BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS114C11

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    193   6e-56   Populus euphratica
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   7e-56   Populus euphratica
ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           192   1e-55   Glycine max [soybeans]
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             191   6e-55   Phaseolus vulgaris [French bean]
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    190   9e-55   Populus trichocarpa [western balsam poplar]
ref|NP_001234409.1|  protein kinase 1b                                  188   4e-54   
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    188   6e-54   Cicer arietinum [garbanzo]
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             187   8e-54   Citrus clementina [clementine]
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    187   1e-53   
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   187   1e-53   Citrus sinensis [apfelsine]
ref|NP_001242670.1|  uncharacterized protein LOC100798404               187   1e-53   Glycine max [soybeans]
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     187   2e-53   Glycine soja [wild soybean]
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    187   2e-53   
gb|KCW88942.1|  hypothetical protein EUGRSUZ_A01268                     182   3e-53   Eucalyptus grandis [rose gum]
emb|CDP09060.1|  unnamed protein product                                185   5e-53   Coffea canephora [robusta coffee]
gb|KJB20072.1|  hypothetical protein B456_003G131600                    185   5e-53   Gossypium raimondii
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     185   7e-53   
gb|KJB20070.1|  hypothetical protein B456_003G131600                    185   8e-53   Gossypium raimondii
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       184   1e-52   Gossypium arboreum [tree cotton]
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    184   1e-52   Eucalyptus grandis [rose gum]
ref|XP_007016405.1|  Kinase superfamily protein isoform 3               182   1e-52   
ref|XP_007016404.1|  Kinase superfamily protein isoform 2               182   1e-52   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   1e-52   Nicotiana sylvestris
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       184   2e-52   Gossypium arboreum [tree cotton]
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     184   2e-52   Eucalyptus grandis [rose gum]
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     184   2e-52   Populus euphratica
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    184   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     184   3e-52   Camelina sativa [gold-of-pleasure]
gb|KDP20446.1|  hypothetical protein JCGZ_05291                         183   3e-52   Jatropha curcas
ref|XP_007016403.1|  Kinase 1B isoform 1                                183   4e-52   
dbj|BAE71262.1|  putative protein kinase APK1A                          183   4e-52   Trifolium pratense [peavine clover]
ref|XP_010106485.1|  Protein kinase APK1A                               182   4e-52   Morus notabilis
dbj|BAC43185.1|  putative protein kinase                                177   5e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             182   1e-51   
ref|XP_011011764.1|  PREDICTED: protein kinase APK1B, chloroplast...    178   1e-51   Populus euphratica
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic     181   2e-51   Fragaria vesca subsp. vesca
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             181   2e-51   Phaseolus vulgaris [French bean]
gb|KJB55870.1|  hypothetical protein B456_009G099000                    181   2e-51   Gossypium raimondii
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    181   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     181   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             180   4e-51   
gb|KJB36716.1|  hypothetical protein B456_006G172600                    177   4e-51   Gossypium raimondii
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    180   4e-51   Prunus mume [ume]
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   5e-51   Brassica rapa
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   5e-51   Brassica rapa
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     180   6e-51   Nelumbo nucifera [Indian lotus]
emb|CDX95754.1|  BnaC03g26350D                                          180   7e-51   
ref|XP_003616403.1|  Serine/threonine protein kinase                    180   8e-51   Medicago truncatula
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             179   1e-50   Capsella rubella
gb|KDP35639.1|  hypothetical protein JCGZ_09077                         179   1e-50   Jatropha curcas
gb|KJB55871.1|  hypothetical protein B456_009G099000                    181   1e-50   Gossypium raimondii
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   1e-50   
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    179   1e-50   Populus euphratica
emb|CDX83305.1|  BnaA03g22010D                                          179   1e-50   
dbj|BAD12263.1|  protein kinase                                         179   2e-50   Brassica rapa
ref|NP_001288898.1|  protein kinase APK1B, chloroplastic-like           179   2e-50   Brassica rapa
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             179   2e-50   
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   2e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001031439.1|  protein kinase APK1B                               178   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             178   3e-50   Eutrema salsugineum [saltwater cress]
gb|KJB36715.1|  hypothetical protein B456_006G172600                    178   3e-50   Gossypium raimondii
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    178   3e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001031440.1|  protein kinase APK1B                               178   3e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06715.1|  BnaA10g04940D                                          178   3e-50   
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   3e-50   Brassica rapa
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             177   5e-50   
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    177   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_180459.2|  protein kinase APK1B                                  177   6e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95143.1|  BnaC05g05280D                                          177   6e-50   
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   6e-50   Glycine max [soybeans]
gb|ACU19261.1|  unknown                                                 177   6e-50   Glycine max [soybeans]
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    177   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             177   7e-50   
ref|XP_010554610.1|  PREDICTED: serine/threonine-protein kinase B...    177   8e-50   Tarenaya hassleriana [spider flower]
emb|CDX77220.1|  BnaC04g40150D                                          177   8e-50   
gb|AGP76187.1|  MLPK                                                    177   8e-50   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    176   8e-50   
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   9e-50   Glycine max [soybeans]
emb|CDY31741.1|  BnaA04g16770D                                          177   9e-50   Brassica napus [oilseed rape]
ref|XP_010542648.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   1e-49   Tarenaya hassleriana [spider flower]
gb|KEH39440.1|  kinase 1B                                               177   1e-49   Medicago truncatula
emb|CBI16124.3|  unnamed protein product                                176   1e-49   Vitis vinifera
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     176   1e-49   Sesamum indicum [beniseed]
ref|XP_006846202.1|  hypothetical protein AMTR_s00012p00221000          176   1e-49   Amborella trichopoda
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    176   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009133858.1|  PREDICTED: protein kinase APK1B, chloroplast...    175   2e-49   Brassica rapa
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    176   2e-49   Ricinus communis
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    175   2e-49   Tarenaya hassleriana [spider flower]
gb|AIU96237.1|  serine/threonine-protein kinase BIK1                    170   2e-49   Nicotiana benthamiana
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     176   3e-49   Vitis vinifera
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       175   3e-49   Gossypium arboreum [tree cotton]
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    176   3e-49   Solanum tuberosum [potatoes]
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    175   3e-49   Vitis vinifera
ref|XP_009133856.1|  PREDICTED: protein kinase APK1B, chloroplast...    175   3e-49   Brassica rapa
ref|XP_004142761.1|  PREDICTED: protein kinase APK1A, chloroplast...    175   3e-49   Cucumis sativus [cucumbers]
emb|CDY09904.1|  BnaC08g45470D                                          175   3e-49   Brassica napus [oilseed rape]
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     176   3e-49   Sesamum indicum [beniseed]
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    175   4e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    175   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG32116.1|  protein kinase APK1B                                    175   5e-49   Zea mays [maize]
ref|XP_004165801.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    175   5e-49   
gb|KJB83756.1|  hypothetical protein B456_013G263600                    175   5e-49   Gossypium raimondii
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    175   5e-49   Elaeis guineensis
ref|XP_004143118.1|  PREDICTED: protein kinase APK1A, chloroplast...    175   5e-49   
emb|CDP06608.1|  unnamed protein product                                175   6e-49   Coffea canephora [robusta coffee]
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    174   6e-49   Cucumis melo [Oriental melon]
ref|NP_172237.1|  protein kinase APK1A                                  175   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542646.1|  PREDICTED: protein kinase APK1A, chloroplast...    174   7e-49   Tarenaya hassleriana [spider flower]
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    174   7e-49   Eucalyptus grandis [rose gum]
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    174   7e-49   Solanum lycopersicum
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     174   7e-49   Cucumis melo [Oriental melon]
emb|CDY39519.1|  BnaC04g15180D                                          174   7e-49   Brassica napus [oilseed rape]
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     174   9e-49   Solanum lycopersicum
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     174   1e-48   
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     174   1e-48   Brassica rapa
ref|XP_010534501.1|  PREDICTED: serine/threonine-protein kinase B...    174   1e-48   Tarenaya hassleriana [spider flower]
ref|NP_001184929.1|  protein kinase APK1A                               174   1e-48   
ref|NP_001145874.1|  uncharacterized protein LOC100279389               174   1e-48   Zea mays [maize]
ref|XP_010558329.1|  PREDICTED: probable serine/threonine-protein...    172   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             173   2e-48   Citrus clementina [clementine]
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    174   2e-48   
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    173   2e-48   
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    173   2e-48   Nicotiana sylvestris
gb|ACF87678.1|  unknown                                                 174   2e-48   Zea mays [maize]
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    174   2e-48   
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...    174   2e-48   Elaeis guineensis
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...    173   2e-48   Brassica rapa
gb|KJB76052.1|  hypothetical protein B456_012G070600                    172   2e-48   Gossypium raimondii
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    173   2e-48   Nicotiana sylvestris
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     173   2e-48   Nicotiana tomentosiformis
dbj|BAJ87345.1|  predicted protein                                      169   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY55560.1|  BnaA03g54910D                                          173   2e-48   Brassica napus [oilseed rape]
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                173   2e-48   Erythranthe guttata [common monkey flower]
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     172   2e-48   Gossypium arboreum [tree cotton]
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   173   2e-48   Citrus sinensis [apfelsine]
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...    173   3e-48   Elaeis guineensis
ref|XP_007027015.1|  Kinase superfamily protein                         172   3e-48   
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    172   3e-48   Tarenaya hassleriana [spider flower]
gb|KJB76054.1|  hypothetical protein B456_012G070600                    172   3e-48   Gossypium raimondii
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    173   3e-48   Phoenix dactylifera
ref|XP_003567536.1|  PREDICTED: probable serine/threonine-protein...    172   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_004171473.1|  PREDICTED: probable serine/threonine-protein...    172   4e-48   
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    172   4e-48   Cucumis sativus [cucumbers]
gb|KJB76051.1|  hypothetical protein B456_012G070600                    172   4e-48   Gossypium raimondii
gb|KHG05340.1|  Protein kinase APK1A, chloroplastic -like protein       172   4e-48   Gossypium arboreum [tree cotton]
gb|EMT08269.1|  Protein kinase APK1A, chloroplastic                     170   4e-48   
gb|AAA18853.1|  protein kinase                                          172   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          172   4e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80814.1|  BnaC03g00680D                                          172   4e-48   
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   4e-48   
gb|AAF79545.1|AC022464_3  F22G5.5                                       174   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810614.1|  PREDICTED: protein kinase APK1A, chloroplastic     172   5e-48   Phoenix dactylifera
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   5e-48   Phoenix dactylifera
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    172   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    172   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    172   5e-48   Nicotiana sylvestris
