V +++    LES     Y+F DPSLLVEAL HGSY +    +SYQRLEFLGDAVLDY
Sbjct  824  EKLVRIRQNLSCLESKL---YSFHDPSLLVEALKHGSYKLQEIPRSYQRLEFLGDAVLDY  880

Query  384  AVTRHFYDQYPG-LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  551
             +++H YD++P  + PG LT++RS SVNN CYA  +VKAGLH +IL  S  L ++I 
Sbjct  881  LISKHLYDEHPDQMLPGLLTDMRSASVNNECYARCAVKAGLHEHILRDSRELDNNIV  937



>gb|KEH20231.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1219

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
             +E V    K+Y+RG RK+  + +ADV EALIGAFLS  GE+AAL F+ W+G+ ++    P
Sbjct  1067  EETVFKGTKIYTRGNRKLKRKVVADVVEALIGAFLSAGGEMAALLFMDWVGIKVNLNITP  1126

Query  192   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  368
                      + ++NV  LES  LL Y+FRD SLLVEA+THGSY +P   + YQRLE+LGD
Sbjct  1127  YERQINSCPDNLLNVSYLES--LLKYSFRDRSLLVEAMTHGSYMLPDVPRCYQRLEYLGD  1184

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNAC  473
             +VLDY +T H Y++YPG++PG LT++RS SVNN C
Sbjct  1185  SVLDYLITTHLYNEYPGMTPGQLTDMRSASVNNEC  1219



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24   LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
            L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  697  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  756

Query  201  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
               + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  757  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  814

Query  378  DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
            D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  815  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  874

Query  558  V  560
            +
Sbjct  875  L  875



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  998   LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1057

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1058  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1115

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1116  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1175

Query  558   V  560
             +
Sbjct  1176  L  1176



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1090  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1149

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1150  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1207

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1208  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1267

Query  558   V  560
             +
Sbjct  1268  L  1268



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1055  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1114

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1115  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1172

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1173  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1232

Query  558   V  560
             +
Sbjct  1233  L  1233



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1061  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1120

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ ++V+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1121  KISMKAEEFIDVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1178

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1179  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1238

Query  558   V  560
             +
Sbjct  1239  L  1239



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  24    LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  200
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1059  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1118

Query  201   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  377
                + AE+ ++V+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1119  KISMKAEEFIDVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1176

Query  378   DYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             D+  T ++Y +YP  +P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1177  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1236

Query  558   V  560
             +
Sbjct  1237  L  1237



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +3

Query  12   QECVLTSGK--LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            +E +++SG+  +Y   +R ++ + +ADV EALIGAF+ST  E AALSF+ W+G+D+D   
Sbjct  432  KEELVSSGRTSMYVGRKRNIEVKKVADVVEALIGAFISTKDEKAALSFINWIGIDVDTKI  491

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFL  362
             P   +   + E +V+VK LES   L Y F+DP LLVEALTH S    G  + Y+RLEFL
Sbjct  492  MPYERHLSTHPENLVDVKFLESQ--LKYKFKDPYLLVEALTHSSCKRSGISTCYERLEFL  549

Query  363  GDAVLDYAVTRHFYDQY--PGLSPGCLTELRSESVNNACYALSSVKAGLHNYIL  518
            GDAVLD  +T HFY++Y     SP  LT +RS SVNN CYALS++KA LH +IL
Sbjct  550  GDAVLDNVMTMHFYEEYYNEKCSPEFLTTMRSISVNNECYALSAIKAELHKHIL  603



>gb|AGT63299.1| ribonuclease III, partial [Nicotiana tabacum]
Length=144

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             D+E ++ S K+YSRGR+KM ++ +ADV EALIGAFLS+ GE+AALSF++WLG+ IDF+D
Sbjct  34   FDEEVLMPSVKMYSRGRQKMKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIGIDFVD  93

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI  323
            AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY+
Sbjct  94   APSPRHFPMNAEKLVNVRYLE--SLLHYKFHDPSLLVEALTHGSYM  137



>gb|AFW68291.1| hypothetical protein ZEAMMB73_565304 [Zea mays]
Length=462

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  150  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  209

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  210  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  267

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  268  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  316



>ref|XP_008644683.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X8 
[Zea mays]
Length=479

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  167  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  226

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  227  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  284

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  285  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  333



>ref|XP_008644682.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X7 
[Zea mays]
Length=486

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  174  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  233

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  234  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  291

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  292  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  340



>ref|XP_008644681.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X6 
[Zea mays]
Length=639

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  439  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  498

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  499  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  556

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  557  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  605



>ref|XP_008644678.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Zea mays]
Length=717

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  405  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  464

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  465  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  522

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  523  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  571



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  370  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  429

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  430  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  487

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  488  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  536



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  439  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  498

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  499  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  556

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  557  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  605



>ref|XP_008644680.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X5 
[Zea mays]
Length=674

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 112/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  39   LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLN  215
            +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +       
Sbjct  365  MYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTITTK  424

Query  216  AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVT  392
            +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY +T
Sbjct  425  SEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDYILT  482

Query  393  RHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  483  YYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  528



>ref|XP_008644677.1| PREDICTED: uncharacterized protein LOC103626078 isoform X2 [Zea 
mays]
Length=737

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +3

Query  30   SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNF  206
            +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  425  TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  484

Query  207  PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  383
               +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  485  TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  542

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
             +T +FY +YP  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  543  ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  591



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  429  LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  488

Query  186  APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  353
             P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  489  MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  546

Query  354  EFLGDAVLDYAVTRHFYDQYPG--LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  527
            EFLGDAVLDY +T HFY +Y     S    T +RS SVNN CYALS++KA L  +IL  S
Sbjct  547  EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  606

Query  528  TALRSSIA  551
              ++++IA
Sbjct  607  -VVKNNIA  613



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  429  LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  488

Query  186  APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  353
             P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  489  MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  546

Query  354  EFLGDAVLDYAVTRHFYDQYPG--LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  527
            EFLGDAVLDY +T HFY +Y     S    T +RS SVNN CYALS++KA L  +IL  S
Sbjct  547  EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  606

Query  528  TALRSSIA  551
              ++++IA
Sbjct  607  -VVKNNIA  613



>ref|XP_004982512.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Setaria italica]
Length=654

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 114/172 (66%), Gaps = 5/172 (3%)
 Frame = +3

Query  21   VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIV  197
            +L +  +YS     M ++ IAD  EALIGA+LS +GE AA  F++ LG+ ++   +    
Sbjct  441  LLPTNNMYSLKAISMKSKRIADTVEALIGAYLSASGEQAAFHFIKSLGMGVELHSEMQEE  500

Query  198  GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL  377
                  +E++++V+ LE+  +L+Y F D SLL+EALTH SY   G   Y+RLEFLGDAVL
Sbjct  501  RKIITKSEEIIDVRSLET--MLDYVFNDRSLLIEALTHSSYNIAGP-CYERLEFLGDAVL  557

Query  378  DYAVTRHFYD-QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
            D+ +T +FY   YPG +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  558  DHIITDYFYKLYYPGCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  609



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
            L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  477  LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  536

Query  186  APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  353
             P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  537  MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  594

Query  354  EFLGDAVLDYAVTRHFYDQYPG--LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  527
            EFLGDAVLDY +T HFY +Y     S    T +RS SVNN CYALS++KA L  +IL  S
Sbjct  595  EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  654

Query  528  TALRSSIA  551
              ++++IA
Sbjct  655  -VVKNNIA  661



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 114/172 (66%), Gaps = 5/172 (3%)
 Frame = +3

Query  21   VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIV  197
            +L +  +YS     M ++ IAD  EALIGA+LS +GE AA  F++ LG+ ++   +    
Sbjct  405  LLPTNNMYSLKAISMKSKRIADTVEALIGAYLSASGEQAAFHFIKSLGMGVELHSEMQEE  464

Query  198  GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL  377
                  +E++++V+ LE+  +L+Y F D SLL+EALTH SY   G   Y+RLEFLGDAVL
Sbjct  465  RKIITKSEEIIDVRSLET--MLDYVFNDRSLLIEALTHSSYNIAGP-CYERLEFLGDAVL  521

Query  378  DYAVTRHFYD-QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
            D+ +T +FY   YPG +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  522  DHIITDYFYKLYYPGCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  573



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 114/172 (66%), Gaps = 5/172 (3%)
 Frame = +3

Query  21   VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIV  197
            +L +  +YS     M ++ IAD  EALIGA+LS +GE AA  F++ LG+ ++   +    
Sbjct  441  LLPTNNMYSLKAISMKSKRIADTVEALIGAYLSASGEQAAFHFIKSLGMGVELHSEMQEE  500

Query  198  GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL  377
                  +E++++V+ LE+  +L+Y F D SLL+EALTH SY   G   Y+RLEFLGDAVL
Sbjct  501  RKIITKSEEIIDVRSLET--MLDYVFNDRSLLIEALTHSSYNIAGP-CYERLEFLGDAVL  557

Query  378  DYAVTRHFYD-QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
            D+ +T +FY   YPG +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  558  DHIITDYFYKLYYPGCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS  609



>ref|XP_002464289.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
 gb|EER91287.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
Length=462

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 112/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  27   TSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF  206
            T+  +YS     + ++ IAD  EAL GA+LS  GE+AA+ F++ LG+D++      V   
Sbjct  149  TTNDMYSLDEIPIKSKRIADTVEALTGAYLSACGELAAVHFIKSLGMDVELHSKMQVERI  208

Query  207  -PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLD  380
                +E+ ++V+ L++  ++ Y F D SLL+EALTH SY   G T   +RLEFLGDAVLD
Sbjct  209  VSTKSEEFIDVESLQT--IIGYVFDDSSLLIEALTHSSYNTAGITTCNERLEFLGDAVLD  266

Query  381  YAVTRHFYDQY-PGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  530
            Y +T +FY +Y P  +P  LT LR  SVNN CYA ++VKAGLH +ILHSS+
Sbjct  267  YILTDYFYRKYYPKCTPALLTNLRKASVNNWCYAHAAVKAGLHKHILHSSS  317