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             172   5e-48   Eutrema salsugineum [saltwater cress]
ref|NP_001141912.1|  uncharacterized LOC100274061                       172   6e-48   Zea mays [maize]
gb|KJB76739.1|  hypothetical protein B456_012G104300                    169   6e-48   Gossypium raimondii
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    171   6e-48   Cucumis melo [Oriental melon]
gb|KJB73944.1|  hypothetical protein B456_011G261900                    171   7e-48   Gossypium raimondii
ref|XP_010557253.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   7e-48   
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   8e-48   Pyrus x bretschneideri [bai li]
ref|XP_007009313.1|  Kinase superfamily protein isoform 2               170   8e-48   
ref|XP_010557255.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   8e-48   Tarenaya hassleriana [spider flower]
gb|KJB76738.1|  hypothetical protein B456_012G104300                    169   8e-48   Gossypium raimondii
dbj|BAJ95924.1|  predicted protein                                      172   8e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010557252.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   8e-48   
emb|CDY48100.1|  BnaC02g03570D                                          171   9e-48   Brassica napus [oilseed rape]
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...    171   9e-48   Brassica rapa
emb|CDY04848.1|  BnaAnng00300D                                          171   9e-48   
ref|XP_009143298.1|  PREDICTED: serine/threonine-protein kinase B...    171   1e-47   Brassica rapa
emb|CDY10453.1|  BnaCnng03540D                                          171   2e-47   Brassica napus [oilseed rape]
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    171   2e-47   Setaria italica
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             170   2e-47   
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    171   2e-47   Sesamum indicum [beniseed]
emb|CDP00097.1|  unnamed protein product                                171   2e-47   Coffea canephora [robusta coffee]
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    171   2e-47   
gb|AAO18450.1|  putative protein kinase                                 171   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    170   2e-47   Brassica rapa
emb|CDY40347.1|  BnaA10g27210D                                          170   2e-47   Brassica napus [oilseed rape]
ref|XP_006827147.1|  hypothetical protein AMTR_s00010p00251410          170   2e-47   Amborella trichopoda
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    170   3e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001051730.1|  Os03g0821900                                       171   3e-47   
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    170   3e-47   Cicer arietinum [garbanzo]
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          170   3e-47   Sorghum bicolor [broomcorn]
gb|AFK44181.1|  unknown                                                 170   3e-47   Lotus japonicus
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...    170   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    170   4e-47   Glycine max [soybeans]
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     170   4e-47   Glycine soja [wild soybean]
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    169   4e-47   Solanum tuberosum [potatoes]
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               170   5e-47   Theobroma cacao [chocolate]
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    169   5e-47   Eucalyptus grandis [rose gum]
gb|ABD39229.1|  protein kinase ABC1063                                  169   5e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...    170   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001045548.1|  Os01g0973500                                       169   6e-47   
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    169   6e-47   Sesamum indicum [beniseed]
gb|EEC72262.1|  hypothetical protein OsI_05407                          169   6e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010507635.1|  PREDICTED: serine/threonine-protein kinase B...    163   7e-47   
gb|EAZ15004.1|  hypothetical protein OsJ_04942                          169   7e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             169   8e-47   
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    169   8e-47   Nicotiana tomentosiformis
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             169   1e-46   Phaseolus vulgaris [French bean]
gb|ABF18545.1|  serine/threonine kinase-like protein ABC1063            168   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       168   1e-46   Morus notabilis
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           169   1e-46   Solanum tuberosum [potatoes]
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    168   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    168   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT20337.1|  Protein kinase APK1A, chloroplastic                     167   2e-46   
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     171   2e-46   Gossypium arboreum [tree cotton]
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    168   2e-46   Populus euphratica
gb|EPS63220.1|  protein kinase 1b                                       166   2e-46   Genlisea aurea
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    167   2e-46   Prunus mume [ume]
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    168   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...    168   3e-46   Solanum lycopersicum
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...    167   3e-46   Brachypodium distachyon [annual false brome]
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    167   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78387.1|  hypothetical protein OsI_18165                          167   3e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...    167   3e-46   Solanum lycopersicum
gb|KDP44953.1|  hypothetical protein JCGZ_01453                         167   4e-46   Jatropha curcas
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...    167   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802716.1|  PREDICTED: protein kinase APK1B, chloroplast...    166   4e-46   Phoenix dactylifera
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             167   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             167   4e-46   Phaseolus vulgaris [French bean]
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     167   5e-46   Populus euphratica
gb|KJB16970.1|  hypothetical protein B456_002G257500                    164   5e-46   Gossypium raimondii
ref|NP_001049704.1|  Os03g0274800                                       166   5e-46   
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    167   5e-46   Fragaria vesca subsp. vesca
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    167   6e-46   Vitis vinifera
gb|ABF95246.1|  Protein kinase APK1B, chloroplast precursor, puta...    166   6e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010690630.1|  PREDICTED: probable serine/threonine-protein...    167   6e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    167   6e-46   Glycine max [soybeans]
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             166   8e-46   Eutrema salsugineum [saltwater cress]
emb|CDY20465.1|  BnaC04g05790D                                          166   8e-46   Brassica napus [oilseed rape]
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             166   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    166   1e-45   
ref|XP_009140954.1|  PREDICTED: protein kinase APK1B, chloroplastic     166   1e-45   Brassica rapa
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    166   1e-45   
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...    166   1e-45   Elaeis guineensis
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                166   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    166   1e-45   
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...    166   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            167   1e-45   Triticum urartu
ref|XP_010517317.1|  PREDICTED: serine/threonine-protein kinase BIK1    165   2e-45   Camelina sativa [gold-of-pleasure]
emb|CDY45196.1|  BnaA06g34000D                                          166   2e-45   Brassica napus [oilseed rape]
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    164   2e-45   
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    165   2e-45   Prunus mume [ume]
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    164   2e-45   Cucumis melo [Oriental melon]
gb|KJB16969.1|  hypothetical protein B456_002G257500                    164   2e-45   Gossypium raimondii
ref|XP_010508995.1|  PREDICTED: serine/threonine-protein kinase B...    165   3e-45   Camelina sativa [gold-of-pleasure]
gb|KFK24748.1|  hypothetical protein AALP_AA8G019600                    164   3e-45   Arabis alpina [alpine rockcress]
ref|NP_001054444.1|  Os05g0110900                                       164   3e-45   
ref|XP_006294362.1|  hypothetical protein CARUB_v10023379mg             164   3e-45   Capsella rubella
ref|XP_009101235.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    166   4e-45   Brassica rapa
gb|KFK36852.1|  hypothetical protein AALP_AA4G180100                    164   4e-45   Arabis alpina [alpine rockcress]
gb|AFW83844.1|  putative protein kinase superfamily protein             164   4e-45   
ref|XP_010507637.1|  PREDICTED: serine/threonine-protein kinase B...    164   4e-45   
ref|NP_181496.1|  serine/threonine-protein kinase BIK1                  164   5e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34793.1|  hypothetical protein AALP_AA5G193900                    164   5e-45   Arabis alpina [alpine rockcress]
ref|XP_002879808.1|  botrytis-induced kinase1                           164   5e-45   
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg             164   6e-45   
ref|XP_009419747.1|  PREDICTED: probable serine/threonine-protein...    164   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419746.1|  PREDICTED: probable serine/threonine-protein...    164   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025834.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   6e-45   Populus euphratica
ref|XP_010111129.1|  Protein kinase APK1A                               166   7e-45   
ref|XP_002311595.1|  KINASE 2B family protein                           164   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011025841.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   7e-45   Populus euphratica
ref|XP_010531641.1|  PREDICTED: serine/threonine-protein kinase B...    163   7e-45   Tarenaya hassleriana [spider flower]
gb|ACJ84452.1|  unknown                                                 160   9e-45   Medicago truncatula
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             161   9e-45   
ref|XP_010523451.1|  PREDICTED: protein kinase 2B, chloroplastic-...    164   9e-45   Tarenaya hassleriana [spider flower]
ref|XP_009133374.1|  PREDICTED: serine/threonine-protein kinase BIK1    163   9e-45   Brassica rapa
emb|CDY07643.1|  BnaA03g18680D                                          163   1e-44   
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    163   1e-44   
gb|ACF83789.1|  unknown                                                 162   1e-44   
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    163   1e-44   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    162   1e-44   
ref|XP_010268227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   1e-44   
ref|XP_009341752.1|  PREDICTED: probable serine/threonine-protein...    162   2e-44   
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                163   2e-44   
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          163   2e-44   
ref|XP_006649840.1|  PREDICTED: protein kinase APK1B, chloroplast...    162   2e-44   
gb|KHN17927.1|  Protein kinase APK1B, chloroplastic                     161   2e-44   
ref|XP_010554324.1|  PREDICTED: protein kinase 2B, chloroplastic-...    163   2e-44   
gb|KDO82855.1|  hypothetical protein CISIN_1g014623mg                   163   2e-44   
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    163   2e-44   
emb|CDY24954.1|  BnaC03g22180D                                          162   2e-44   
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             163   2e-44   
ref|XP_006438644.1|  hypothetical protein CICLE_v10031645mg             163   2e-44   
ref|XP_009357737.1|  PREDICTED: probable serine/threonine-protein...    162   2e-44   
ref|XP_006291104.1|  hypothetical protein CARUB_v10017216mg             163   2e-44   
gb|AFK41166.1|  unknown                                                 162   2e-44   
gb|KHG05760.1|  Protein kinase 2B, chloroplastic -like protein          162   3e-44   
ref|NP_001235430.1|  protein kinase                                     161   3e-44   
ref|XP_006403457.1|  hypothetical protein EUTSA_v10010443mg             162   3e-44   
ref|XP_004492356.1|  PREDICTED: probable serine/threonine-protein...    162   3e-44   
ref|NP_001149460.1|  LOC100283086                                       162   3e-44   
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    162   3e-44   
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 162   3e-44   
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               161   4e-44   
ref|XP_008369907.1|  PREDICTED: probable serine/threonine-protein...    162   4e-44   
ref|XP_008780759.1|  PREDICTED: protein kinase 2B, chloroplastic-...    162   4e-44   
ref|XP_009141824.1|  PREDICTED: serine/threonine-protein kinase B...    161   4e-44   
emb|CDX93249.1|  BnaC04g46470D                                          161   4e-44   
ref|XP_007163407.1|  hypothetical protein PHAVU_001G232300g             161   4e-44   
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 162   4e-44   
emb|CDY41675.1|  BnaC02g34790D                                          162   5e-44   
emb|CDY07022.1|  BnaA04g22930D                                          161   5e-44   
ref|XP_006291105.1|  hypothetical protein CARUB_v10017216mg             162   5e-44   
emb|CDY67404.1|  BnaA02g36850D                                          162   5e-44   
ref|XP_004960525.1|  PREDICTED: protein kinase APK1A, chloroplast...    161   5e-44   
gb|EPS69141.1|  hypothetical protein M569_05623                         160   5e-44   
emb|CDY03036.1|  BnaC07g21910D                                          162   6e-44   
gb|KEH34697.1|  tyrosine kinase family protein                          161   6e-44   
ref|XP_009129122.1|  PREDICTED: protein kinase 2B, chloroplastic ...    163   6e-44   
tpg|DAA50034.1|  TPA: putative protein kinase superfamily protein       157   7e-44   
ref|XP_002465484.1|  hypothetical protein SORBIDRAFT_01g039630          160   7e-44   
ref|XP_009129123.1|  PREDICTED: protein kinase 2B, chloroplastic ...    162   7e-44   
ref|XP_009129121.1|  PREDICTED: protein kinase 2B, chloroplastic ...    162   8e-44   
gb|KEH34700.1|  tyrosine kinase family protein                          161   9e-44   
ref|NP_001241432.1|  probable serine/threonine-protein kinase NAK...    160   1e-43   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    160   1e-43   
ref|XP_007157675.1|  hypothetical protein PHAVU_002G089100g             160   1e-43   
ref|XP_002876829.1|  hypothetical protein ARALYDRAFT_484186             161   1e-43   
ref|XP_004490013.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   1e-43   
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    160   1e-43   
ref|XP_003519043.2|  PREDICTED: protein kinase 2B, chloroplastic-...    160   1e-43   
ref|XP_010425051.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   2e-43   
ref|XP_003517946.2|  PREDICTED: protein kinase 2B, chloroplastic-...    160   2e-43   
dbj|BAC42058.1|  putative protein kinase                                160   2e-43   
ref|NP_178383.1|  protein kinase 2B                                     160   2e-43   
ref|XP_010514052.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   2e-43   
ref|XP_010502291.1|  PREDICTED: protein kinase 2B, chloroplastic        160   2e-43   
gb|KFK33463.1|  hypothetical protein AALP_AA5G016500                    161   2e-43   
ref|XP_011071021.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   2e-43   
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    160   2e-43   
ref|XP_010427317.1|  PREDICTED: probable receptor-like protein ki...    159   2e-43   
ref|XP_010516114.1|  PREDICTED: probable receptor-like protein ki...    159   2e-43   
ref|XP_010504400.1|  PREDICTED: probable receptor-like protein ki...    159   2e-43   
ref|XP_010427316.1|  PREDICTED: probable receptor-like protein ki...    159   2e-43   
ref|XP_010504399.1|  PREDICTED: probable receptor-like protein ki...    159   2e-43   
ref|XP_010527880.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   3e-43   
emb|CDP00299.1|  unnamed protein product                                160   3e-43   
ref|XP_006411192.1|  hypothetical protein EUTSA_v10016758mg             159   3e-43   
gb|KJB80150.1|  hypothetical protein B456_013G083100                    159   3e-43   
gb|EYU28722.1|  hypothetical protein MIMGU_mgv1a007163mg                160   3e-43   
ref|XP_009592152.1|  PREDICTED: protein kinase 2B, chloroplastic-...    160   3e-43   
gb|EMS68595.1|  Protein kinase APK1A, chloroplastic                     160   3e-43   
ref|XP_002277256.1|  PREDICTED: protein kinase 2B, chloroplastic ...    159   4e-43   
emb|CDY41231.1|  BnaC08g26270D                                          159   4e-43   
ref|XP_002315799.1|  KINASE 2B family protein                           159   4e-43   
ref|XP_010652320.1|  PREDICTED: protein kinase 2B, chloroplastic ...    159   4e-43   
ref|XP_009116239.1|  PREDICTED: probable receptor-like protein ki...    159   4e-43   
emb|CDY40221.1|  BnaA09g35030D                                          159   4e-43   
gb|EMT32058.1|  Protein kinase APK1A, chloroplastic                     159   4e-43   
ref|XP_009116240.1|  PREDICTED: probable receptor-like protein ki...    159   5e-43   
ref|XP_006395757.1|  hypothetical protein EUTSA_v10004126mg             160   5e-43   
ref|XP_011086380.1|  PREDICTED: protein kinase 2B, chloroplastic        159   5e-43   
ref|XP_003613630.1|  Protein kinase 2B                                  159   5e-43   
ref|XP_008221674.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   5e-43   
gb|ACJ84335.1|  unknown                                                 159   5e-43   
gb|EMS62888.1|  Protein kinase APK1A, chloroplastic                     160   5e-43   
ref|XP_008221672.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   6e-43   
ref|XP_010234717.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   6e-43   
ref|NP_001151952.1|  LOC100285589                                       159   6e-43   
gb|KJB80149.1|  hypothetical protein B456_013G083100                    159   6e-43   
ref|XP_010096366.1|  Protein kinase 2B                                  159   7e-43   
ref|XP_003573903.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   8e-43   
ref|XP_004238776.1|  PREDICTED: protein kinase 2B, chloroplastic-...    159   8e-43   
ref|XP_006602311.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   9e-43   
gb|KDP21209.1|  hypothetical protein JCGZ_21680                         158   9e-43   
ref|XP_006602310.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   9e-43   
ref|NP_001183697.1|  uncharacterized LOC100502290                       159   1e-42   
gb|KHN31764.1|  Protein kinase 2B, chloroplastic                        158   1e-42   
gb|AAT39953.2|  Protein kinase APK1B, chloroplast precursor, puta...    158   1e-42   
ref|XP_009769692.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   1e-42   
ref|XP_004503146.1|  PREDICTED: protein kinase APK1A, chloroplast...    158   1e-42   
ref|XP_008221673.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   1e-42   
ref|XP_010476493.1|  PREDICTED: protein kinase 2A, chloroplastic-...    154   1e-42   
gb|ABC74580.1|  rust resistance gene ABC1041                            158   1e-42   
ref|XP_004228391.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   1e-42   
ref|XP_009389572.1|  PREDICTED: protein kinase 2A, chloroplastic-...    158   1e-42   
ref|XP_009389571.1|  PREDICTED: protein kinase 2A, chloroplastic-...    158   1e-42   
gb|AAT40481.1|  putative protein kinase                                 158   1e-42   
ref|XP_006363247.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   1e-42   
gb|AAO29965.1|  serine/threonine-specific protein kinase -like          157   2e-42   
ref|XP_004142838.1|  PREDICTED: protein kinase APK1A, chloroplast...    156   2e-42   
emb|CAB75903.1|  serine/threonine-specific protein kinase-like          157   2e-42   
ref|NP_191105.2|  PBS1-like 1 kinase                                    157   2e-42   
ref|XP_004984728.1|  PREDICTED: protein kinase APK1B, chloroplast...    157   2e-42   
gb|EPS58949.1|  hypothetical protein M569_15863                         155   2e-42   
ref|XP_002893367.1|  hypothetical protein ARALYDRAFT_472702             157   2e-42   
ref|XP_010917006.1|  PREDICTED: protein kinase 2B, chloroplastic-...    158   2e-42   
ref|NP_001238650.1|  protein kinase                                     157   2e-42   
ref|XP_010229119.1|  PREDICTED: protein kinase 2B, chloroplastic        157   2e-42   
ref|XP_008663158.1|  PREDICTED: protein kinase 2B, chloroplastic-...    150   2e-42   
ref|XP_008339927.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   2e-42   
ref|XP_006363926.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   2e-42   
ref|XP_010258573.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   2e-42   
ref|XP_010258572.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   2e-42   
ref|XP_010044713.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   2e-42   
ref|XP_009360375.1|  PREDICTED: protein kinase 2B, chloroplastic-...    157   3e-42   
ref|NP_174019.2|  putative protein kinase                               157   3e-42   
ref|XP_007222585.1|  hypothetical protein PRUPE_ppa006262mg             157   3e-42   
ref|NP_001190097.1|  PBS1-like 1 kinase                                 157   4e-42   
gb|AAF79849.1|AC000348_2  T7N9.2                                        157   4e-42   
ref|XP_007046178.1|  Kinase 2B isoform 1                                157   4e-42   
gb|KJB50673.1|  hypothetical protein B456_008G182000                    157   4e-42   
emb|CDX76093.1|  BnaA04g03570D                                          155   5e-42   
ref|XP_010227588.1|  PREDICTED: probable serine/threonine-protein...    157   5e-42   
ref|XP_010044714.1|  PREDICTED: protein kinase 2B, chloroplastic-...    155   6e-42   
ref|XP_004983145.1|  PREDICTED: protein kinase 2B, chloroplastic-...    156   6e-42   
ref|XP_008458874.1|  PREDICTED: protein kinase APK1B, chloroplast...    155   6e-42   
gb|AGU99598.1|  protein kinase                                          157   6e-42   
ref|XP_010458935.1|  PREDICTED: protein kinase 2A, chloroplastic-...    156   8e-42   
ref|XP_010496035.1|  PREDICTED: protein kinase 2A, chloroplastic        156   8e-42   
ref|XP_002520117.1|  Protein kinase APK1A, chloroplast precursor,...    156   8e-42   
ref|XP_007153823.1|  hypothetical protein PHAVU_003G067900g             155   8e-42   
gb|ACF79269.1|  unknown                                                 155   9e-42   
ref|NP_001149364.1|  protein kinase APK1A                               155   1e-41   
gb|KDO69307.1|  hypothetical protein CISIN_1g015731mg                   153   1e-41   
gb|KHG12048.1|  Protein kinase 2B, chloroplastic -like protein          155   1e-41   
ref|XP_004145296.1|  PREDICTED: protein kinase APK1A, chloroplast...    155   1e-41   
gb|EPS59398.1|  hypothetical protein M569_15409                         154   1e-41   
ref|XP_004985548.1|  PREDICTED: protein kinase 2B, chloroplastic-...    155   1e-41   
ref|XP_010037161.1|  PREDICTED: protein kinase 2B, chloroplastic-...    155   1e-41   
ref|XP_008677038.1|  PREDICTED: protein kinase APK1A isoform X1         155   2e-41   
emb|CDY53554.1|  BnaA09g57130D                                          155   2e-41   
ref|XP_004165824.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    154   2e-41   
ref|XP_008653698.1|  PREDICTED: protein kinase 2B, chloroplastic-...    149   2e-41   
ref|XP_006649471.1|  PREDICTED: protein kinase 2B, chloroplastic-...    155   2e-41   
emb|CDX81634.1|  BnaC08g39670D                                          155   2e-41   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    155   2e-41   
ref|XP_010476492.1|  PREDICTED: protein kinase 2A, chloroplastic-...    155   2e-41   
ref|XP_008457480.1|  PREDICTED: protein kinase APK1B, chloroplast...    154   2e-41   
ref|XP_006307552.1|  hypothetical protein CARUB_v10009175mg             155   2e-41   
ref|XP_010926227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   3e-41   
ref|XP_008389509.1|  PREDICTED: protein kinase 2B, chloroplastic        154   3e-41   
ref|XP_008457478.1|  PREDICTED: protein kinase APK1B, chloroplast...    154   3e-41   
emb|CDY02940.1|  BnaC04g25460D                                          153   3e-41   
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    154   3e-41   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             154   3e-41   
gb|ABF94203.1|  serine/threonine-protein kinase NAK, putative, ex...    154   3e-41   
ref|XP_002876303.1|  hypothetical protein ARALYDRAFT_485972             154   3e-41   
gb|AAL84315.1|AC073556_32  putative protein tyrosine-serine-threo...    154   3e-41   
ref|XP_009117905.1|  PREDICTED: protein kinase 2A, chloroplastic        154   3e-41   
gb|EEC74601.1|  hypothetical protein OsI_10191                          154   4e-41   
gb|ACF81963.1|  unknown                                                 154   4e-41   
ref|XP_009762807.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   5e-41   
ref|XP_010552590.1|  PREDICTED: protein kinase 2B, chloroplastic        153   5e-41   
ref|XP_011021613.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   5e-41   
ref|NP_001130876.1|  LOC100191980                                       154   5e-41   
ref|NP_001147807.1|  serine/threonine-protein kinase NAK                154   5e-41   
ref|XP_002465785.1|  hypothetical protein SORBIDRAFT_01g045780          154   5e-41   
ref|XP_009590721.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   6e-41   
dbj|BAK02513.1|  predicted protein                                      153   7e-41   
ref|XP_010683239.1|  PREDICTED: protein kinase 2B, chloroplastic-...    153   7e-41   
ref|XP_008811563.1|  PREDICTED: protein kinase 2B, chloroplastic-...    153   8e-41   
ref|XP_004169012.1|  PREDICTED: protein kinase 2B, chloroplastic-...    149   8e-41   
ref|XP_002467271.1|  hypothetical protein SORBIDRAFT_01g022400          153   9e-41   
ref|XP_002890052.1|  hypothetical protein ARALYDRAFT_471608             153   9e-41   
ref|XP_004505860.1|  PREDICTED: protein kinase APK1B, chloroplast...    153   1e-40   
ref|XP_004505862.1|  PREDICTED: protein kinase APK1B, chloroplast...    153   1e-40   
ref|XP_011021612.1|  PREDICTED: protein kinase 2B, chloroplastic-...    154   1e-40   
gb|EMT28025.1|  Putative serine/threonine-protein kinase NAK            153   1e-40   
ref|XP_006590337.1|  PREDICTED: uncharacterized protein LOC100809...    152   1e-40   
ref|NP_001242718.1|  protein kinase APK1A, chloroplastic-like           152   1e-40   
ref|NP_172889.1|  protein kinase 2A                                     152   1e-40   
gb|EMS64110.1|  Protein kinase 2B, chloroplastic                        153   2e-40   
gb|ABK24429.1|  unknown                                                 153   2e-40   
gb|KGN64246.1|  hypothetical protein Csa_1G045440                       148   2e-40   
ref|XP_006390970.1|  hypothetical protein EUTSA_v10018676mg             151   3e-40   
gb|EMS52364.1|  Protein kinase APK1A, chloroplastic                     150   3e-40   
ref|XP_004297326.1|  PREDICTED: protein kinase 2B, chloroplastic-...    152   3e-40   
ref|XP_007132065.1|  hypothetical protein PHAVU_011G064000g             152   3e-40   
ref|XP_004162537.1|  PREDICTED: protein kinase 2B, chloroplastic-...    151   4e-40   
gb|KDO76089.1|  hypothetical protein CISIN_1g0135571mg                  148   4e-40   
emb|CDY39318.1|  BnaC05g10610D                                          151   4e-40   
ref|XP_009110056.1|  PREDICTED: protein kinase 2B, chloroplastic        151   5e-40   
emb|CDY46426.1|  BnaA08g20040D                                          151   5e-40   
ref|XP_011098600.1|  PREDICTED: probable receptor-like protein ki...    152   5e-40   
ref|XP_006661758.1|  PREDICTED: protein kinase 2B, chloroplastic-...    151   5e-40   
emb|CDY49086.1|  BnaA06g09200D                                          151   5e-40   
ref|XP_009148734.1|  PREDICTED: protein kinase 2A, chloroplastic-...    151   6e-40   
gb|KHN21952.1|  Protein kinase APK1A, chloroplastic                     152   6e-40   
gb|AET14353.1|  protein kinase 1b                                       150   7e-40   
ref|XP_006417017.1|  hypothetical protein EUTSA_v10007701mg             151   7e-40   
ref|XP_004146751.1|  PREDICTED: protein kinase 2B, chloroplastic-...    150   7e-40   
ref|XP_009409221.1|  PREDICTED: protein kinase 2B, chloroplastic-...    150   1e-39   
ref|XP_007015405.1|  Serine/threonine-protein kinase NAK                150   1e-39   
ref|XP_008456461.1|  PREDICTED: protein kinase 2B, chloroplastic-...    149   1e-39   
gb|EYU34094.1|  hypothetical protein MIMGU_mgv1a005466mg                151   1e-39   
ref|XP_008233630.1|  PREDICTED: protein kinase APK1B, chloroplast...    149   1e-39   