>gb|AJA90756.1| Dicer-like 3 [Cycas revoluta]
Length=1876

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = +3

Query  21    VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDA  188
             V+  GK   +G R M ++TI+D  EALI A L   G IAAL  ++W+ +D++F    ++A
Sbjct  1207  VVKIGKACGKGHRWMCSKTISDAVEALIAAHLVGGGPIAALELMKWMNMDVEFEPDLVEA  1266

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLG  365
                  F      + +   L  +SLL YTF++  LLVEA+TH S   P G   YQRLEFLG
Sbjct  1267  AFQRAFVYPC-VLRSTNLLGLESLLGYTFQNKGLLVEAITHASQQDPEGGCCYQRLEFLG  1325

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLD  +TRH +  +PGL+PG LT+LRS +VNN  +A  +VK  +  Y+ H S AL + 
Sbjct  1326  DSVLDLLITRHLFSMHPGLTPGVLTDLRSAAVNNENFARVAVKQNIQKYLRHGSGALLTQ  1385

Query  546   IADFV  560
             I +FV
Sbjct  1386  ITEFV  1390



>gb|ADT80932.1| dicer-like protein [Nicotiana attenuata]
Length=111

 Score =   135 bits (340),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +3

Query  6    LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  185
             D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  14   FDEELLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGVDIDFVD  73

Query  186  APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEAL  305
            AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEAL
Sbjct  74   APTPRHFPMNAEKLVNVRYLE--SLLDYKFHDPSLLVEAL  111



>ref|XP_002961233.1| hypothetical protein SELMODRAFT_74321, partial [Selaginella moellendorffii]
 gb|EFJ38772.1| hypothetical protein SELMODRAFT_74321, partial [Selaginella moellendorffii]
Length=1291

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 5/180 (3%)
 Frame = +3

Query  33    GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN---  203
             GK   +G R M ++T +D  EALIGA+    G   AL F++ L +D+DF    I  +   
Sbjct  971   GKTCGQGHRWMCSKTTSDALEALIGAYAVGGGFDGALEFMKALQVDVDFDSGLIAASQHR  1030

Query  204   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD  380
               PL+A Q      L  +  L YTF++ +LL+EA+TH S  P     YQRLEF+GDAVLD
Sbjct  1031  PVPLDAVQFHMPALLSLEKELCYTFQNKALLLEAITHAS-TPDTVFCYQRLEFIGDAVLD  1089

Query  381   YAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             + VTRH +  +PGLSPG L++LRS SVNN C A  +VK  LH+Y+ H S  LR+ I  F+
Sbjct  1090  FLVTRHLFTSHPGLSPGLLSDLRSASVNNDCLARVAVKHRLHSYLRHGSAELRAKITSFL  1149



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 116/182 (64%), Gaps = 32/182 (18%)
 Frame = +3

Query  12    QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  188
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL            
Sbjct  1071  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLN-----------  1119

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  365
                              R+ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1120  -----------------RIES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1160

Query  366   DAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  545
             D+VLDYA+T H Y++YPG++P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1161  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1220

Query  546   IA  551
             I+
Sbjct  1221  IS  1222



>ref|XP_002969464.1| hypothetical protein SELMODRAFT_91347, partial [Selaginella moellendorffii]
 gb|EFJ29552.1| hypothetical protein SELMODRAFT_91347, partial [Selaginella moellendorffii]
Length=1255

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 5/180 (3%)
 Frame = +3

Query  33    GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN---  203
             GK   +G R M ++T +D  EALIGA+    G   AL F++ L +D+DF    I  +   
Sbjct  935   GKTCGQGHRWMCSKTTSDALEALIGAYTVGGGFDGALEFMKALQVDVDFDSGLIAASQHR  994

Query  204   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD  380
               PL+A Q      L  +  L YTF++ +LL+EA+TH S  P     YQRLEF+GDAVLD
Sbjct  995   PVPLDAVQFHMPALLSLEKELCYTFQNKALLLEAITHAS-TPDTVFCYQRLEFIGDAVLD  1053

Query  381   YAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             + VTRH +  +PGLSPG L++LRS SVNN C A  +VK  LH+Y+ H S  LR+ I  F+
Sbjct  1054  FLVTRHLFTSHPGLSPGLLSDLRSASVNNDCLARVAVKHRLHSYLRHGSAELRAKINSFL  1113



>ref|XP_010047157.1| PREDICTED: dicer-like protein 4 isoform X2 [Eucalyptus grandis]
Length=1345

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFP-  209
             S+G   +  +TIADV EAL+GAF+  +G  AA +FLRW+GL++DF    + +  +G+   
Sbjct  1148  SKGHHWLQKKTIADVIEALVGAFIVDSGFKAATAFLRWIGLEVDFDARQVSSACIGSTRY  1207

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             L     V++  LE    L Y F    LL++A  H SY  HG   YQRLEFLGDA+LDY +
Sbjct  1208  LTLADCVDIDSLED--YLKYKFHHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAILDYLI  1265

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             T + Y  YP L PG LT+LRS +VNN  +A  +V+   H ++L  S++L  +I DFV
Sbjct  1266  TSYLYSAYPKLKPGELTDLRSLAVNNKAFANVAVERSFHKFLLCDSSSLSEAIKDFV  1322


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +3

Query  282   PSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESV  461
             P+ ++EALT          S +RLE LGDA L +AV RH + ++  L  G LT  RS++V
Sbjct  1024  PNRILEALTTEKC--QERFSLERLEILGDAFLKFAVGRHLFLRHEALDEGGLTRKRSKAV  1081

Query  462   NNACYALSSVKAGLHNYI  515
             NN+     +VK+ L  YI
Sbjct  1082  NNSNLFNLAVKSNLQVYI  1099



>gb|ABR17101.1| unknown [Picea sitchensis]
Length=685

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = +3

Query  72   ETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRL--  245
            +TIADV EALIGA+L  +G  AAL+FL+W+G++IDF D  +VG   + +   +++ +   
Sbjct  163  KTIADVVEALIGAYLVDSGFGAALAFLKWIGIEIDF-DTSLVGEVCIRSRNNLSLIKCID  221

Query  246  --ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPG  419
              E + LL Y F    LL+EA  H S+  H    YQRLEFLGDAVLDY +T + Y  YP 
Sbjct  222  IDELERLLGYNFSYKGLLLEAFAHPSFNEHNGGCYQRLEFLGDAVLDYIITSYLYSVYPD  281

Query  420  LSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
            + PG LT++RS +VNN  +A  +V+ GL+ Y++  S +L S++  +V
Sbjct  282  MKPGYLTDMRSMTVNNESFACVAVRHGLYMYLIQKSDSLSSAVTKYV  328



>ref|XP_010047156.1| PREDICTED: dicer-like protein 4 isoform X1 [Eucalyptus grandis]
 gb|KCW78979.1| hypothetical protein EUGRSUZ_C00406 [Eucalyptus grandis]
Length=1658

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFP-  209
             S+G   +  +TIADV EAL+GAF+  +G  AA +FLRW+GL++DF    + +  +G+   
Sbjct  1148  SKGHHWLQKKTIADVIEALVGAFIVDSGFKAATAFLRWIGLEVDFDARQVSSACIGSTRY  1207

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             L     V++  LE    L Y F    LL++A  H SY  HG   YQRLEFLGDA+LDY +
Sbjct  1208  LTLADCVDIDSLED--YLKYKFHHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAILDYLI  1265

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             T + Y  YP L PG LT+LRS +VNN  +A  +V+   H ++L  S++L  +I DFV
Sbjct  1266  TSYLYSAYPKLKPGELTDLRSLAVNNKAFANVAVERSFHKFLLCDSSSLSEAIKDFV  1322


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +3

Query  282   PSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESV  461
             P+ ++EALT          S +RLE LGDA L +AV RH + ++  L  G LT  RS++V
Sbjct  1024  PNRILEALTTEKC--QERFSLERLEILGDAFLKFAVGRHLFLRHEALDEGGLTRKRSKAV  1081

Query  462   NNACYALSSVKAGLHNYI  515
             NN+     +VK+ L  YI
Sbjct  1082  NNSNLFNLAVKSNLQVYI  1099



>gb|AFD22621.1| dicer-like 4 protein [Nicotiana attenuata]
Length=1622

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+  + +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF ++ +          
Sbjct  1127  SKCHQWLRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIYTDFEESQVKSICAASKVF  1186

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL  E  ++++ +E+  LL YTF    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1187  MPLADE--IDIQAIEN--LLGYTFVHKGLLIQAFIHPSYNNHGGGCYQRLEFLGDAVLDY  1242

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V    H++IL  S+ LR SI  +V
Sbjct  1243  LITSYLYSVYPKLKPGQLTDLRSVSVNNTTFAVVAVHQSFHSHILCDSSGLRESITRYV  1301



>ref|XP_008352221.1| PREDICTED: dicer-like protein 4 [Malus domestica]
Length=549

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = +3

Query  45   SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGN--  203
            S+G   + N+TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  54   SKGHHWLYNKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  113

Query  204  FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
             PL+A   +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  114  IPLSA--CMDIAALENS--LGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  169

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S +L  +I  +V
Sbjct  170  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSCSLSEAIESYV  228



>ref|XP_008337203.1| PREDICTED: dicer-like protein 4 [Malus domestica]
Length=549

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = +3

Query  45   SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGN--  203
            S+G   + N+TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  54   SKGHHWLYNKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  113

Query  204  FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
             PL+A   +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  114  IPLSA--CMDIAALENS--LGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  169

Query  384  AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S +L  +I  +V
Sbjct  170  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSCSLSEAIESYV  228



>ref|XP_010686530.1| PREDICTED: endoribonuclease Dicer homolog 1 [Beta vulgaris subsp. 
vulgaris]
Length=1972

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 107/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  221
             R + ++T+ADV EALIG      G++AA  F++W+G+DI+F    ID P    N P    
Sbjct  1569  RVLSSKTLADVVEALIGIHYVEGGKLAANHFMKWIGIDIEFNPEDIDRPKRPSNVPEGVL  1628

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + V+   LE    LN  FRD + L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1629  RSVDFDTLEG--ALNIKFRDRTFLIEAITHASRPSSGVACYQRLEFVGDAVLDHLITRHL  1686