>ref|XP_011035309.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035310.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035311.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035312.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
Length=407

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V STDGS L  + SK    S P TP+SEGEILQS NLKSF+F+DLKMATR+FR 
Sbjct  20   GLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQSTNLKSFSFSDLKMATRNFRP  78

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQF 
Sbjct  79   DSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAGFQGHKEWLAEVNYLGQFY  138

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  139  HPHLVKLIGYC  149



>ref|XP_011035314.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Populus euphratica]
Length=405

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V STDGS L  + SK    S P TP+SEGEILQS NLKSF+F+DLKMATR+FR 
Sbjct  18   GLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQSTNLKSFSFSDLKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQF 
Sbjct  77   DSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAGFQGHKEWLAEVNYLGQFY  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>ref|NP_001240863.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006593429.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89549.1| putative protein kinase [Glycine max]
 gb|KHN30169.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=419

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 13/150 (9%)
 Frame = +1

Query  115  KIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSP  285
            +I +  PF+++F         +SK V STDG+ LG ++ K   NS PQTP+SEGEILQS 
Sbjct  8    QIKAESPFNTVF---------NSKYV-STDGNDLGSTNDKVSANSVPQTPRSEGEILQSS  57

Query  286  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  465
            NLKSFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  
Sbjct  58   NLKSFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQD  117

Query  466  GLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+QGH EWLAE+NYLGQ SHP+LV+LIG+C
Sbjct  118  GIQGHREWLAEVNYLGQLSHPHLVRLIGFC  147



>ref|XP_007150326.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
 gb|ESW22320.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
Length=422

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK   STDG+ LG ++ K   NS PQTP+SEGEILQS NLKSFT ++LK ATR+FR 
Sbjct  18   GLNSK-YGSTDGNYLGSTNDKVSGNSVPQTPRSEGEILQSSNLKSFTLSELKTATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+QGH EWLAE+NYLGQ S
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGIQGHREWLAEVNYLGQLS  136

Query  523  HPNLVKLIGYC  555
            HP+LV+LIG+C
Sbjct  137  HPHLVRLIGFC  147



>ref|XP_002299870.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE84675.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=405

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 106/131 (81%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V STDG+ L  + SK    S P TP+SEGEILQS NLKSF+F+DLKMATR FR 
Sbjct  18   GLSSKYV-STDGNDLSSTGSKVLSVSVPPTPRSEGEILQSTNLKSFSFSDLKMATRSFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQF 
Sbjct  77   DSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQDGFQGHKEWLAEVNYLGQFY  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 107/128 (84%), Gaps = 4/128 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GL+S+ V S DG   G S+S +  P T +SEGEILQSPNLKSF+F+DLK ATR+FR DSV
Sbjct  18   GLNSRSV-SIDG---GDSNSSSRVPSTTRSEGEILQSPNLKSFSFSDLKTATRNFRPDSV  73

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH EWLAE+NYLGQFSHP+
Sbjct  74   LGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPH  133

Query  532  LVKLIGYC  555
            LVKLIGYC
Sbjct  134  LVKLIGYC  141



>ref|XP_004487006.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X5 
[Cicer arietinum]
Length=411

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +1

Query  172  GLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK    I  D S    S DS  S PQTP+SEGEILQS NLKS+T A+LK ATR+FR 
Sbjct  18   GLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNLKSYTLAELKAATRNFRP  77

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFS
Sbjct  78   DSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGCQGHREWLAEVNYLGQFS  137

Query  523  HPNLVKLIGYC  555
            HP+LV+LIGYC
Sbjct  138  HPHLVRLIGYC  148



>ref|XP_006424836.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006424837.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006488335.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Citrus sinensis]
 gb|ESR38076.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 gb|ESR38077.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
Length=404

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNLKSF+F+DLK ATR+FR 
Sbjct  18   GVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNLKSFSFSDLKTATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDGFQGHKEWLAEVNYLGQLY  136

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  137  HPNLVKLIGYC  147



>ref|XP_004487004.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004487005.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=428

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +1

Query  172  GLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK    I  D S    S DS  S PQTP+SEGEILQS NLKS+T A+LK ATR+FR 
Sbjct  5    GLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNLKSYTLAELKAATRNFRP  64

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFS
Sbjct  65   DSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGCQGHREWLAEVNYLGQFS  124

Query  523  HPNLVKLIGYC  555
            HP+LV+LIGYC
Sbjct  125  HPHLVRLIGYC  135



>gb|KDO72843.1| hypothetical protein CISIN_1g046897mg [Citrus sinensis]
Length=404

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNLKSF+F+DLK ATR+FR 
Sbjct  18   GVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNLKSFSFSDLKTATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDGFQGHKEWLAEVNYLGQLY  136

Query  523  HPNLVKLIGYC  555
            HPNLVKL+GYC
Sbjct  137  HPNLVKLVGYC  147



>ref|NP_001242670.1| uncharacterized protein LOC100798404 [Glycine max]
 gb|ACU24124.1| unknown [Glycine max]
Length=422

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G +SK V STDG+  G ++ K   NS PQTP+SEGEIL+S NLKSF  ++LK ATR+FR 
Sbjct  18   GFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEGEILRSSNLKSFPLSELKTATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+QGH EWLAE+NYLGQ S
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGIQGHREWLAEVNYLGQLS  136

Query  523  HPNLVKLIGYC  555
            HP+LV+LIG+C
Sbjct  137  HPHLVRLIGFC  147



>gb|KHN33381.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=422

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G +SK V STDG+  G ++ K   NS PQTP+SE EIL+S NLKSFT ++LK ATR+FR 
Sbjct  18   GFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEVEILRSSNLKSFTLSELKTATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G+QGH EWLAE+NYLGQ S
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDGIQGHREWLAEVNYLGQLS  136

Query  523  HPNLVKLIGYC  555
            HP+LV+LIG+C
Sbjct  137  HPHLVRLIGFC  147



>ref|XP_004487002.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004487003.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +1

Query  172  GLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK    I  D S    S DS  S PQTP+SEGEILQS NLKS+T A+LK ATR+FR 
Sbjct  18   GLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNLKSYTLAELKAATRNFRP  77

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFS
Sbjct  78   DSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDGCQGHREWLAEVNYLGQFS  137

Query  523  HPNLVKLIGYC  555
            HP+LV+LIGYC
Sbjct  138  HPHLVRLIGYC  148



>gb|KCW88942.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=291

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  18   GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH EWLAE+NYLGQ  HPN
Sbjct  77   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGHREWLAEINYLGQLHHPN  136

Query  532  LVKLIGYC  555
            LVKLIG+C
Sbjct  137  LVKLIGFC  144



>emb|CDP09060.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK V STDG+ L  S  K S    P  P+SEGEILQSPNLKSF+F+DLKMATR+FR 
Sbjct  18   GLTSKNV-STDGNSLKSSSGKVSSGSVPPPPRSEGEILQSPNLKSFSFSDLKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQF 
Sbjct  77   DSVLGEGGFGSVFKGWIDENSFAATKPGTGVVIAVKRLNLEGFQGHREWLAEVNYLGQFC  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>gb|KJB20072.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=400

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQSPNLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKP
Sbjct  39   PLTPRSEGEILQSPNLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKP  98

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  99   GSGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  142



>ref|XP_009590400.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590401.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590402.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=404

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GL+S+   STDG     S   ++ P  P+SEGEILQS NLKSF+F+DLK ATR+FR DSV
Sbjct  18   GLNSRSA-STDGYDSNPSSRVSTVPLAPRSEGEILQSANLKSFSFSDLKTATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH EWLAE+NYLGQFSHP+
Sbjct  77   LGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPH  136

Query  532  LVKLIGYC  555
            LVKLIGYC
Sbjct  137  LVKLIGYC  144



>gb|KJB20070.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
 gb|KJB20071.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=418

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQSPNLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKP
Sbjct  57   PLTPRSEGEILQSPNLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKP  116

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  117  GSGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  160



>gb|KHG20116.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=404

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSSK V S   D S      S  S P TP+SEGEILQSPNLKSF+FADLKMATR+FR D
Sbjct  17   GLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKSFSFADLKMATRNFRPD  76

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFK WID+NSL+ +KPGTG VIAVKRLN  G QGH EWLAE+NYLGQ  H
Sbjct  77   SVLGEGGFGSVFKAWIDENSLAASKPGTGTVIAVKRLNQEGFQGHREWLAEVNYLGQLYH  136

Query  526  PNLVKLIGYC  555
            P+LVKLIGYC
Sbjct  137  PHLVKLIGYC  146



>ref|XP_010047712.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Eucalyptus 
grandis]
Length=398

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  9    GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  67

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH EWLAE+NYLGQ  HPN
Sbjct  68   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGHREWLAEINYLGQLHHPN  127

Query  532  LVKLIGYC  555
            LVKLIG+C
Sbjct  128  LVKLIGFC  135



>ref|XP_007016405.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY34024.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
Length=337

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 106/131 (81%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNLKSF+FADLKMATR+FR 
Sbjct  30   GLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNLKSFSFADLKMATRNFRP  88

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  89   DSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLY  148

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  149  HPHLVKLIGYC  159



>ref|XP_007016404.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY34023.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=325

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 106/131 (81%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNLKSF+FADLKMATR+FR 
Sbjct  18   GLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNLKSFSFADLKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLY  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>ref|XP_009774717.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009774718.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=404

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GL+S+ V STDG     S   ++ P  P+SEGEILQS NLKSF+F++L+ ATR+FR DSV
Sbjct  18   GLNSRSV-STDGYDSNPSSRVSTVPPAPRSEGEILQSANLKSFSFSELRTATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G QGH EWLAE+NYLGQFSHP+
Sbjct  77   LGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPH  136

Query  532  LVKLIGYC  555
            LVKLIGYC
Sbjct  137  LVKLIGYC  144



>gb|KHG10966.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=418

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQSPNLKSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NS + TKP
Sbjct  57   PLTPRSEGEILQSPNLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTATKP  116

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+G+VIAVKRLN  G QGH EWLAE+N+LGQ  HPNLVKLIGYC
Sbjct  117  GSGIVIAVKRLNQDGFQGHKEWLAEVNFLGQLYHPNLVKLIGYC  160



>gb|KCW88940.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=408

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  19   GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  77

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH EWLAE+NYLGQ  HPN
Sbjct  78   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGHREWLAEINYLGQLHHPN  137

Query  532  LVKLIGYC  555
            LVKLIG+C
Sbjct  138  LVKLIGFC  145



>ref|XP_011042707.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=405

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V STDG+ L  + SK S    P TP+SEGEILQS NLKSF+F+DLKMATR+FR 
Sbjct  18   GLSSKNV-STDGTDLSSTSSKVSSLSVPPTPRSEGEILQSSNLKSFSFSDLKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQF 
Sbjct  77   DSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAGFQGHKEWLAEVNYLGQFY  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>ref|XP_010047703.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
 gb|KCW88941.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=407

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  18   GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G QGH EWLAE+NYLGQ  HPN
Sbjct  77   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEGFQGHREWLAEINYLGQLHHPN  136

Query  532  LVKLIGYC  555
            LVKLIG+C
Sbjct  137  LVKLIGFC  144



>ref|XP_010457947.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG SSK V S   D   LG   S  S   TP++EGEILQSPNLKSF+FA+LK ATR+FR 
Sbjct  14   PGTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKSFSFAELKSATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGYC  555
            H +LVKLIGYC
Sbjct  134  HRHLVKLIGYC  144



>ref|XP_010487664.1| PREDICTED: protein kinase APK1A, chloroplastic [Camelina sativa]
Length=413

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG SSK V S   D   LG   S  S   TP++EGEILQSPNLKSF+FA+LK ATR+FR 
Sbjct  14   PGTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKSFSFAELKSATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGYC  555
            H +LVKLIGYC
Sbjct  134  HRHLVKLIGYC  144



>gb|KDP20446.1| hypothetical protein JCGZ_05291 [Jatropha curcas]
Length=404

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSSK V +   D S   K  S + PP TP+SEGEILQS NLKSF+F+DLKMATR+FR D
Sbjct  18   GLSSKYVSTDVNDRSTSSKVSSASMPP-TPRSEGEILQSSNLKSFSFSDLKMATRNFRPD  76

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+NS +  KPGTG+VIAVKRLN  GLQGH EWLAE+NYLGQF H
Sbjct  77   SVLGEGGFGSVFKGWIDENSFAAAKPGTGMVIAVKRLNQEGLQGHKEWLAEVNYLGQFCH  136

Query  526  PNLVKLIGYC  555
            P+LVKLIGYC
Sbjct  137  PHLVKLIGYC  146



>ref|XP_007016403.1| Kinase 1B isoform 1 [Theobroma cacao]
 gb|EOY34022.1| Kinase 1B isoform 1 [Theobroma cacao]
Length=405