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             + +Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFV
Sbjct  1687  FFRYTDLPPGRLTDLRAAAVNNENFARVAVKHRLHVHLRHGSTALEKQIRDFV  1739


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKR--------LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G     A+++ ++ R        +E  +++NY     S ++EALT  S     T  Y
Sbjct  1387  PLPGELVRGAQRLPSIMRRVESMLLAIELKNIINYPV-PASKILEALTAASC--QETFCY  1443

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1444  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQKMVSNMVLYHHALEKGLQSYI  1500



>ref|XP_009358497.1| PREDICTED: dicer-like protein 4 [Pyrus x bretschneideri]
Length=1624

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 111/179 (62%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGN--  203
             S+G   +  +TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  1128  SKGHHWLYKKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  1187

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL+A   +N+  LE+  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1188  IPLSA--CMNIAALEN--LLGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  1243

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S++L  +I  +V
Sbjct  1244  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSSSLSEAIESYV  1302



>ref|XP_006343692.1| PREDICTED: dicer-like protein 4-like isoform X3 [Solanum tuberosum]
Length=1342

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+    +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +          
Sbjct  1126  SKCHHWLRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVF  1185

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL AE    +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1186  MPLAAE----IDVLGIEHLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDY  1241

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1242  LITSYLYSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1300


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1007  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1064

Query  471   CYALSSVKAGLHNYI  515
                + +++  L  YI
Sbjct  1065  NLYMVAIRNNLQAYI  1079



>ref|XP_009411416.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1558

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    GE+AA   ++W+G+ +D     I  P   N P +  +
Sbjct  1153  RVLSSKTLADVVEALIGVYYVEGGEVAANHLMKWIGIQVDIDPRDIPCPKPYNIPESIMR  1212

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE    LN  FRD  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1213  SVDFDALEG--ALNVKFRDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1270

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1271  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1322



>ref|XP_006343690.1| PREDICTED: dicer-like protein 4-like isoform X1 [Solanum tuberosum]
Length=1622

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+    +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +          
Sbjct  1126  SKCHHWLRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVF  1185

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL AE    +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1186  MPLAAE----IDVLGIEHLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDY  1241

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1242  LITSYLYSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1300


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1007  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1064

Query  471   CYALSSVKAGLHNYI  515
                + +++  L  YI
Sbjct  1065  NLYMVAIRNNLQAYI  1079



>ref|XP_006343691.1| PREDICTED: dicer-like protein 4-like isoform X2 [Solanum tuberosum]
Length=1621

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+    +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +          
Sbjct  1125  SKCHHWLRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVF  1184

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL AE    +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1185  MPLAAE----IDVLGIEHLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDY  1240

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1241  LITSYLYSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1299


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1006  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1063

Query  471   CYALSSVKAGLHNYI  515
                + +++  L  YI
Sbjct  1064  NLYMVAIRNNLQAYI  1078



>ref|XP_009411415.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1926

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    GE+AA   ++W+G+ +D     I  P   N P +  +
Sbjct  1521  RVLSSKTLADVVEALIGVYYVEGGEVAANHLMKWIGIQVDIDPRDIPCPKPYNIPESIMR  1580

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE    LN  FRD  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1581  SVDFDALEG--ALNVKFRDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1638

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1639  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1690



>ref|XP_010520559.1| PREDICTED: LOW QUALITY PROTEIN: dicer-like protein 4 [Tarenaya 
hassleriana]
Length=1667

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EALIGAF+  +G   A +FLRW+G+D+ F      DA I  N  
Sbjct  1158  SKGHHWLHKKTIADVVEALIGAFIVDSGFKGATAFLRWIGIDVGFEPSKVRDACIGSNIY  1217

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +     +++  LE   +L Y F +  LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1218  MPLTSHIDLAALED--ILGYKFFNKGLLLQAFVHPSYNRHGGGCYQRLEFLGDAVLDYLI  1275

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  YP L PG LT+LRS SVNN  +A  ++   L  ++L  S  LR +I D+
Sbjct  1276  TSYFFTVYPNLKPGQLTDLRSLSVNNKAFANVAISLSLDRFLLCDSVFLREAIKDY  1331



>emb|CDP10524.1| unnamed protein product [Coffea canephora]
Length=1655

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 103/169 (61%), Gaps = 7/169 (4%)
 Frame = +3

Query  69    NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP-----LNAEQMVN  233
              +TIADV EALIGAFL  +G   A +FL+W+G+ IDF ++ ++  F      L     +N
Sbjct  1166  KKTIADVVEALIGAFLVDSGFGGATAFLKWIGIQIDFEESQLLKIFNESKNFLPLANQIN  1225

Query  234   VKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQY  413
             +  LE+  LL Y FR   LL++A  H SY  H    YQRLEFLGDA+LDY +T + Y  Y
Sbjct  1226  ITALEN--LLGYKFRHKGLLIQAFVHPSYNNHLGGCYQRLEFLGDAMLDYLITSYLYSVY  1283

Query  414   PGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             P L PG LT+LRS SVNN  +A  ++    H +I+  S+AL  S+  +V
Sbjct  1284  PKLKPGQLTDLRSASVNNTSFADIAIHCSFHEFIICDSSALSKSMEQYV  1332



>dbj|BAD94606.1| CAF protein [Arabidopsis thaliana]
Length=690

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57   RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  221
            R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  276  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  335

Query  222  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
            + ++  RLE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  336  KSIDFVRLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  393

Query  402  YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
            +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FV
Sbjct  394  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFV  446


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
            P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct  99   PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE  156

Query  348  RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
            R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  157  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  212



>ref|XP_010934025.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Elaeis 
guineensis]
Length=1933

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1526  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1585

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE+   LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1586  SVDFDALEA--ALNIQFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1643

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1644  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1695



>ref|XP_010934026.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Elaeis 
guineensis]
Length=1847

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1440  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1499

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE+   LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1500  SVDFDALEA--ALNIQFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1557

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1558  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1609



>ref|XP_010323152.1| PREDICTED: dicer-like protein 4 isoform X2 [Solanum lycopersicum]
Length=1610

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 105/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------NFPLNAE  221
             +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +           PL  E
Sbjct  1120  LRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVFMPLADE  1179

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
                 +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY +T + 
Sbjct  1180  ----IDVLGIERLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLITSYL  1235

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1236  YSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1288


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  995   VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1052

Query  471   CYALSSVKAGLHNYI  515
                + ++K  L  YI
Sbjct  1053  NLYMVAIKKNLQAYI  1067



>ref|XP_010323153.1| PREDICTED: dicer-like protein 4 isoform X3 [Solanum lycopersicum]
Length=1588

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 105/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------NFPLNAE  221
             +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +           PL  E
Sbjct  1098  LRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVFMPLADE  1157

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
                 +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY +T + 
Sbjct  1158  ----IDVLGIERLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLITSYL  1213

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1214  YSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1266


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  973   VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1030

Query  471   CYALSSVKAGLHNYI  515
                + ++K  L  YI
Sbjct  1031  NLYMVAIKKNLQAYI  1045



>ref|XP_010323151.1| PREDICTED: dicer-like protein 4 isoform X1 [Solanum lycopersicum]
Length=1621

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 105/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------NFPLNAE  221
             +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +           PL  E
Sbjct  1131  LRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVFMPLADE  1190

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
                 +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY +T + 
Sbjct  1191  ----IDVLGIERLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLITSYL  1246

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1247  YSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1299


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1006  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1063

Query  471   CYALSSVKAGLHNYI  515
                + ++K  L  YI
Sbjct  1064  NLYMVAIKKNLQAYI  1078



>ref|NP_001266210.1| dicer-like protein 4 [Solanum lycopersicum]
 gb|AFO53518.1| dicer-like protein 4 [Solanum lycopersicum]
Length=1620

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 105/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------NFPLNAE  221
             +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +           PL  E
Sbjct  1130  LRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVFMPLADE  1189

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
                 +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY +T + 
Sbjct  1190  ----IDVLGIERLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLITSYL  1245

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V
Sbjct  1246  YSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYV  1298


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  291   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNA  470
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1005  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1062

Query  471   CYALSSVKAGLHNYI  515
                + ++K  L  YI
Sbjct  1063  NLYMVAIKKNLQAYI  1077



>gb|AJA90772.1| Dicer-like 3 [Ginkgo biloba]
Length=1815

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 108/184 (59%), Gaps = 4/184 (2%)
 Frame = +3

Query  21    VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG  200
             V+  GK   +G R M ++T+AD  EALIGA+L   G  AA  F+ W+ +++    A + G
Sbjct  1221  VVKIGKTCDKGHRWMCSKTVADSVEALIGAYLVGGGLTAAFKFMSWMNIEVALEPALVEG  1280

Query  201   NFP---LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGD  368
              F    ++A  + N      +S L YTF + +LLVEA+TH S     G   YQRLEFLGD
Sbjct  1281  AFKHASVHAHVLRNTNLHALESQLGYTFHNKALLVEAITHASQQDSEGGCCYQRLEFLGD  1340

Query  369   AVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  548
             +VLD+ +TRH +  +  LSPG LT+LRS +VNN  +A  +VK  L  Y+ H S AL   I
Sbjct  1341  SVLDFLITRHLFSAHTDLSPGVLTDLRSAAVNNENFAQVAVKHNLQQYLRHGSGALLGQI  1400

Query  549   ADFV  560
               F+
Sbjct  1401  TAFI  1404



>ref|XP_006289431.1| hypothetical protein CARUB_v10002936mg [Capsella rubella]
 gb|EOA22329.1| hypothetical protein CARUB_v10002936mg [Capsella rubella]
Length=1700

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 105/176 (60%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI-----DAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FLRW+G+++DF+     DA +     
Sbjct  1221  SKGHHFLYKKTIADVVEALVGAFLVDSGFKGAVKFLRWIGINVDFVSSQVQDACVASRRY  1280

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      N++ LE+   LNYTF    LLV+A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1281  MPLTTRNNLEALENQ--LNYTFLHKGLLVQAFIHPSYNKHGGGCYQRLEFLGDAVLDYLM  1338

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   S  L  +I D+
Sbjct  1339  TSYFFTVFPTLKPGQLTDLRSLSVNNKALANVAVNFSLKRFLFCESIYLHEAINDY  1394



>ref|XP_002991516.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
 gb|EFJ07438.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
Length=1719

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +3

Query  51    GRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNA  218
             G R +  + +ADV EALIGA+L+T+G  +A+  ++ LG+DI+F    + +    + P  +
Sbjct  1394  GHRGIRRKALADVVEALIGAYLATSGPPSAMELMKQLGIDIEFDIGLLASARQASLPAES  1453

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              Q +       +  L Y F++ SLLVEA+TH S  P+    YQRLEFLGD VLD+ V+RH
Sbjct  1454  FQHLQASLESLEHKLQYKFQNRSLLVEAITHASQ-PNCLLCYQRLEFLGDGVLDFLVSRH  1512

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              ++ +PGL PG LT+LRS +VNN  +A   ++ GLH ++ H S  L   I  FV
Sbjct  1513  LFETHPGLPPGTLTDLRSAAVNNKWFARLVLRHGLHQHLQHGSVELDCEIRKFV  1566



>ref|XP_010932228.1| PREDICTED: endoribonuclease Dicer homolog 4 [Elaeis guineensis]
Length=1628

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 105/176 (60%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQ  224
             ++    +  +TIADV EALIGAFL  +G  AA++FLRW+G+ +DF  + +     L+   
Sbjct  1115  TKSHHWLHKKTIADVVEALIGAFLVESGFKAAIAFLRWIGIQVDFEVSDVYRACELSKSN  1174

Query  225   M-----VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             M      NV  LE   LL  TFR   LL++AL H SY  H    YQ+LEFLGDAVL+Y +
Sbjct  1175  MSLIDGTNVAELEQ--LLCRTFRYKGLLMQALVHPSYNKHSGGCYQKLEFLGDAVLEYLI  1232

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T + Y  YP L PG +T+LRS +VNN  +A  +V   LH Y++  S +L  ++  F
Sbjct  1233  TSYLYSAYPDLKPGQITDLRSITVNNNSFAHVAVWRSLHKYLIKDSNSLTEAVNKF  1288



>gb|KEH32166.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1625

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV-------GNFPLNAE  221
             +  +TI+DV EAL+GAF+  +G  AA++FL W+G+ ++F  + +V       G FPL++E
Sbjct  1139  LHRKTISDVVEALVGAFIVDSGFKAAIAFLTWIGMQVNFEASQVVNICTGSVGYFPLSSE  1198

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
               V++  LE    L + F    LL++A  H SY  HG   YQRLEFLGDAVLDY +T + 
Sbjct  1199  --VDIPSLEGK--LGHHFVHKGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDYLITSYL  1254

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             Y  YP L PG LT+LRS SVNN  +A  +V    H ++L  S+AL  +I  +
Sbjct  1255  YSAYPKLKPGQLTDLRSLSVNNKAFACVAVDRCFHEFLLCDSSALTGAIKKY  1306



>gb|AIO05700.1| putative endoribonuclease dicer-like protein 1, partial [Cocos 
nucifera]
Length=1720

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1313  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELSCPKPHNIPESIMR  1372

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE+   L+  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1373  SVDFDALEA--ALSIKFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1430

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1431  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1482


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
             P+ G     A+++ ++ R     LL    +D      PS  ++EALT  S     T  Y+
Sbjct  1131  PLPGTLVRGAQRLPSIMRRVESMLLAVQLKDMINYPVPSARILEALTAASC--QETFCYE  1188

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L  YI
Sbjct  1189  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKRLQFYI  1244



>ref|XP_009794783.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana sylvestris]
Length=1178

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  57   RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  221
            R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  777  RVLSSKTMADVVEALIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  836

Query  222  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
            + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  837  RSVDFDKLQG--ALNISFNDKGLLLEAMTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  894

Query  402  YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
            +  Y  L PG LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DFV
Sbjct  895  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFV  947


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = +3

Query  189  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
            P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  595  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  652

Query  348  RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
            R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  653  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQLVSNMVLYQYALNKGLQSYI  708



>gb|AFD22618.1| dicer-like 1 protein, partial [Nicotiana attenuata]
Length=1690

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  1287  RVLSSKTMADVVEALIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  1346

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1347  RSVDFDKLQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1404

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DFV
Sbjct  1405  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFV  1457


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  1105  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  1162

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1163  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1218



>gb|KFK42493.1| hypothetical protein AALP_AA1G000600 [Arabis alpina]
Length=1791

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 105/174 (60%), Gaps = 8/174 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  218
             R + ++T+ADV EALIG +    G+IAA   ++W+G+D++  D   +       N P + 
Sbjct  1376  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIDVEEDDPEEIEGTVKPANVPESV  1435

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              + ++   LE    L + F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1436  LKSIDFVGLEK--ALKFEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRH  1493

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFV
Sbjct  1494  LFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHFYLRHGSSALEKQIRDFV  1547


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        SL++Y     S ++EALT  S     T  Y
Sbjct  1199  PLSGSLVRGAQRLPSIMRRVESMLLAVQLKSLISYPI-PTSKILEALTAASC--QETFCY  1255

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1256  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1312



>gb|KDP28399.1| hypothetical protein JCGZ_14170 [Jatropha curcas]
Length=1986

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ +DF    ID+ I   N P +  
Sbjct  1583  RVLSSKTLADVVEALIGVYYVEDGKNAANHLMKWIGIQVDFDREEIDSAIRPSNVPESVL  1642

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1643  RSIDFDTLEG--ALNIMFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1700

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1701  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFV  1753


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1401  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKDIINYPVPASKILEALTAASC--QETFCYE  1458

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1459  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1514



>ref|XP_002448150.1| hypothetical protein SORBIDRAFT_06g022180 [Sorghum bicolor]
 gb|EES12478.1| hypothetical protein SORBIDRAFT_06g022180 [Sorghum bicolor]
Length=698

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 109/187 (58%), Gaps = 11/187 (6%)
 Frame = +3

Query  12   QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  191
            + C L   K +    RK    TIADV E+L+GAFL   G  AA +FLRW+G+ +DF ++ 
Sbjct  177  ENCNLRCTKSHHWLHRK----TIADVVESLLGAFLVECGFKAAFAFLRWIGIKVDFENSA  232

Query  192  I-----VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLE  356
            +       +  L+    +N+  LE   L+ YTF+   LL++A  H S+  H    YQR+E
Sbjct  233  LYRVLDASSTNLSLMNYMNISELEE--LIGYTFKHKGLLLQAFVHPSFNKHSGGCYQRME  290

Query  357  FLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTAL  536
            FLGDAVLDY +  + Y  YP L PG LT+L+S ++NN  +A  +VK  +H Y++  S +L
Sbjct  291  FLGDAVLDYLMASYLYSAYPDLKPGQLTDLKSLALNNNSFAYVAVKKSIHKYLIKDSKSL  350

Query  537  RSSIADF  557
             ++I  F
Sbjct  351  TAAINKF  357



>ref|XP_008776225.1| PREDICTED: endoribonuclease Dicer homolog 4, partial [Phoenix 
dactylifera]
Length=1243

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = +3

Query  45   SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQ  224
            ++    +  +TIADV EAL+GAFL  +G  AA++FLRW+G+ +DF  + +     L+   
Sbjct  772  TKSHHWLHRKTIADVVEALVGAFLVESGFKAAIAFLRWIGIQVDFEVSYVYRACELSKSN  831

Query  225  M-----VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
            M      NV +LE   LL +TF+   LL++A  H SY  H    YQ+LEFLGDAVL+Y +
Sbjct  832  MSLIDDTNVAKLEQ--LLGHTFQYKGLLMQAFVHPSYNKHSGGCYQKLEFLGDAVLEYLI  889

Query  390  TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
            T + Y  YP L PG +T+LRS +VNN  +A  +V   LH Y++  S +L  ++  F
Sbjct  890  TSYLYSAYPDLKPGQITDLRSITVNNNSFAHVAVWQSLHKYLIKDSNSLTEAVTKF  945



>ref|XP_002979043.1| hypothetical protein SELMODRAFT_444049 [Selaginella moellendorffii]
 gb|EFJ20000.1| hypothetical protein SELMODRAFT_444049 [Selaginella moellendorffii]
Length=1686

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +3

Query  51    GRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNA  218
             G R +  + +ADV EALIGA+L+T+G  +A+  ++ L +DI+F    + +    + P  +
Sbjct  1425  GHRGIRRKALADVVEALIGAYLATSGPPSAMELMKQLDIDIEFDIGLLASARQASLPAES  1484

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              Q +       +  L Y F++ SLLVEA+TH S  P+    YQRLEFLGD VLD+ V+RH
Sbjct  1485  FQHLQASLESLEHKLQYKFQNRSLLVEAITHASQ-PNCLLCYQRLEFLGDGVLDFLVSRH  1543

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              ++ +PGL PG LT+LRS +VNN  +A   V+ GLH ++ H S  L   I  FV
Sbjct  1544  LFETHPGLPPGTLTDLRSAAVNNKWFARLVVRHGLHQHLQHGSVELDCEIRKFV  1597



>emb|CDX92469.1| BnaA10g15080D [Brassica napus]
Length=1642

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 104/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FL+W+G+++DF      DA +     
Sbjct  1156  SKGHHWLHKKTIADVVEALVGAFLVDSGFKGAIEFLKWIGINVDFESLQVRDACVASKRF  1215

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      ++  LES  LL YTF    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1216  MPLTTCFDLAALES--LLGYTFLHKGLLLQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1273

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   ST L  +I D+
Sbjct  1274  TSYFFSVFPKLKPGQLTDLRSLSVNNKALANVAVSFSLQRFLFCDSTYLHDAIKDY  1329



>gb|EYU35897.1| hypothetical protein MIMGU_mgv1a000073mg [Erythranthe guttata]
Length=1905

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVN-  233
             R +  +T+ADV EALIG +    G+ AA   ++W+G+DI+F    I  N+ +    + + 
Sbjct  1501  RVLSGKTLADVVEALIGVYYVEGGKTAANHLMKWIGIDIEFDLKEI--NYSIRPSSVPDS  1558