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 106/131 (81%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNLKSF+FADLKMATR+FR 
Sbjct  18   GLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNLKSFSFADLKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDGFQGHKEWLAEVNYLGQLY  136

Query  523  HPNLVKLIGYC  555
            HP+LVKLIGYC
Sbjct  137  HPHLVKLIGYC  147



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK   S  G+ L  ++SK    S PQTP+SEGEIL+S N+KS+T A+LK ATR+FR 
Sbjct  18   GLNSKNSNSA-GNDLSSTNSKVSTGSVPQTPRSEGEILKSTNVKSYTLAELKSATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+NSL+P KPGTG+VIAVKRLN    QGH EWLAE+NYLGQFS
Sbjct  77   DSVLGEGGFGSVFKGWIDENSLAPAKPGTGIVIAVKRLNQESFQGHREWLAEVNYLGQFS  136

Query  523  HPNLVKLIGYC  555
            HP+LV+LIGYC
Sbjct  137  HPHLVRLIGYC  147



>ref|XP_010106485.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC10661.1| Protein kinase APK1A [Morus notabilis]
Length=402

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GL+SK V STDG+        S  S P TP+SEGEILQS NLKSF FADL+MATR+FR D
Sbjct  15   GLNSKYV-STDGNLSSTSSKVSSVSVPPTPRSEGEILQSSNLKSFCFADLRMATRNFRPD  73

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  H
Sbjct  74   SVLGEGGFGSVFKGWIDENSFAATKPGTGMVIAVKRLNQDGFQGHKEWLAEVNYLGQLYH  133

Query  526  PNLVKLIGYC  555
            P+LVKLIGYC
Sbjct  134  PHLVKLIGYC  143



>dbj|BAC43185.1| putative protein kinase [Arabidopsis thaliana]
Length=215

 Score =   177 bits (449),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K + S     LG   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DS
Sbjct  14   PGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDS  73

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHP
Sbjct  74   VLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHP  133

Query  529  NLVKLIGYC  555
            NLVKLIGYC
Sbjct  134  NLVKLIGYC  142



>ref|XP_002322956.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
 gb|EEF04717.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
Length=428

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 105/135 (78%), Gaps = 12/135 (9%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATR  330
            GLSSKC     GS  GK+        S  S PQTP+SEGEILQS NLK FTF +LK ATR
Sbjct  47   GLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILQSSNLKIFTFGELKTATR  101

Query  331  DFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYL  510
            +FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIAVKRLN  G QGH EWLAE+NYL
Sbjct  102  NFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIAVKRLNQEGFQGHREWLAEINYL  161

Query  511  GQFSHPNLVKLIGYC  555
            GQF HPNLVKLIGYC
Sbjct  162  GQFQHPNLVKLIGYC  176



>ref|XP_011011764.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Populus euphratica]
Length=275

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 106/135 (79%), Gaps = 12/135 (9%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATR  330
            GLSSKC     GS  GK+        S  S PQTP+SEGEIL+S NLK+FTF +LK ATR
Sbjct  18   GLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILESSNLKTFTFGELKTATR  72

Query  331  DFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYL  510
            +FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN  G QGH EWLAE+NYL
Sbjct  73   NFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLNQEGFQGHREWLAEINYL  132

Query  511  GQFSHPNLVKLIGYC  555
            GQF HPNLVKLIG+C
Sbjct  133  GQFQHPNLVKLIGFC  147



>ref|XP_004294513.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011461211.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            +S DGS   K  S ++PP TP++EGEILQS NL+SF+FADLK+ATR+FR DSVLGEGGFG
Sbjct  22   VSNDGSTSSKVSSFSAPP-TPRTEGEILQSTNLRSFSFADLKLATRNFRPDSVLGEGGFG  80

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             VFKGWID+NS +  KPGTG+V+AVKRLN    QGH EWLAE+NYLGQF HPNLVKLIGY
Sbjct  81   SVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQGHREWLAEVNYLGQFHHPNLVKLIGY  140

Query  553  C  555
            C
Sbjct  141  C  141



>ref|XP_007141880.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
 gb|ESW13874.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
Length=400

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GLSSK   +T+  GL    S  S P TP++EGEIL+S N+KSFTF +LK+ATR+FR DSV
Sbjct  18   GLSSKDG-NTEEDGLSGKISTPSVPPTPRTEGEILKSSNMKSFTFGELKIATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            +GEGGFG VFKGWID+ SL+P +PGTGLVIAVKRLN  GLQGHSEWL E+NYLGQ  HPN
Sbjct  77   VGEGGFGCVFKGWIDEQSLAPVRPGTGLVIAVKRLNQEGLQGHSEWLTEINYLGQLHHPN  136

Query  532  LVKLIGYC  555
            LVKLIGYC
Sbjct  137  LVKLIGYC  144



>gb|KJB55870.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55872.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=404

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSSK V S   D S      S  S P TP+SEGEILQSPNLK F+FADLKMATR+FR D
Sbjct  17   GLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKCFSFADLKMATRNFRPD  76

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G QGH EWLAE+NYLGQ  H
Sbjct  77   SVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEGFQGHREWLAEVNYLGQLYH  136

Query  526  PNLVKLIGYC  555
            P++VKLIGYC
Sbjct  137  PHIVKLIGYC  146



>ref|XP_010475518.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010475519.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG SSK   S   D   LG   S  S   TP++EGEILQSPNLKSF+FA+L+ ATR+FR 
Sbjct  14   PGTSSKYASSDGKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKSFSFAELRSATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGYC  555
            H +LVKLIGYC
Sbjct  134  HRHLVKLIGYC  144



>ref|XP_010521843.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010521844.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
Length=414

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = +1

Query  169  PGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFR  339
            PG S K  +S+DG+    LG   S  S   TP++EGEILQSPNLKSF+F++LK ATR+FR
Sbjct  14   PGASPKH-LSSDGNDTGSLGSKASSMSVRPTPRTEGEILQSPNLKSFSFSELKTATRNFR  72

Query  340  LDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQF  519
             DSVLGEGGFG VFKGWID+ +L+ TKPGTG VIAVKRLN  G QGH EWLAE+NYLGQF
Sbjct  73   PDSVLGEGGFGCVFKGWIDEQTLTATKPGTGTVIAVKRLNQDGWQGHKEWLAEVNYLGQF  132

Query  520  SHPNLVKLIGYC  555
            SHP+LVKLIGYC
Sbjct  133  SHPHLVKLIGYC  144



>ref|XP_010510562.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Camelina 
sativa]
Length=414

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG S K + S   D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR 
Sbjct  14   PGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGY  552
            HPNLVKLIGY
Sbjct  134  HPNLVKLIGY  143



>ref|XP_010256925.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
 ref|XP_010256926.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=415

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G++SKCV S DG+ +  S S+ S    P TP+  GEI+ S NLKSF+F++LKMATR+FR 
Sbjct  18   GVNSKCV-SKDGNDVSGSSSRASATSVPLTPRGAGEIIPSSNLKSFSFSELKMATRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+N+L+  KPGTG++IAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDENALTAAKPGTGMIIAVKRLNQEGYQGHREWLAEVNYLGQLY  136

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  137  HPNLVKLIGYC  147



>ref|XP_007205264.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
 gb|EMJ06463.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
Length=414

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            G++SK ++STDG+       S  S P TP+SEGEILQS NLKSF+F DLKMATR+FR DS
Sbjct  18   GVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKSFSFNDLKMATRNFRPDS  76

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QGH EWLAE+NYLGQF HP
Sbjct  77   VLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQGHREWLAEVNYLGQFHHP  136

Query  529  NLVKLIGYC  555
            NLVKLIG+C
Sbjct  137  NLVKLIGFC  145



>gb|KJB36716.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=283

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SEGEILQS NLK+FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKP
Sbjct  43   PQTPRSEGEILQSSNLKTFTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKP  102

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG++IAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  103  GTGIIIAVKRLNQEGFQGHKEWLAEINYLGQLHHPNLVKLIGYC  146



>ref|XP_008223637.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
 ref|XP_008223643.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=414

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            G++SK ++STDG+       S  S P TP+SEGEILQS NLKSF+F DLKMATR+FR DS
Sbjct  18   GVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKSFSFNDLKMATRNFRPDS  76

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN    QGH EWLAE+NYLGQF HP
Sbjct  77   VLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESFQGHREWLAEVNYLGQFHHP  136

Query  529  NLVKLIGYC  555
            NLVKLIG+C
Sbjct  137  NLVKLIGFC  145



>ref|XP_010414461.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG S K + S   D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR 
Sbjct  14   PGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGY  552
            HPNLVKLIGY
Sbjct  134  HPNLVKLIGY  143



>ref|XP_010470020.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG S K + S   D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR 
Sbjct  14   PGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGY  552
            HPNLVKLIGY
Sbjct  134  HPNLVKLIGY  143



>ref|XP_009124367.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124368.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124369.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 emb|CDY47885.1| BnaA07g14300D [Brassica napus]
Length=413

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            G+SSK + S   D   +G   S  S    P++EGEILQSPNLKSF+  +LK ATR+FR D
Sbjct  18   GVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLKSFSLDELKSATRNFRQD  77

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFSH
Sbjct  78   SVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDGWQGHQEWLAEVNYLGQFSH  137

Query  526  PNLVKLIGYC  555
            PNLVKLIGYC
Sbjct  138  PNLVKLIGYC  147



>ref|XP_009124366.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Brassica 
rapa]
Length=419

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            G+SSK + S   D   +G   S  S    P++EGEILQSPNLKSF+  +LK ATR+FR D
Sbjct  24   GVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLKSFSLDELKSATRNFRQD  83

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQFSH
Sbjct  84   SVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDGWQGHQEWLAEVNYLGQFSH  143

Query  526  PNLVKLIGYC  555
            PNLVKLIGYC
Sbjct  144  PNLVKLIGYC  153



>ref|XP_010264446.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=413

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVI--STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            G++SK V     D SG     S  S PQTP+SEGEIL S NLKSF+F +LKMATR+FR D
Sbjct  18   GVNSKYVSKDENDVSGASSKVSAASVPQTPRSEGEILLSSNLKSFSFNELKMATRNFRPD  77

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+++ +  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  H
Sbjct  78   SVLGEGGFGSVFKGWIDEHAFTAAKPGTGIVIAVKRLNQEGFQGHKEWLAEVNYLGQLYH  137

Query  526  PNLVKLIGYC  555
            PNLVKLIGYC
Sbjct  138  PNLVKLIGYC  147



>emb|CDX95754.1| BnaC03g26350D [Brassica napus]
Length=404

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRLDSVLGEGGFG 
Sbjct  28   ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  88   VFKGWIDEESLTASKPGTGMVIAVKRLNKEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>ref|XP_003616403.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES99361.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  GSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFK  384
            G   GK  +  + P TP++EGEIL+S N+KSFTF++LK ATR+FR DSV+GEGGFG VFK
Sbjct  32   GRSSGKVSTAPTAPPTPRTEGEILKSSNMKSFTFSELKTATRNFRPDSVVGEGGFGAVFK  91

Query  385  GWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GWID+N+L P +PGTG+VIAVKRLN  GLQGHSEWL E+NYLGQ  HPNLVKLIGYC
Sbjct  92   GWIDENTLVPVRPGTGVVIAVKRLNQEGLQGHSEWLTEINYLGQLHHPNLVKLIGYC  148



>ref|XP_006294292.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
 gb|EOA27190.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
Length=414

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            PG S K + S   D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR 
Sbjct  14   PGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRP  73

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFS
Sbjct  74   DSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFS  133

Query  523  HPNLVKLIGY  552
            HPNLVKLIGY
Sbjct  134  HPNLVKLIGY  143



>gb|KDP35639.1| hypothetical protein JCGZ_09077 [Jatropha curcas]
Length=392

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL+SK   S DG  L    SK S    PQTP+SEGEILQSPNLK+F+F++L+ +TR+FR 
Sbjct  18   GLNSKSA-SRDGKNLSSVSSKVSSASIPQTPRSEGEILQSPNLKNFSFSELRTSTRNFRP  76

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++SLS TKP +G+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  77   DSVLGEGGFGSVFKGWIDEHSLSATKPDSGMVIAVKRLNQEGFQGHKEWLAEINYLGQLE  136

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  137  HPNLVKLIGYC  147



>gb|KJB55871.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55873.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=475