Query  234   -VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
              ++ ++ D+L   LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H 
Sbjct  1559  VLRTIDFDALEGCLNVKFNDKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHL  1618

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  SVK  LH ++ H S+AL   I DFV
Sbjct  1619  FFTYTDLPPGRLTDLRAAAVNNENFARVSVKHNLHTHLRHGSSALEKQIRDFV  1671


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1319  PLPGSLVRGAQRLPSIMRRIESMLLAVQLKEIINYPV-PASKILEALTAASC--QETFCY  1375

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1376  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNVVLYQFALDKGLQSYI  1432



>ref|XP_007220573.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
 gb|EMJ21772.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
Length=1971

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 103/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G++++F        P     P N  
Sbjct  1568  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEVEFNPDGVESTPKSSTVPENVL  1627

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LE    LN  F+D  LLVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1628  RSVNFDALEG--ALNSKFKDRGLLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1685

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1686  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFV  1738


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    RD        S ++EALT  S     T  Y+
Sbjct  1389  PLPGSLVRGAQRLPSIMRRVESMLLAVELRDIINYPIPASKILEALTAASC--QETFCYE  1446

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1447  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1502



>ref|XP_011078684.1| PREDICTED: dicer-like protein 4 isoform X2 [Sesamum indicum]
Length=1639

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63    MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-------VGNFPLNAE  221
             + N+T+ADV EAL+GAF+  +G  AA +FL WLG+++DF+ + I           PL A+
Sbjct  1134  LHNKTVADVVEALVGAFIVDSGFKAATAFLNWLGIEVDFMRSEIDNICSASKAFLPL-AD  1192

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             QM +V  LE   LL Y F    LL++A  H S+  H    YQRLEFLGDAVLDY +T + 
Sbjct  1193  QM-DVNALED--LLGYKFAHKGLLIQAFVHPSFNNHLGGCYQRLEFLGDAVLDYLITSYL  1249

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             Y  YP L PG LT+LRS SVNN  +A  + +   H +I+  S+ LR ++  +V
Sbjct  1250  YSVYPNLKPGQLTDLRSVSVNNISFADVAGRWSFHKFIICDSSVLRETMTKYV  1302



>ref|XP_008783544.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Phoenix 
dactylifera]
Length=1932

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1527  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1586

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE+  ++   F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1587  SVDFDALEAALIIK--FKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1644

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1645  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1696



>ref|XP_011078683.1| PREDICTED: dicer-like protein 4 isoform X1 [Sesamum indicum]
Length=1329

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 11/173 (6%)
 Frame = +3

Query  63   MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-------VGNFPLNAE  221
            + N+T+ADV EAL+GAF+  +G  AA +FL WLG+++DF+ + I           PL A+
Sbjct  824  LHNKTVADVVEALVGAFIVDSGFKAATAFLNWLGIEVDFMRSEIDNICSASKAFLPL-AD  882

Query  222  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
            QM +V  LE   LL Y F    LL++A  H S+  H    YQRLEFLGDAVLDY +T + 
Sbjct  883  QM-DVNALED--LLGYKFAHKGLLIQAFVHPSFNNHLGGCYQRLEFLGDAVLDYLITSYL  939

Query  402  YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
            Y  YP L PG LT+LRS SVNN  +A  + +   H +I+  S+ LR ++  +V
Sbjct  940  YSVYPNLKPGQLTDLRSVSVNNISFADVAGRWSFHKFIICDSSVLRETMTKYV  992



>ref|XP_008783545.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Phoenix 
dactylifera]
Length=1840

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1527  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1586

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              V+   LE+  ++   F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1587  SVDFDALEAALIIK--FKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1644

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1645  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFV  1696



>ref|XP_009765936.1| PREDICTED: dicer-like protein 4 isoform X3 [Nicotiana sylvestris]
Length=1458

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 12/180 (7%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+  + +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF ++ +          
Sbjct  962   SKCHQWLRKKTIADIVEALVGAFIVDSGFKAAIAFLKWIGIYTDFEESQVKSICAASKVF  1021

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL  E  +++  +E+  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1022  MPLADE--IDIPAIEN--LLGYPFVHKGLLIQAFIHPSYNNHGGGCYQRLEFLGDAVLDY  1077

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHS-STALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V    H++IL   S+ LR SI  +V
Sbjct  1078  LITSYLYSVYPKLKPGQLTDLRSVSVNNNTFAVVAVHQSFHSHILCDYSSGLRESITRYV  1137



>ref|XP_009765934.1| PREDICTED: dicer-like protein 4 isoform X1 [Nicotiana sylvestris]
Length=1624

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 12/180 (7%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+  + +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF ++ +          
Sbjct  1128  SKCHQWLRKKTIADIVEALVGAFIVDSGFKAAIAFLKWIGIYTDFEESQVKSICAASKVF  1187

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL  E  +++  +E+  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1188  MPLADE--IDIPAIEN--LLGYPFVHKGLLIQAFIHPSYNNHGGGCYQRLEFLGDAVLDY  1243

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHS-STALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V    H++IL   S+ LR SI  +V
Sbjct  1244  LITSYLYSVYPKLKPGQLTDLRSVSVNNNTFAVVAVHQSFHSHILCDYSSGLRESITRYV  1303



>ref|XP_009765935.1| PREDICTED: dicer-like protein 4 isoform X2 [Nicotiana sylvestris]
Length=1623

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 12/180 (7%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+  + +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF ++ +          
Sbjct  1127  SKCHQWLRKKTIADIVEALVGAFIVDSGFKAAIAFLKWIGIYTDFEESQVKSICAASKVF  1186

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL  E  +++  +E+  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1187  MPLADE--IDIPAIEN--LLGYPFVHKGLLIQAFIHPSYNNHGGGCYQRLEFLGDAVLDY  1242

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHS-STALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V    H++IL   S+ LR SI  +V
Sbjct  1243  LITSYLYSVYPKLKPGQLTDLRSVSVNNNTFAVVAVHQSFHSHILCDYSSGLRESITRYV  1302



>ref|XP_002515097.1| dicer-1, putative [Ricinus communis]
 gb|EEF47081.1| dicer-1, putative [Ricinus communis]
Length=1543

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    ID+ I   N P +  
Sbjct  1140  RVLSSKTLADVVEALIGIYYVEGGKTAANHLMRWIGIKVEFDHEEIDSAIRPSNVPESIL  1199

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1200  RSIDFDALEG--ALNIKFQDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1257

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +V   LH ++ H S+AL   I DFV
Sbjct  1258  FFTYTNLPPGRLTDLRAAAVNNENFARVAVNHKLHVHLRHGSSALEKQIRDFV  1310


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  958   PLPGSLVRGAQRLPSIMRRVESMLLAIQLKDIIHYSVPALKILEALTAASC--QETFCYE  1015

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1016  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALIKGLQSYI  1071



>ref|XP_006650986.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Oryza brachyantha]
Length=1855

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD   I  P   N P +  +
Sbjct  1448  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPQDIPPPKPYNIPESIMK  1507

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              +N   LE   +L+  F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1508  SINFDTLEG--VLDIKFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1565

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FV
Sbjct  1566  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFV  1617


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct  1269  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKDIIDYPVPATKILEALTAASC--QETFCYE  1326

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L +YI
Sbjct  1327  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKTLQSYI  1382



>ref|XP_008243098.1| PREDICTED: dicer-like protein 4 [Prunus mume]
Length=1659

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 107/179 (60%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+G   +  +TIADV E+LIGAF+  +G  AA +FLRW+G+ +DF  + +          
Sbjct  1155  SKGHHWLYKKTIADVVESLIGAFVVDSGFKAATAFLRWIGIQVDFEPSQVTEVCIASTRY  1214

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL+A   +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1215  IPLSA--CMDIAALENS--LGYQFVHKGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  1270

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S++L  +I  +V
Sbjct  1271  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLICDSSSLSEAIKVYV  1329



>ref|XP_010535851.1| PREDICTED: LOW QUALITY PROTEIN: dicer-like protein 4 [Tarenaya 
hassleriana]
Length=1612

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNF-  206
             S+G   +  +TIADV EALIGAFL   G   A++FLRW+G+D+ F     IDA +     
Sbjct  1117  SKGHCILHKKTIADVVEALIGAFLVDTGFKGAIAFLRWIGIDVGFEPVQVIDACVKTKIF  1176

Query  207   -PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL+A+  +++  LE   LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1177  TPLSAD--IDLPALEG--LLGYKFFHKGLLLQAFVHPSYNRHGGGCYQRLEFLGDAVLDY  1232

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
              +T +++  YP L PG LT+LRS SVNN  +A  +V   L   +   +  LR +I D+
Sbjct  1233  LITSYYFTVYPNLKPGELTDLRSLSVNNKAFANVAVGLSLDRILFCDNDFLRRAIKDY  1290



>gb|EPS58332.1| hypothetical protein M569_16483, partial [Genlisea aurea]
Length=554

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 110/193 (57%), Gaps = 15/193 (8%)
 Frame = +3

Query  12   QECVLTSGKLYSRGR--RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF--  179
            +E  +  G+L S     R +  +T+ADV EALIG +    G+ AA   +RW+G++IDF  
Sbjct  187  EESEMEDGELESDSSSYRVLSGKTLADVVEALIGIYYVEGGKNAANHLMRWIGIEIDFDL  246

Query  180  ------IDAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS  341
                  I    V +  L +   V+ + LE    LN  F+D   L+EA+TH S    G   
Sbjct  247  DEIGPSIKPSCVPDIILRS---VDFEALEGS--LNARFKDRGFLIEAITHASRPSSGVSC  301

Query  342  YQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILH  521
            YQRLEF+GDAVLD+ +TRH +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H
Sbjct  302  YQRLEFVGDAVLDHLITRHLFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHAHLRH  361

Query  522  SSTALRSSIADFV  560
             S+AL   I DFV
Sbjct  362  GSSALDKQIRDFV  374


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +3

Query  189  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
            P+ G+    A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct  26   PLSGSLVRGAQRLPSIMRRIESMLLAVQLKDTINYPVPATKILEALTAASC--QETFCYE  83

Query  348  RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
            R E LGDA L + V++  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  84   RAELLGDAYLKWVVSKFLFLKYPQKHEGQLTRMRQQMVSNVVLYQYALQKGLQSYI  139



>ref|XP_010229289.1| PREDICTED: endoribonuclease Dicer homolog 1 [Brachypodium distachyon]
Length=1930

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  224
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD   I  P + N P +  +
Sbjct  1522  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPQEIPPPKIYNIPDSIMR  1581

Query  225   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
              +N   LES  ++   F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1582  SINFDTLES--IMGIKFQNKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1639

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FV
Sbjct  1640  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFV  1691



>ref|XP_009120817.1| PREDICTED: dicer-like protein 4 [Brassica rapa]
Length=1641

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FL+W+G+++DF      DA +     
Sbjct  1155  SKGHHWLHKKTIADVVEALVGAFLVDSGFKGAIEFLKWIGINVDFESLQVRDACVASKRY  1214

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      ++  LES  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1215  MPLTTCFDLAALES--LLGYKFLHKGLLLQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1272

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   ST L  +I D+
Sbjct  1273  TSYFFSVFPKLKPGQLTDLRSLSVNNKALANVAVSFSLQRFLFCDSTYLHDAIKDY  1328



>emb|CDY35811.1| BnaC09g37430D [Brassica napus]
Length=1641

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FL+W+G+++DF      DA +     
Sbjct  1155  SKGHHWLHKKTIADVVEALVGAFLVDSGFKGAIEFLKWIGINVDFESLQVRDACVASKRY  1214

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      ++  LES  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1215  MPLTTCFDLAALES--LLGYKFLHKGLLLQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1272

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   ST L  +I D+
Sbjct  1273  TSYFFSVFPKLKPGQLTDLRSLSVNNKALANVAVSFSLQRFLFCDSTYLHDAIKDY  1328



>ref|XP_010054144.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Eucalyptus 
grandis]
Length=1954

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA  F++W+G+ ++F +     A    N P +  
Sbjct  1554  RVLSSKTLADVVEALIGVYYVEGGKNAANHFMKWVGIRVEFDNDEKECAIRPSNVPESIL  1613

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LES   LN  F D   L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1614  RSVNFDALES--ALNLKFNDRGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1671

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1672  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFV  1724



>ref|XP_010054145.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Eucalyptus 
grandis]
Length=1930

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA  F++W+G+ ++F +     A    N P +  
Sbjct  1530  RVLSSKTLADVVEALIGVYYVEGGKNAANHFMKWVGIRVEFDNDEKECAIRPSNVPESIL  1589

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LES   LN  F D   L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1590  RSVNFDALES--ALNLKFNDRGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1647

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1648  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFV  1700


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1349  PLPGSLVRGAQRLPSIMRRVESILLAIQLKDVIDYSVPASKILEALTAASC--QETFCYE  1406

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V++  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1407  RAELLGDAYLKWVVSKFLFLRYPQKHEGQLTRMRQQMVSNMVLYEYALNKGLQSYI  1462



>ref|XP_010474688.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Camelina 
sativa]
Length=1908

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 104/171 (61%), Gaps = 3/171 (2%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  230
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1554

Query  231   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  407
              ++  +  +  LN+ F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALNFEFKEKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  408   QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFV
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFV  1665


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        +L++Y     S ++EALT  S     T  Y
Sbjct  1320  PLSGSLVRGAQRLPSIMRRVESILLAVQLKNLISYPI-PTSKILEALTAASC--QETFCY  1376

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1377  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1433



>gb|AAF03534.1|AF187317_1 CAF protein [Arabidopsis thaliana]
Length=1909

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  221
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1554

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1555  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1612

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FV
Sbjct  1613  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFV  1665


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct  1318  PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE  1375

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1376  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1431



>ref|NP_171612.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 sp|Q9SP32.2|DCL1_ARATH RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like 
protein 1; Short=AtDCL1; AltName: Full=Protein ABNORMAL 
SUSPENSOR 1; AltName: Full=Protein CARPEL FACTORY; AltName: 
Full=Protein SHORT INTEGUMENTS 1; AltName: Full=Protein 
SUSPENSOR 1 [Arabidopsis thaliana]
 gb|AAG38019.1|AF292940_1 short integuments 1 [Arabidopsis thaliana]
 gb|AAG38020.1|AF292941_1 short integuments 1 [Arabidopsis thaliana]
 gb|AEE27220.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1909

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  221
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1554

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1555  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1612

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FV
Sbjct  1613  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFV  1665


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct  1318  PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE  1375

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1376  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1431



>ref|NP_001184881.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 gb|AEE27221.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1910

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  221
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1496  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1555

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1556  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1613

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FV
Sbjct  1614  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFV  1666


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct  1319  PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE  1376

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1377  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1432



>ref|XP_010656556.1| PREDICTED: dicer-like protein 4 isoform X1 [Vitis vinifera]
Length=1633

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 105/177 (59%), Gaps = 7/177 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+    +  +TIADV EAL+GAF+  +G  AA  FL+W+G+ +DF     I+A I     
Sbjct  1130  SKCHHWLHKKTIADVVEALVGAFIVDSGFKAATVFLKWIGIQVDFEAFQVINACISSTSY  1189

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      +V  LE   LL + F    LL++A+ H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1190  MQLASSTDVPALEK--LLGHEFLHKGLLLQAIVHPSYNKHGGGCYQRLEFLGDAVLDYLI  1247

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             T + Y  YP L PG +T+LRS SVNN  +A  +V   LH +++  +++L  +I  +V
Sbjct  1248  TSYLYSVYPKLKPGQMTDLRSLSVNNKSFANVAVSRSLHEFLICDASSLSEAIKKYV  1304



>gb|AEZ02177.1| Dicer [Arabidopsis thaliana]
Length=1886

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  221
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1472  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1531

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1532  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1589

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FV
Sbjct  1590  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFV  1642


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        +L++Y     S ++EALT  S     T  Y
Sbjct  1295  PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPI-PTSKILEALTAASC--QETFCY  1351

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1352  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1408



>ref|XP_010474687.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Camelina 
sativa]
Length=1907

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 104/171 (61%), Gaps = 3/171 (2%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  230
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1494  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1553

Query  231   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  407
              ++  +  +  LN+ F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1554  KSIDFVGLERALNFEFKEKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1613

Query  408   QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFV
Sbjct  1614  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFV  1664


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        +L++Y     S ++EALT  S     T  Y
Sbjct  1319  PLSGSLVRGAQRLPSIMRRVESILLAVQLKNLISYPI-PTSKILEALTAASC--QETFCY  1375

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1376  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1432



>ref|XP_011083770.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X6 [Sesamum 
indicum]
Length=1572

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1340  LESQISEFV  1348


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1047  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1104

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1105  NSALHKLGTNCKLQEYI  1121



>ref|XP_002264486.2| PREDICTED: dicer-like protein 4 isoform X2 [Vitis vinifera]
Length=1622

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 105/177 (59%), Gaps = 7/177 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+    +  +TIADV EAL+GAF+  +G  AA  FL+W+G+ +DF     I+A I     
Sbjct  1130  SKCHHWLHKKTIADVVEALVGAFIVDSGFKAATVFLKWIGIQVDFEAFQVINACISSTSY  1189

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      +V  LE   LL + F    LL++A+ H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1190  MQLASSTDVPALEK--LLGHEFLHKGLLLQAIVHPSYNKHGGGCYQRLEFLGDAVLDYLI  1247

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             T + Y  YP L PG +T+LRS SVNN  +A  +V   LH +++  +++L  +I  +V
Sbjct  1248  TSYLYSVYPKLKPGQMTDLRSLSVNNKSFANVAVSRSLHEFLICDASSLSEAIKKYV  1304



>emb|CBI25610.3| unnamed protein product [Vitis vinifera]
Length=1623

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 105/177 (59%), Gaps = 7/177 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+    +  +TIADV EAL+GAF+  +G  AA  FL+W+G+ +DF     I+A I     
Sbjct  1131  SKCHHWLHKKTIADVVEALVGAFIVDSGFKAATVFLKWIGIQVDFEAFQVINACISSTSY  1190

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      +V  LE   LL + F    LL++A+ H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1191  MQLASSTDVPALEK--LLGHEFLHKGLLLQAIVHPSYNKHGGGCYQRLEFLGDAVLDYLI  1248

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             T + Y  YP L PG +T+LRS SVNN  +A  +V   LH +++  +++L  +I  +V
Sbjct  1249  TSYLYSVYPKLKPGQMTDLRSLSVNNKSFANVAVSRSLHEFLICDASSLSEAIKKYV  1305



>ref|XP_011083691.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X5 [Sesamum 
indicum]
Length=1586

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1340  LESQISEFV  1348


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1047  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1104

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1105  NSALHKLGTNCKLQEYI  1121



>ref|XP_011083544.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X3 [Sesamum 
indicum]
Length=1641

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1150  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1209

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1210  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1267

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1268  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1327

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1328  LESQISEFV  1336


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1035  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1092

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1093  NSALHKLGTNCKLQEYI  1109



>ref|XP_008244191.1| PREDICTED: endoribonuclease Dicer homolog 1 [Prunus mume]
Length=1953

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (59%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G++++F        P     P N  
Sbjct  1550  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEVEFNPDGVESTPKSSTVPENVL  1609

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LE    LN  F+D   LVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1610  RSVNFDALEV--ALNIKFKDRGFLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1667

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1668  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFV  1720


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1371  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDIINYPIPASKILEALTAASC--QETFCYE  1428

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1429  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1484



>ref|XP_011468880.1| PREDICTED: endoribonuclease Dicer homolog 1 [Fragaria vesca subsp. 
vesca]
Length=1932

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF--PLNAEQMV  230
             R + ++T+ADV EALIG +    G+ AA   ++W+G+D++F +A  + N   P N    V
Sbjct  1528  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWVGIDVEF-NADEIENTTRPCNVPDSV  1586