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  172  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSSK V S   D S      S  S P TP+SEGEILQSPNLK F+FADLKMATR+FR D
Sbjct  88   GLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKCFSFADLKMATRNFRPD  147

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G QGH EWLAE+NYLGQ  H
Sbjct  148  SVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEGFQGHREWLAEVNYLGQLYH  207

Query  526  PNLVKLIGYC  555
            P++VKLIGYC
Sbjct  208  PHIVKLIGYC  217



>ref|XP_010470021.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470022.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470023.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
Length=394

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  5    ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  64

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  65   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGY  123



>ref|XP_011011763.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Populus euphratica]
Length=399

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 106/135 (79%), Gaps = 12/135 (9%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATR  330
            GLSSKC     GS  GK+        S  S PQTP+SEGEIL+S NLK+FTF +LK ATR
Sbjct  18   GLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILESSNLKTFTFGELKTATR  72

Query  331  DFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYL  510
            +FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN  G QGH EWLAE+NYL
Sbjct  73   NFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLNQEGFQGHREWLAEINYL  132

Query  511  GQFSHPNLVKLIGYC  555
            GQF HPNLVKLIG+C
Sbjct  133  GQFQHPNLVKLIGFC  147



>emb|CDX83305.1| BnaA03g22010D [Brassica napus]
Length=404

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRLDSVLGEGGFG 
Sbjct  28   ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  88   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>dbj|BAD12263.1| protein kinase [Brassica rapa]
Length=404

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRLDSVLGEGGFG 
Sbjct  28   ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  88   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>ref|NP_001288898.1| protein kinase APK1B, chloroplastic-like [Brassica rapa]
 gb|ABP01775.1| MLPK isoform 2 [Brassica rapa]
Length=410

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRLDSVLGEGGFG 
Sbjct  34   ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLDSVLGEGGFGC  93

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  94   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  153



>ref|XP_006307674.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 ref|XP_006307675.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40572.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40573.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
Length=410

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K      GS LG   S  S   TP++EGEILQSPNLKSF+FA+LK ATR+FR DS
Sbjct  14   PGTSPKYDAKDTGS-LGSKASSVSVRPTPRTEGEILQSPNLKSFSFAELKSATRNFRPDS  72

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH 
Sbjct  73   VLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHG  132

Query  529  NLVKLIGYC  555
            +LVKLIGYC
Sbjct  133  HLVKLIGYC  141



>ref|XP_010414460.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  28   ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  88   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGY  146



>ref|XP_010510560.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Camelina 
sativa]
Length=417

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  28   ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  88   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGY  146



>ref|NP_001031439.1| protein kinase APK1B [Arabidopsis thaliana]
 sp|P46573.2|APK1B_ARATH RecName: Full=Protein kinase APK1B, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC33221.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15075.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08190.1| protein kinase APK1B [Arabidopsis thaliana]
Length=412

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K + S     LG   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DS
Sbjct  14   PGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDS  73

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHP
Sbjct  74   VLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHP  133

Query  529  NLVKLIGYC  555
            NLVKLIGYC
Sbjct  134  NLVKLIGYC  142



>ref|XP_006409926.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
 gb|ESQ51379.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
Length=417

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQSPNLKSF+FA+LK+ATR+FR DSVLGEGGFG VFKGWID+ SLS +KPGTG
Sbjct  47   PRTEGEILQSPNLKSFSFAELKLATRNFRPDSVLGEGGFGCVFKGWIDEQSLSASKPGTG  106

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +VIAVKRLN  G QGH EWLAE+NYLGQFSHP+LVKLIGYC
Sbjct  107  MVIAVKRLNQDGWQGHQEWLAEVNYLGQFSHPHLVKLIGYC  147



>gb|KJB36715.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=397

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SEGEILQS NLK+FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKP
Sbjct  43   PQTPRSEGEILQSSNLKTFTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKP  102

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG++IAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  103  GTGIIIAVKRLNQEGFQGHKEWLAEINYLGQLHHPNLVKLIGYC  146



>ref|XP_010470019.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  28   ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGY
Sbjct  88   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGY  146



>ref|NP_001031440.1| protein kinase APK1B [Arabidopsis thaliana]
 gb|AEC08191.1| protein kinase APK1B [Arabidopsis thaliana]
Length=415

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K + S     LG   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DS
Sbjct  17   PGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDS  76

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQFSHP
Sbjct  77   VLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHP  136

Query  529  NLVKLIGYC  555
            NLVKLIGYC
Sbjct  137  NLVKLIGYC  145



>emb|CDY06715.1| BnaA10g04940D [Brassica napus]
Length=408

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 101/129 (78%), Gaps = 3/129 (2%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K     D   LG   S  S   TP+SEGEILQSPNLKSF+FA+LK ATR+FR DS
Sbjct  14   PGASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFSFAELKSATRNFRPDS  70

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH 
Sbjct  71   VLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHG  130

Query  529  NLVKLIGYC  555
            +LVKLIGYC
Sbjct  131  HLVKLIGYC  139



>ref|XP_009118950.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Brassica 
rapa]
Length=408

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 101/129 (78%), Gaps = 3/129 (2%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K     D   LG   S  S   TP+SEGEILQSPNLKSF+FA+LK ATR+FR DS
Sbjct  14   PGASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFSFAELKSATRNFRPDS  70

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH 
Sbjct  71   VLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHG  130

Query  529  NLVKLIGYC  555
            +LVKLIGYC
Sbjct  131  HLVKLIGYC  139



>ref|XP_002892407.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68666.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D + LG   S  S   +P++EGEILQSPNLKSF+FADLK ATR+FR DSVLGEGGFG 
Sbjct  22   AKDTASLGSKGSSVSVRPSPRTEGEILQSPNLKSFSFADLKSATRNFRPDSVLGEGGFGC  81

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  82   VFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYC  141



>ref|XP_010678047.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  STDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            S DG     S  S  S PQTP+SEGEILQS NLK+F+F +LK ATR+FR DSVLGEGGFG
Sbjct  26   SKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKNFSFNELKTATRNFRPDSVLGEGGFG  85

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             VFKGWID+++L+PT+PGTG+VIAVKRLN  G QGH EWL E+NYLGQ  HPNLV+LIGY
Sbjct  86   AVFKGWIDEHALTPTRPGTGIVIAVKRLNQEGPQGHKEWLTEINYLGQLRHPNLVRLIGY  145

Query  553  C  555
            C
Sbjct  146  C  146



>ref|NP_180459.2| protein kinase APK1B [Arabidopsis thaliana]
 gb|ABM06025.1| At2g28930 [Arabidopsis thaliana]
 gb|AEC08189.1| protein kinase APK1B [Arabidopsis thaliana]
Length=423

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  53   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  112

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  113  VVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  153



>emb|CDX95143.1| BnaC05g05280D [Brassica napus]
Length=408

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 3/129 (2%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K     D   LG   S  S   TP++EGEILQSPNLKSF+FA+LK ATR+FR DS
Sbjct  14   PGASPKF---KDTGSLGSKGSSVSVRPTPRTEGEILQSPNLKSFSFAELKSATRNFRPDS  70

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH 
Sbjct  71   VLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHG  130

Query  529  NLVKLIGYC  555
            +LVKLIGYC
Sbjct  131  HLVKLIGYC  139



>ref|XP_003519344.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 1 
[Glycine max]
 gb|KHN41092.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=392

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 103/132 (78%), Gaps = 9/132 (7%)
 Frame = +1

Query  172  GLSSKCVISTDGS----GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFR  339
            GLSSK     DG+    GL    S  S P TP++EGEIL+S N+KSF F++LK ATR+FR
Sbjct  18   GLSSK-----DGNKEEDGLSSKASTPSVPPTPRTEGEILKSSNMKSFNFSELKTATRNFR  72

Query  340  LDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQF  519
             DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGHSEWL E+NYLGQ 
Sbjct  73   PDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGHSEWLTEINYLGQL  132

Query  520  SHPNLVKLIGYC  555
             HPNLVKLIGYC
Sbjct  133  RHPNLVKLIGYC  144



>gb|ACU19261.1| unknown [Glycine max]
Length=392

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 103/132 (78%), Gaps = 9/132 (7%)
 Frame = +1

Query  172  GLSSKCVISTDGS----GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFR  339
            GLSSK     DG+    GL    S  S P TP++EGEIL+S N+KSF F++LK ATR+FR
Sbjct  18   GLSSK-----DGNKEEDGLSSKASTPSVPPTPRTEGEILKSSNMKSFNFSELKTATRNFR  72

Query  340  LDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQF  519
             DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGHSEWL E+NYLGQ 
Sbjct  73   PDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGHSEWLTEINYLGQL  132

Query  520  SHPNLVKLIGYC  555
             HPNLVKLIGYC
Sbjct  133  RHPNLVKLIGYC  144



>ref|XP_010678048.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  STDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            S DG     S  S  S PQTP+SEGEILQS NLK+F+F +LK ATR+FR DSVLGEGGFG
Sbjct  25   SKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKNFSFNELKTATRNFRPDSVLGEGGFG  84

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             VFKGWID+++L+PT+PGTG+VIAVKRLN  G QGH EWL E+NYLGQ  HPNLV+LIGY
Sbjct  85   AVFKGWIDEHALTPTRPGTGIVIAVKRLNQEGPQGHKEWLTEINYLGQLRHPNLVRLIGY  144

Query  553  C  555
            C
Sbjct  145  C  145



>ref|XP_002879189.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55448.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  55   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  114

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +VIAVK+LN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  115  VVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  155



>ref|XP_010554610.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=397

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTP-KSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            S+D  GL  S  K+S      K+EGEILQS ++KSFTF +LK+ATR+FR DSV+GEGGFG
Sbjct  25   SSDLYGLSLSSQKSSMTTVSHKTEGEILQSASVKSFTFNELKLATRNFRPDSVVGEGGFG  84

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             VFKGWID+N+L+PTKPGTGLVIAVKRLN  GLQGH EWL E+NYLGQ +HPNLVKLIGY
Sbjct  85   SVFKGWIDENTLTPTKPGTGLVIAVKRLNQEGLQGHREWLTEINYLGQLNHPNLVKLIGY  144

Query  553  C  555
            C
Sbjct  145  C  145



>emb|CDX77220.1| BnaC04g40150D [Brassica napus]
Length=418

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSF+FA++K ATR+FR DSVLGEGGFG 
Sbjct  28   ANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFSFAEVKSATRNFRPDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  88   VFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQGHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>gb|AGP76187.1| MLPK [Brassica rapa subsp. chinensis]
Length=418

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSF+FA++K ATR+FR DSVLGEGGFG 
Sbjct  28   ANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFSFAEVKSATRNFRPDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  88   VFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQGHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_002534306.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF28074.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=389

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SEGEILQS NLK+F+FA+L+ ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKP
Sbjct  41   PQTPRSEGEILQSSNLKNFSFAELRNATRNFRPDSVLGEGGFGSVFKGWIDEQSLTATKP  100

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  101  GSGVVIAVKRLNQEGFQGHREWLAEINYLGQLQHPNLVKLIGYC  144



>ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine 
max]
 gb|KHN20929.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=399

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GLSSK   + +  GL    S  S P TP++EGEIL+S N+KSF F++LK ATR+FR DSV
Sbjct  18   GLSSKDG-NKEEDGLSSKVSTPSDPPTPRTEGEILKSSNMKSFNFSELKTATRNFRPDSV  76

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            +GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  GLQGHSEWL E+NYLGQ  HPN
Sbjct  77   VGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEGLQGHSEWLTEINYLGQLRHPN  136

Query  532  LVKLIGYC  555
            LVKLIGYC
Sbjct  137  LVKLIGYC  144



>emb|CDY31741.1| BnaA04g16770D [Brassica napus]
Length=418

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSF+FA++K ATR+FR DSVLGEGGFG 
Sbjct  28   ANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFSFAEVKSATRNFRPDSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  88   VFKGWIDEQSLTASKPGTGMVIAVKRLNQDGWQGHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_010542648.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=257

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S+DG+  G   SK S      TP++EGEILQSP L SF+FA+LK ATR+FR DSVLGEG
Sbjct  21   MSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLNSFSFAELKAATRNFRPDSVLGEG  80

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G QGH EWL E+N+LGQFSHP+LVKL
Sbjct  81   GFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDGWQGHKEWLTEVNFLGQFSHPHLVKL  140