Query  231   NVKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
              ++ ++ D+L   LN  FRD  LLVEA++H S    G   YQRLEF+GDAVLD+ +T+H 
Sbjct  1587  -LRSIDFDALEGALNIKFRDKGLLVEAISHASRPSSGVACYQRLEFVGDAVLDHLITKHL  1645

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1646  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALERQIHDFV  1698


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ KR+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1349  PLSGSLVRGAQRLPSIMKRVESMLLAVELKEIINYPV-PASKILEALTAASC--QETFCY  1405

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1406  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQKVSNMVLYHHALERGLQSYI  1462



>ref|XP_011083472.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Sesamum 
indicum]
Length=1651

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1160  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1219

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1220  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1277

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1278  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1337

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1338  LESQISEFV  1346


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1045  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1102

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1103  NSALHKLGTNCKLQEYI  1119



>ref|XP_011083398.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Sesamum 
indicum]
Length=1653

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1340  LESQISEFV  1348


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1047  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1104

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1105  NSALHKLGTNCKLQEYI  1121



>ref|XP_010424192.1| PREDICTED: dicer-like protein 4 [Camelina sativa]
Length=1380

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   AL FLRW+G+++DF      D  I     
Sbjct  1075  SKGHHWLYKKTIADVVEALVGAFLVDSGFKGALKFLRWIGVNVDFESLQVRDTCIASRRY  1134

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      N++ LE+   L YTF    LLV+A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1135  MPLTTRNNLEALENQ--LEYTFLHKGLLVQAFIHPSYNKHGGGCYQRLEFLGDAVLDYLM  1192

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   S  L  +I D+
Sbjct  1193  TSYFFTVFPTLKPGQLTDLRSLSVNNKALANVAVNFSLKRFLFCESIYLHEAIDDY  1248


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 84/162 (52%), Gaps = 23/162 (14%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   AL FLRW+G+++DF      D  I     
Sbjct  883   SKGHHWLYKKTIADVVEALVGAFLVDSGFKGALKFLRWIGVNVDFESLQVRDTCIASRRY  942

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      N++ LE+   L YTF    LLV+A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  943   MPLTTRNNLEALENQ--LEYTFLHKGLLVQAFIHPSYNKHGGGCYQRLEFLGDAVLDYLM  1000

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             T                  RS  VNN+     ++K  L  YI
Sbjct  1001  TXR----------------RSNVVNNSNLCRLAIKRNLQVYI  1026



>ref|XP_007012010.1| Dicer-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29629.1| Dicer-like protein, putative isoform 1 [Theobroma cacao]
Length=1690

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQ  224
             SR    +  +TIADV EAL+GAF+   G  AA +FLRW+G+ +DF  + +      +   
Sbjct  1182  SRNHHWLHKKTIADVVEALVGAFIVDRGFKAATAFLRWIGIRVDFQHSQVNNVCAASKRF  1241

Query  225   MVNVKRLES---DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  395
             M    ++++   ++LL Y F    LL++A  H S+  HG   YQRLEFLGDAVLDY +T 
Sbjct  1242  MPLCSKVDTGALENLLGYQFLHKGLLLQAFVHPSHNKHGGGCYQRLEFLGDAVLDYLITS  1301

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             + +  YP L PG LT+LRS SVNN  +A  +V   LH +++  S  L  +I  +V
Sbjct  1302  YLFSVYPKLKPGQLTDLRSVSVNNKSFANVAVDRSLHKFLICDSCPLSEAIGKYV  1356



>ref|XP_007012011.1| Dicer-like protein isoform 2, partial [Theobroma cacao]
 gb|EOY29630.1| Dicer-like protein isoform 2, partial [Theobroma cacao]
Length=1614

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQ  224
             SR    +  +TIADV EAL+GAF+   G  AA +FLRW+G+ +DF  + +      +   
Sbjct  1146  SRNHHWLHKKTIADVVEALVGAFIVDRGFKAATAFLRWIGIRVDFQHSQVNNVCAASKRF  1205

Query  225   MVNVKRLES---DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  395
             M    ++++   ++LL Y F    LL++A  H S+  HG   YQRLEFLGDAVLDY +T 
Sbjct  1206  MPLCSKVDTGALENLLGYQFLHKGLLLQAFVHPSHNKHGGGCYQRLEFLGDAVLDYLITS  1265

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             + +  YP L PG LT+LRS SVNN  +A  +V   LH +++  S  L  +I  +V
Sbjct  1266  YLFSVYPKLKPGQLTDLRSVSVNNKSFANVAVDRSLHKFLICDSCPLSEAIGKYV  1320



>ref|XP_004155270.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
1-like [Cucumis sativus]
Length=1987

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 105/174 (60%), Gaps = 9/174 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  218
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1584  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1642

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1643  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1700

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1701  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFV  1754


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1402  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHMINYPV-PASKILEALTAASC--QETFCY  1458

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L +YI
Sbjct  1459  ERAELLGDAYLKWVVSRFLFLKYPRKHEGQLTRMRQQMVSNMVLYQYALSKKLQSYI  1515



>ref|XP_011083615.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X4 [Sesamum 
indicum]
Length=1616

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 8/189 (4%)
 Frame = +3

Query  12    QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  179
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1125  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1184

Query  180   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  353
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1185  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1242

Query  354   EFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  533
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1243  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1302

Query  534   LRSSIADFV  560
             L S I++FV
Sbjct  1303  LESQISEFV  1311


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  285   SLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVN  464
             SL++EALT  +   + T S +RLE LGD+VL YAV+ H + +YP    G L+  RS  V+
Sbjct  1010  SLILEALT--TLRCNETFSMERLELLGDSVLKYAVSCHLFLKYPKKHEGQLSSHRSRIVS  1067

Query  465   NACYALSSVKAGLHNYI  515
             N+          L  YI
Sbjct  1068  NSALHKLGTNCKLQEYI  1084



>ref|XP_004134274.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Cucumis sativus]
Length=1986

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 105/174 (60%), Gaps = 9/174 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  218
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1583  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1641

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1642  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1699

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1700  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFV  1753


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1401  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHMINYPV-PASKILEALTAASC--QETFCY  1457

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L +YI
Sbjct  1458  ERAELLGDAYLKWVVSRFLFLKYPRKHEGQLTRMRQQMVSNMVLYQYALSKKLQSYI  1514



>ref|XP_007204799.1| hypothetical protein PRUPE_ppa000144mg [Prunus persica]
 gb|EMJ05998.1| hypothetical protein PRUPE_ppa000144mg [Prunus persica]
Length=1639

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 106/179 (59%), Gaps = 11/179 (6%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  203
             S+G   +  +TIADV E+LIGAF+  +G  AA +FLRW+G+ +DF  + +          
Sbjct  1137  SKGHHWLYKKTIADVVESLIGAFVVDSGFKAATAFLRWIGIQVDFEPSQVTEVCIASTRY  1196

Query  204   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  383
              PL+A   +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1197  IPLSA--CMDIAALENS--LGYQFVHKGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  1252

Query  384   AVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S +L  +I  +V
Sbjct  1253  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLICDSGSLSEAIKVYV  1311



>ref|XP_010556639.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Tarenaya 
hassleriana]
Length=1945

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++     I G     N P +  
Sbjct  1538  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIHVEADPTEIEGTVKAANVPESVL  1597

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + V+   +E    LNY F +  LLVEALTH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1598  KSVDFIAIER--ALNYKFTEKGLLVEALTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1655

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF
Sbjct  1656  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDF  1707


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1358  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDLINFPIPSSKILEALTAASC--QETFCYE  1415

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1416  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMILYQYALEKGLQSYI  1471



>gb|KGN56328.1| hypothetical protein Csa_3G116650 [Cucumis sativus]
Length=1989

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 105/174 (60%), Gaps = 9/174 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  218
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1586  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1644

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1645  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1702

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1703  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFV  1756


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1404  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHMINYPV-PASKILEALTAASC--QETFCY  1460

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L +YI
Sbjct  1461  ERAELLGDAYLKWVVSRFLFLKYPRKHEGQLTRMRQQMVSNMVLYQYALSKKLQSYI  1517



>ref|XP_010556636.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556637.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556638.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
Length=1946

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++     I G     N P +  
Sbjct  1539  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIHVEADPTEIEGTVKAANVPESVL  1598

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + V+   +E    LNY F +  LLVEALTH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1599  KSVDFIAIER--ALNYKFTEKGLLVEALTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1656

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF
Sbjct  1657  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDF  1708


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1359  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDLINFPIPSSKILEALTAASC--QETFCYE  1416

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1417  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMILYQYALEKGLQSYI  1472



>ref|XP_008437750.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis melo]
Length=1990

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 105/174 (60%), Gaps = 9/174 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  218
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1587  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1645

Query  219   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  398
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1646  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1703

Query  399   FYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1704  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFV  1757


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 17/120 (14%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1405  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHMINYPV-PASKILEALTAASC--QETFCY  1461

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNAC---YALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N     YALS     L +YI
Sbjct  1462  ERAELLGDAYLKWVVSRFLFLKYPRKHEGQLTRMRQQMVSNMVLYQYALSKT---LQSYI  1518



>ref|XP_009606996.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana tomentosiformis]
Length=1907

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 107/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  221
             R + ++T+ADV E+LIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  1506  RVLSSKTMADVVESLIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  1565

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1566  RSVDFDKLQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1623

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1624  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHSLHLHLRHGSSALEKQIRDFV  1676


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  1324  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  1381

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1382  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQLVSNMVLYQYALNKGLQSYI  1437



>gb|KHG02896.1| Endoribonuclease Dicer -like protein [Gossypium arboreum]
Length=1962

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL-------DIDFIDAPIVGNFPLN  215
             R + ++T+ADV EALIG +    G+ AA   ++W+G+       D+D I  P   N P +
Sbjct  1559  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIQVESDPDDMDSIVKP--SNVPES  1616

Query  216   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  395
               + VN + LE    LN  F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1617  ILRSVNFEALEG--ALNIEFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1674

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1675  HLFFTYTNLPPGRLTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFV  1729


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLESDSL---LNYTFRDP---SLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ +R+ES  L   L +  + P   S ++EALT  S     T  Y+
Sbjct  1378  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHIIQFPVPASKILEALTAASC--QETFCYE  1435