Query  544  IGYC  555
            IGYC
Sbjct  141  IGYC  144



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = +1

Query  205  GSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            G+ L  ++SK S    P TP+SEGEILQS NLKS+T A+LK ATR+FR DSVLGEGGFG 
Sbjct  28   GNDLSSTNSKVSAASVPPTPRSEGEILQSSNLKSYTLAELKSATRNFRPDSVLGEGGFGS  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+N+L   KPGTG+VIAVKRLN    QGH EWLAE+NYLGQFSHP+LV+LIGYC
Sbjct  88   VFKGWIDENTLVAAKPGTGIVIAVKRLNQESFQGHREWLAEVNYLGQFSHPHLVRLIGYC  147



>emb|CBI16124.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +STDG+    + SK    S P TP+SEG+ILQSPNLK+FTF++LKMATR+FR DSVLGEG
Sbjct  24   VSTDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNLKNFTFSELKMATRNFRPDSVLGEG  83

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID+ S +  +PGTG+VIAVKRLN    QGH EWLAE+NYLGQ  HP+LVKL
Sbjct  84   GFGSVFKGWIDEQSFAAARPGTGMVIAVKRLNLESFQGHKEWLAEVNYLGQLYHPHLVKL  143

Query  544  IGYC  555
            IG+C
Sbjct  144  IGFC  147



>ref|XP_011089469.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
 ref|XP_011089470.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
Length=406

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S+DG  +    SK    S P TP++EGEILQS NLKSF+F+DLK+ATR+FR DSVLG G
Sbjct  24   VSSDGYDMSLGSSKISSTSVPPTPRTEGEILQSSNLKSFSFSDLKVATRNFRPDSVLGGG  83

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID+NS +  KPGTG++IAVK+L+    QGH EWLAE+NYLGQFSHPNLVKL
Sbjct  84   GFGSVFKGWIDENSFTAAKPGTGMIIAVKKLHQESYQGHREWLAEVNYLGQFSHPNLVKL  143

Query  544  IGYC  555
            IGYC
Sbjct  144  IGYC  147



>ref|XP_006846202.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
 gb|ERN07877.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
Length=405

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 103/131 (79%), Gaps = 11/131 (8%)
 Frame = +1

Query  196  STDGSGL-GKSDSK-----NSPPQ-----TPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            S   SGL  +S SK     NSPP      TPKSEGEILQS N+KSF+FA+LK ATR+FR 
Sbjct  21   SVPASGLDSRSSSKDGVDPNSPPSGSVPPTPKSEGEILQSSNVKSFSFAELKAATRNFRP  80

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID+++ +PTKPGTG+VIAVKR N  G QGH EWLAE+NYLGQ S
Sbjct  81   DSVLGEGGFGSVFKGWIDEHTFAPTKPGTGIVIAVKRHNQDGYQGHREWLAEVNYLGQLS  140

Query  523  HPNLVKLIGYC  555
            HPNLVKLIG+C
Sbjct  141  HPNLVKLIGFC  151



>ref|XP_010685751.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK-NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            G++SK V S DG+      SK +S P TP+SEGEILQS NLK+F+F++LK ATR+FR DS
Sbjct  18   GINSKYV-SKDGNDPTFPSSKVSSAPLTPRSEGEILQSSNLKNFSFSELKAATRNFRPDS  76

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN    QGH EWLAE+NYLGQ  HP
Sbjct  77   VLGEGGFGSVFKGWIDENSYAATKPGTGMVIAVKRLNQESYQGHREWLAEVNYLGQLYHP  136

Query  529  NLVKLIGYC  555
            +LVKL+GYC
Sbjct  137  HLVKLVGYC  145



>ref|XP_009133858.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Brassica rapa]
Length=381

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRL SVLGEGGFG 
Sbjct  5    ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLYSVLGEGGFGC  64

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  65   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  124



>ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=410

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +1

Query  223  SDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKN  402
            S S ++ P TP++EGEILQS NLKSF+F +LK ATR+FR DSVLGEGGFG VFKGWID++
Sbjct  32   SGSSSAVPSTPRTEGEILQSSNLKSFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEH  91

Query  403  SLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            SL+  KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  92   SLTAAKPGTGIVIAVKRLNQEGFQGHQEWLAEINYLGQLDHPNLVKLIGYC  142



>ref|XP_010543301.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=387

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSS+  +S DGS   K  S  S    P+SEGEILQSPNLK+F F DLK ATR+FR DSV+
Sbjct  19   LSSR-FLSRDGS---KCSSTASFSHGPRSEGEILQSPNLKNFCFGDLKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+NS + +KPG+G+V+AVKRLN  G QGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGSVFKGWIDENSFAASKPGSGIVVAVKRLNQEGFQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>gb|AIU96237.1| serine/threonine-protein kinase BIK1, partial [Nicotiana benthamiana]
Length=196

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            ++DG  L    S +S P TP+S+ EIL+S NL SF+F +L++ATR+FR DSVLGEGGFG 
Sbjct  19   ASDGRDLSSRLSYSSAPLTPRSQNEILESTNLNSFSFNELRVATRNFRPDSVLGEGGFGC  78

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+++    +PGTGLVIAVKRLN  G QGH EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  79   VFKGWIDEHTFKSARPGTGLVIAVKRLNQEGFQGHKEWLAEINYLGSLSHPNLVKLIGYC  138



>ref|XP_002283646.2| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
 ref|XP_010651014.1| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
Length=442

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +STDG+    + SK    S P TP+SEG+ILQSPNLK+FTF++LKMATR+FR DSVLGEG
Sbjct  24   VSTDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNLKNFTFSELKMATRNFRPDSVLGEG  83

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID+ S +  +PGTG+VIAVKRLN    QGH EWLAE+NYLGQ  HP+LVKL
Sbjct  84   GFGSVFKGWIDEQSFAAARPGTGMVIAVKRLNLESFQGHKEWLAEVNYLGQLYHPHLVKL  143

Query  544  IGYC  555
            IG+C
Sbjct  144  IGFC  147



>gb|KHF99777.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=402

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQ  NLKSF+FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KP
Sbjct  38   PLTPRSEGEILQCTNLKSFSFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKP  97

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  98   GTGIVIAVKRLNQEGFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  141



>ref|XP_006339025.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=413

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL S+ V S +G+ +  S+SK+S    P TP+SEGEILQS NL+SFTF++L+ ATR+FR 
Sbjct  20   GLDSRNV-SGNGTDISNSNSKHSSASVPPTPRSEGEILQSSNLRSFTFSELRSATRNFRP  78

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ  
Sbjct  79   DSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQEGWQGHREWLAEINYLGQLH  138

Query  523  HPNLVKLIGYC  555
            HPNLV LIGYC
Sbjct  139  HPNLVNLIGYC  149



>ref|XP_002266032.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654281.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654282.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI30550.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP++EGEILQ+ NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL  T+P
Sbjct  44   PQTPRTEGEILQASNLKSFGFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENSLMATRP  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G+V+AVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  104  GAGMVVAVKRLNQEGFQGHREWLAEINYLGQLQHPNLVKLIGYC  147



>ref|XP_009133856.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
 ref|XP_009133857.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
Length=404

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRL SVLGEGGFG 
Sbjct  28   ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLYSVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G QGH EWLAE+NYLG+ SHPNLVKLIGYC
Sbjct  88   VFKGWIDEESLTASKPGTGMVIAVKRLNIEGWQGHQEWLAEVNYLGRLSHPNLVKLIGYC  147



>ref|XP_004142761.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004170949.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN51318.1| hypothetical protein Csa_5G517160 [Cucumis sativus]
Length=401

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSS+   + DG+  G S SK+S   P+TP++EGEILQS NLK+F++ +LK ATR+FR D
Sbjct  18   GLSSR--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLKNFSYNELKAATRNFRPD  75

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+ S + TKPGTGLVIAVKRLN  G QGH EWL E++YLGQ  H
Sbjct  76   SVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHH  135

Query  526  PNLVKLIGYC  555
            PNLV+LIG+C
Sbjct  136  PNLVRLIGFC  145



>emb|CDY09904.1| BnaC08g45470D [Brassica napus]
Length=406

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +1

Query  169  PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            PG S K     D   LG   S  S   +P++EGEILQSPNLKSF+F++LK ATR+FR DS
Sbjct  14   PGASPK-----DTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFSFSELKSATRNFRPDS  68

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+ SLS T+PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH 
Sbjct  69   VLGEGGFGCVFKGWIDEKSLSATRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHG  128

Query  529  NLVKLIGYC  555
            +LVKLIGYC
Sbjct  129  HLVKLIGYC  137



>ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum]
Length=414

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G++S  ++S DG+ L  S SK S    P TP++EGEILQS NLKSFTF+DLK ATR+FR 
Sbjct  20   GVNSSKMVSGDGTELSNSVSKASSASVPPTPRTEGEILQSSNLKSFTFSDLKAATRNFRP  79

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++SL+ ++PG+ +V+AVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  80   DSVLGEGGFGSVFKGWIDESSLAASRPGSSMVVAVKRLNQEGWQGHKEWLAEINYLGQLR  139

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  140  HPNLVKLIGYC  150



>ref|XP_010685750.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSK-NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDS  348
            G++SK V S DG+      SK +S P TP+SEGEILQS NLK+F+F++LK ATR+FR DS
Sbjct  27   GINSKYV-SKDGNDPTFPSSKVSSAPLTPRSEGEILQSSNLKNFSFSELKAATRNFRPDS  85

Query  349  VLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHP  528
            VLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN    QGH EWLAE+NYLGQ  HP
Sbjct  86   VLGEGGFGSVFKGWIDENSYAATKPGTGMVIAVKRLNQESYQGHREWLAEVNYLGQLYHP  145

Query  529  NLVKLIGYC  555
            +LVKL+GYC
Sbjct  146  HLVKLVGYC  154



>ref|XP_009404596.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            S +G     S SK S P TP+SE EILQS N+KSFTF++LK ATR+FR DSVLGEGGFG 
Sbjct  29   SREGKAFSSSSSKVSVPPTPRSEDEILQSSNVKSFTFSELKTATRNFRPDSVLGEGGFGS  88

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGW+D+++ +PTKPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLV+LIGYC
Sbjct  89   VFKGWVDEHTFAPTKPGTGMVIAVKKLNQDGHQGHREWLAEVNYLGQLSHPNLVRLIGYC  148



>gb|ACG32116.1| protein kinase APK1B [Zea mays]
Length=419

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 109/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQ  279
            RIK GS +P +S         G+ SK     DGS L    S+ S    P   K+E EILQ
Sbjct  8    RIKDGSPHPGAS---------GMFSKSS-GKDGSRLSGCSSRASSASMPPSAKTECEILQ  57

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLN
Sbjct  58   SANVKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLN  117

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            H GLQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  118  HEGLQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_004165801.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase APK1A, chloroplastic-like 
[Cucumis sativus]
Length=404

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +STDG+ +G ++SK    S P TP++EGEILQS NLKSF+F +LK ATR+FR DSV+GEG
Sbjct  24   VSTDGNDIGSTNSKINLLSVPPTPRTEGEILQSSNLKSFSFTELKAATRNFRPDSVVGEG  83

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID++S +  KPGTG+VIAVKRLN  G QGH EWLAE+N+LGQ SH +LV+L
Sbjct  84   GFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDGFQGHREWLAEVNFLGQLSHCHLVRL  143

Query  544  IGYC  555
            +GYC
Sbjct  144  VGYC  147



>gb|KJB83756.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
 gb|KJB83757.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
Length=402

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP++EGEILQ  NLKSF+FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KP
Sbjct  38   PLTPRTEGEILQCTNLKSFSFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKP  97

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  98   GTGIVIAVKRLNQEGFQGHKEWLAEVNYLGQLYHPNLVKLIGYC  141



>ref|XP_010920578.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Elaeis guineensis]
Length=420

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            G++SKC  S DG G   S   ++   P TP+SEGEILQS N+KSFTF +L+ ATR+FR D
Sbjct  29   GVNSKCS-SRDGKGSVSSSRVSAASVPPTPRSEGEILQSSNVKSFTFNELRNATRNFRPD  87

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+++ + TKPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ +H
Sbjct  88   SVLGEGGFGSVFKGWIDEHTFAATKPGTGIVIAVKKLNQEGFQGHREWLAEVNYLGQLAH  147

Query  526  PNLVKLIGYC  555
            PNLVKLIGYC
Sbjct  148  PNLVKLIGYC  157



>ref|XP_004143118.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN47146.1| hypothetical protein Csa_6G190370 [Cucumis sativus]
Length=404