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1436  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1491



>ref|XP_011071730.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Sesamum 
indicum]
Length=1572

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 103/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIV-GNFPLNAE  221
             R +  +T+ADV EALIG +    G+ AA   ++W+G++IDF    I+  I     P N  
Sbjct  1169  RVLSGKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIDFDLKEINYSIKPSTVPDNIL  1228

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1229  RTIDFDALEGS--LNVKFTDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1286

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1287  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFV  1339


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  987   PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDIISYPVPASKILEALTAASC--QETFCYE  1044

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1045  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNIVLYQYALNKGLQSYI  1100



>ref|XP_010495321.1| PREDICTED: dicer-like protein 4 [Camelina sativa]
Length=1637

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 103/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FLRW+G+++DF      DA I     
Sbjct  1159  SKGHHWLYKKTIADVVEALVGAFLVDSGFKGAVKFLRWIGVNVDFESVQVRDACIASRRY  1218

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      N++ LE+   L YTF    LLV+A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1219  MPLTTRNNLEALENQ--LEYTFLHKGLLVQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1276

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   S  L  +I D+
Sbjct  1277  TSYFFTVFPTLKPGQLTDLRSLSVNNKALANVAVNFSLKRFLFCESIYLHEAIDDY  1332



>ref|XP_010457181.1| PREDICTED: endoribonuclease Dicer homolog 1 [Camelina sativa]
Length=1908

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 104/171 (61%), Gaps = 3/171 (2%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  230
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1554

Query  231   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  407
              ++  +  +  L + F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALKFEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  408   QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFV
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFV  1665


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        +L++Y     S ++EALT  S     T  Y
Sbjct  1323  PLSGSLVRGAQRLPSIMRRVESILLAVQLKNLISYPI-PTSKILEALTAASC--QETFCY  1379

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1380  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1436



>ref|XP_006352611.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Solanum tuberosum]
Length=1914

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF------IDAPIVG-NFPLN  215
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF       +  I   + P N
Sbjct  1511  RVLSSKTMADVVEALIGVYYVEGGKYAANHFMKWIGVEVDFDFNFKETEYSIRSCSIPEN  1570

Query  216   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  395
               + V+   L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1571  VLKSVDFDALQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1628

Query  396   HFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H+S+AL   I DFV
Sbjct  1629  HLFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHSLHLHLRHASSALEKQIRDFV  1683


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    ++      P+L ++EALT  S     T  Y+
Sbjct  1329  PLPGSLVRGAQRLPSIMRRIESMLLAVQLKEMIGYPVPALKILEALTAASC--QETFCYE  1386

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R+ + +YP    G LT +R + V+N     +++  G+ +YI
Sbjct  1387  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQNALSKGIQSYI  1442



>ref|XP_010240123.1| PREDICTED: endoribonuclease Dicer homolog 4 [Brachypodium distachyon]
Length=1625

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 105/176 (60%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  209
             ++    +  +TIADV E+L+GAFL   G  AA +FL W+G+D+DF D+ +       +  
Sbjct  1108  TKSHHWLHKKTIADVVESLLGAFLVEGGFKAAFAFLHWVGIDVDFEDSALYRVLNASSIN  1167

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             L+   ++NV  LE   L+ Y F+   L++EA  H S+  H    YQ+LEFLGDAVL+Y +
Sbjct  1168  LSLMNLINVAELEE--LIGYKFKHKGLIIEAFVHPSFNKHSGGCYQKLEFLGDAVLEYLM  1225

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T + Y  YP L PG +T+L+S +V N  +A  +++  +H YI+  S  L  +++ F
Sbjct  1226  TSYLYSAYPDLKPGEITDLKSLAVCNDSFAYVAIQKCIHKYIIKDSNHLTKAVSKF  1281


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = +3

Query  339   SYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             S +R E LGDA L Y V RH +  Y GL  G LT  RS+ VNN+     SVK  L  YI
Sbjct  1003  SLERFEVLGDAFLKYVVGRHNFMSYEGLDEGQLTRRRSDIVNNSNLHELSVKRNLQVYI  1061



>ref|XP_010454337.1| PREDICTED: dicer-like protein 4 [Camelina sativa]
Length=1730

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 103/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  45    SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  209
             S+G   +  +TIADV EAL+GAFL  +G   A+ FLRW+G+++DF      DA I     
Sbjct  1252  SKGHHWLYKKTIADVVEALVGAFLVDSGFKGAVKFLRWIGVNVDFESVQVRDACIASRRY  1311

Query  210   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  389
             +      N++ LE+   L YTF    LLV+A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1312  MPLTTRNNLEALENQ--LEYTFLHKGLLVQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1369

Query  390   TRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  557
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   S  L  +I D+
Sbjct  1370  TSYFFTVFPTLKPGQLTDLRSLSVNNKALANVAVNFSLKRFLFCESIYLHEAIDDY  1425



>ref|XP_010661522.1| PREDICTED: endoribonuclease Dicer homolog 1 [Vitis vinifera]
Length=1974

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 103/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F    IV      N P +  
Sbjct  1571  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQVEFDPEDIVCATGPCNVPESIL  1630

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LE    LN  F +  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1631  RSVNFDTLEG--ALNIKFNNRGLLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1688

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1689  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHIHLRHGSSALEKQIRDFV  1741


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+   +A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct  1389  PLPGSLVRSAQRLPSIMRRVESMLLAVQLKDVINYPVPAAKILEALTAASC--QETFCYE  1446

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N     S++  GL +YI
Sbjct  1447  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQSALCKGLQSYI  1502



>ref|XP_006306578.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
 gb|EOA39476.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
Length=1906

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  230
             R + ++T+ADV EALIG +    G+IAA   + W+G+ ++     + G   P N  + V 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMTWIGIHVEDDPEEVEGTVKPANVPESVL  1554

Query  231   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  407
              ++  +  +  L + F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALKFEFQDKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  408   QYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFV
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFV  1665


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        +L++Y     S ++EALT  S     T  Y
Sbjct  1320  PLSGSLIRGAQRLPSIMRRVESILLAVQLKNLISYPI-STSKILEALTAASC--QETFCY  1376

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1377  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1433



>ref|XP_011071729.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Sesamum 
indicum]
Length=1934

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 103/173 (60%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIV-GNFPLNAE  221
             R +  +T+ADV EALIG +    G+ AA   ++W+G++IDF    I+  I     P N  
Sbjct  1531  RVLSGKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIDFDLKEINYSIKPSTVPDNIL  1590

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + ++   LE    LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1591  RTIDFDALEGS--LNVKFTDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1648

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1649  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFV  1701


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1349  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDIISYPVPASKILEALTAASC--QETFCYE  1406

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1407  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNIVLYQYALNKGLQSYI  1462



>ref|XP_010241057.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nelumbo nucifera]
Length=2035

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN-----FPLNAE  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F    I  +      P +  
Sbjct  1632  RVLSSKTLADVVEALIGVYYVEGGKQAANHLMKWIGIQVEFDPKEIESSNKPRAIPESIL  1691

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN + LE    LN  F+D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1692  RSVNFEALEG--ALNIKFKDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1749

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV
Sbjct  1750  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEAQIRDFV  1802


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1450  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMINYPVLASKILEALTAASC--QETFCYE  1507

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1508  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1563



>ref|XP_004508388.1| PREDICTED: dicer-like protein 4-like [Cicer arietinum]
Length=1628

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 110/195 (56%), Gaps = 18/195 (9%)
 Frame = +3

Query  18    CVLTSGKLYS-------RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDID  176
             C+ + GK  S       +    +  +T+ADV EAL+GAF+  +G  AA  FL W+G+ ++
Sbjct  1120  CLNSDGKKRSATSTRCNKNHHWLHRKTVADVVEALVGAFIVDSGFKAATVFLTWIGIQVN  1179

Query  177   FIDAPIV-------GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT  335
             F  + +V       G FPL+A+  V++  LE    L + F    LL++A  H SY  HG 
Sbjct  1180  FEASQVVNICTGSVGYFPLSAD--VDIPSLEEK--LGHHFVHKGLLLQAFVHPSYNKHGG  1235

Query  336   QSYQRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
               YQRLEFLGDAVLDY +T + Y  YP L PG LT+LRS SVNN  +A  +V      ++
Sbjct  1236  GCYQRLEFLGDAVLDYLITSYLYSAYPKLKPGQLTDLRSLSVNNKAFACVAVDRCFDEFL  1295

Query  516   LHSSTALRSSIADFV  560
             L  ST L  +I  +V
Sbjct  1296  LCDSTPLTEAIIKYV  1310



>ref|XP_007139041.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
 gb|ESW11035.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
Length=1950

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (59%), Gaps = 7/173 (4%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAE----  221
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N      
Sbjct  1549  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQIEFDPDTLECARKPFNVPDSIL  1608

Query  222   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  401
             + VN   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1609  RSVNFDTLEG--ALNINFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1666

Query  402   YDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FV
Sbjct  1667  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFV  1719


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  344
             P+ G+    A+++ ++ +R+ES        ++++Y  +   +L EALT  S     T  Y
Sbjct  1369  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMISYPVQTSKIL-EALTAASC--QETFCY  1425

Query  345   QRLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1426  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALSKGLQSYI  1482



>ref|XP_006386668.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
 gb|ERP64465.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
Length=1967

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  57    RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NFPLNAEQMVN  233
             R + ++T+ADV EALIG +    G+ A    ++W+G+ ++F    I G + P N  + V 
Sbjct  1564  RVLSSKTLADVVEALIGVYYVEGGKNAVNHLMKWIGIQVEFDHEEIDGASRPFNVPESV-  1622

Query  234   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  404
             ++ ++ D+L   L+  F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1623  LRSVDFDTLEGALDIKFNDRGLLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1682

Query  405   DQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  560
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV
Sbjct  1683  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFV  1734


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = +3

Query  189   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  347
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1383  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDIINYPVPASKILEALTAASC--QETFCYE  1440

Query  348   RLEFLGDAVLDYAVTRHFYDQYPGLSPGCLTELRSESVNNACYALSSVKAGLHNYI  515
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1441  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880