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +STDG+ +G ++SK    S P TP++EGEILQS NLKSF+F +LK ATR+FR DSV+GEG
Sbjct  24   VSTDGNDIGSTNSKINLLSVPPTPRTEGEILQSSNLKSFSFTELKAATRNFRPDSVVGEG  83

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID++S +  KPGTG+VIAVKRLN  G QGH EWLAE+N+LGQ SH +LV+L
Sbjct  84   GFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDGFQGHREWLAEVNFLGQLSHCHLVRL  143

Query  544  IGYC  555
            +GYC
Sbjct  144  VGYC  147



>emb|CDP06608.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDG---SGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S DG   S L    S  S  QTP+SEGEIL+S NLKSFTF +LK ATR+FR DSVLGEG
Sbjct  26   VSEDGTQTSNLSSKASSFSMCQTPRSEGEILESSNLKSFTFGELKAATRNFRPDSVLGEG  85

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID+ S + +KPGTG+V+AVKRLN  G QGH EWLAE+NYLGQ  HPNLVKL
Sbjct  86   GFGSVFKGWIDEQSQAASKPGTGIVVAVKRLNQDGWQGHKEWLAEINYLGQLRHPNLVKL  145

Query  544  IGYC  555
            IGYC
Sbjct  146  IGYC  149



>ref|XP_008464124.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Cucumis melo]
Length=404

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = +1

Query  190  VISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGE  360
             +STDG+ +G ++SK    S P TP++EGEILQS NLKSF+F +LK ATR+FR DSV+GE
Sbjct  23   AVSTDGNDIGSTNSKINLLSMPPTPRTEGEILQSSNLKSFSFTELKAATRNFRPDSVVGE  82

Query  361  GGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVK  540
            GGFG VFKGWID++S +  KPGTG+VIAVKRLN  G QGH EWLAE+N+LGQ SH +LV+
Sbjct  83   GGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDGFQGHREWLAEVNFLGQLSHCHLVR  142

Query  541  LIGYC  555
            L+GYC
Sbjct  143  LVGYC  147



>ref|NP_172237.1| protein kinase APK1A [Arabidopsis thaliana]
 ref|NP_973778.1| protein kinase APK1A [Arabidopsis thaliana]
 sp|Q06548.1|APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02092.1| tyrosine-serine-threonine kinase [Arabidopsis thaliana]
 gb|AAO42086.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AAO50645.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28143.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28144.1| protein kinase APK1A [Arabidopsis thaliana]
Length=410

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   LG   S  S   +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG 
Sbjct  22   AKDIGSLGSKASSVSVRPSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGC  81

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  82   VFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYC  141



>ref|XP_010542646.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010542647.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S+DG+  G   SK S      TP++EGEILQSP L SF+FA+LK ATR+FR DSVLGEG
Sbjct  21   MSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLNSFSFAELKAATRNFRPDSVLGEG  80

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G QGH EWL E+N+LGQFSHP+LVKL
Sbjct  81   GFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDGWQGHKEWLTEVNFLGQFSHPHLVKL  140

Query  544  IGYC  555
            IGYC
Sbjct  141  IGYC  144



>ref|XP_010030960.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50195.1| hypothetical protein EUGRSUZ_J00006 [Eucalyptus grandis]
Length=409

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP++EGEILQS NLKSF F DLK ATR+FR DSVLGEGGFG VFKGWID+ + +  +P
Sbjct  43   PQTPRTEGEILQSSNLKSFAFNDLKTATRNFRPDSVLGEGGFGCVFKGWIDEQTFTAARP  102

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTGLVIAVKRLN  GLQGH EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  103  GTGLVIAVKRLNQEGLQGHKEWLAEINYLGQLYHPNLVKLIGFC  146



>ref|XP_004249535.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=413

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL S+ V S +G+ +  S+SK S    P TP+SEGEILQS NL+SFTF +L+ ATR+FR 
Sbjct  20   GLDSRNV-SGNGTDISNSNSKRSSASIPPTPRSEGEILQSSNLRSFTFNELRSATRNFRP  78

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ  
Sbjct  79   DSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQEGWQGHREWLAEINYLGQLH  138

Query  523  HPNLVKLIGYC  555
            HPNLV LIGYC
Sbjct  139  HPNLVNLIGYC  149



>ref|XP_008458866.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis melo]
Length=401

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  345
            GLSSK   + DG+  G S SK+S   P+TP++EGEILQS NLK+F + +LK ATR+FR D
Sbjct  18   GLSSK--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLKNFAYNELKAATRNFRPD  75

Query  346  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSH  525
            SVLGEGGFG VFKGWID+ S + TKPGTGLVIAVK+LN  G QGH EWL E++YLGQ  H
Sbjct  76   SVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKKLNQEGFQGHREWLTEIDYLGQLHH  135

Query  526  PNLVKLIGYC  555
            PNLV+LIG+C
Sbjct  136  PNLVRLIGFC  145



>emb|CDY39519.1| BnaC04g15180D [Brassica napus]
Length=396

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQSPNLKSF+  +LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG
Sbjct  24   PRTEGEILQSPNLKSFSLDELKSATRNFRQDSVLGEGGFGCVFKGWIDEQSLTASKPGTG  83

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +VIAVKRLN  G QGH EWLAE+NYLGQFSHPNLVKLIGYC
Sbjct  84   MVIAVKRLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYC  124



>ref|XP_004236745.1| PREDICTED: protein kinase APK1A, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            ++DG  L    S +S P TP+S+ EIL+S NLKSF+F +L++ATR+FR DSVLGEGGFG 
Sbjct  19   ASDGRELSSRHSYSSAPLTPRSQSEILESSNLKSFSFNELRVATRNFRPDSVLGEGGFGC  78

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+N+    +PGTGLVIAVKRLN  G QGH EWLAE+ YL Q SHPNLVKLIGYC
Sbjct  79   VFKGWIDENTFKAARPGTGLVIAVKRLNQEGFQGHKEWLAEITYLSQLSHPNLVKLIGYC  138



>ref|XP_008357182.1| PREDICTED: protein kinase APK1A, chloroplastic [Malus domestica]
Length=418

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = +1

Query  196  STDG--SGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGF  369
            S DG  S   K  S  +PP TP+SEGEILQS NLKSF+F +LKMATR+FR DSVLGEGGF
Sbjct  23   SNDGNLSASSKVSSYTAPP-TPRSEGEILQSSNLKSFSFNNLKMATRNFRPDSVLGEGGF  81

Query  370  GPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIG  549
            G VFKGWID+NS +  KPGTG+V+AVKRLN    QGH EWLAE+NYLGQ  HPNLVKLIG
Sbjct  82   GSVFKGWIDENSFTAAKPGTGIVLAVKRLNQESYQGHREWLAEVNYLGQLYHPNLVKLIG  141

Query  550  YC  555
            +C
Sbjct  142  FC  143



>ref|XP_009118427.1| PREDICTED: protein kinase APK1A, chloroplastic [Brassica rapa]
 emb|CDY06271.1| BnaA09g49320D [Brassica napus]
Length=406

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  202  DGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVF  381
            D   LG   S  S   +P++EGEILQSPNLKSF+F++LK ATR+FR DSVLGEGGFG VF
Sbjct  20   DTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFSFSELKSATRNFRPDSVLGEGGFGCVF  79

Query  382  KGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            KGWID+ SL+ T+PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  80   KGWIDEKSLTATRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHGHLVKLIGYC  137



>ref|XP_010534501.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=396

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTP--KSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGF  369
            S+D  GL  S S+ SP  T   K+EGEILQS ++KSF+F +LK+ATR+FR DSV+GEGGF
Sbjct  24   SSDLYGLSLS-SRKSPITTASHKTEGEILQSASVKSFSFNELKLATRNFRPDSVIGEGGF  82

Query  370  GPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIG  549
            G VFKGWID+++L+PTKPGTGLVIAVKRLN  G QGH EWLAE+NYLGQ +HPNLVKLIG
Sbjct  83   GSVFKGWIDESTLTPTKPGTGLVIAVKRLNQEGFQGHREWLAEINYLGQLNHPNLVKLIG  142

Query  550  YC  555
            YC
Sbjct  143  YC  144



>ref|NP_001184929.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28145.1| protein kinase APK1A [Arabidopsis thaliana]
Length=424

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   LG   S  S   +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG 
Sbjct  36   AKDIGSLGSKASSVSVRPSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGC  95

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  96   VFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYC  155



>ref|NP_001145874.1| uncharacterized protein LOC100279389 [Zea mays]
 gb|ACL52773.1| unknown [Zea mays]
Length=419

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 109/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQ  279
            RIK GS +P +S         G+ SK     DGS L    S+ S    P   K+E EIL+
Sbjct  8    RIKDGSPHPGAS---------GMFSKSS-GKDGSRLSGCSSRASSASMPPSAKTECEILR  57

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLN
Sbjct  58   SANVKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLN  117

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            H GLQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  118  HEGLQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_010558329.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Tarenaya hassleriana]
Length=345

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  53   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  112

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  113  SGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYC  155



>ref|XP_006429091.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
 ref|XP_006480830.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Citrus sinensis]
 gb|ESR42331.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
Length=398

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SEGEILQS N+K+F+++DLK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+P
Sbjct  44   PQTPRSEGEILQSSNIKNFSYSDLKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLTSTRP  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG++IAVKRLN  G QGH EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  104  GTGMLIAVKRLNQEGFQGHKEWLTEINYLGQLHHPNLVKLVGYC  147



>ref|XP_009610452.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=414

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL S+   S +G+    S+SK S    P TP+SEGEILQS NL+S+TF++L+ ATR+FR 
Sbjct  21   GLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQSSNLRSYTFSELRAATRNFRP  79

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ  
Sbjct  80   DSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQEGWQGHREWLAEINYLGQLH  139

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  140  HPNLVKLIGYC  150



>ref|XP_010558327.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010558328.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
Length=392

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  39   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  98

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  99   SGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYC  141



>ref|XP_009759469.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=395

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            ++DG  L    S +S P TP+S+ EIL+S NLKSF+F +L++ATR+FR DSVLGEGGFG 
Sbjct  19   ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSFSFNELRVATRNFRPDSVLGEGGFGC  78

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+++    +PGTGLVIAVKRLN  G QGH EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  79   VFKGWIDEHTFKAARPGTGLVIAVKRLNQEGFQGHKEWLAEINYLGSLSHPNLVKLIGYC  138



>gb|ACF87678.1| unknown [Zea mays]
 tpg|DAA52220.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=419

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 109/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQ  279
            RIK GS +P +S         G+ SK     DGS L    S+ S    P   K+E EIL+
Sbjct  8    RIKDGSPHPGAS---------GMFSKSS-GKDGSRLSGCSSRASSASMPPSAKTECEILR  57

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLN
Sbjct  58   SANVKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLN  117

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            H GLQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  118  HEGLQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_009610451.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL S+   S +G+    S+SK S    P TP+SEGEILQS NL+S+TF++L+ ATR+FR 
Sbjct  35   GLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQSSNLRSYTFSELRAATRNFRP  93

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ  
Sbjct  94   DSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQEGWQGHREWLAEINYLGQLH  153

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  154  HPNLVKLIGYC  164



>ref|XP_010937617.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=415

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKP
Sbjct  47   PPTPRSEGEILQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKP  106

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  107  GTGIVIAVKKLNQEGFQGHREWLTEVNYLGQLSHPNLVKLIGYC  150



>ref|XP_009130691.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=391

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P++EGEILQ+ NLKSFT ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPG
Sbjct  39   HVPRTEGEILQNANLKSFTLSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPG  98

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            TGLVIAVK+LN  GLQGH EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  99   TGLVIAVKKLNQEGLQGHREWLAEINYLGQLNHPNLVKLIGYC  141



>gb|KJB76052.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=376

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  44   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  103

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            LVIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  104  LVIAVKRLNQEGFQGHQEWLAEINYLGQLHHPNLVKLIGYC  144



>ref|XP_009772470.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772479.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=415

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GL S+   S +G+    S+SK S    P TP+SEGEILQS NL+S+TF++L+ ATR+FR 
Sbjct  21   GLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQSSNLRSYTFSELRAATRNFRP  79

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ  
Sbjct  80   DSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQEGWQGHREWLAEINYLGQLH  139

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  140  HPNLVKLIGYC  150



>ref|XP_009626085.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=395

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            ++DG  L    S +S P TP+S+ EIL+S NLKSF+F +L++ATR+FR DSVLGEGGFG 
Sbjct  19   ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSFSFNELRVATRNFRPDSVLGEGGFGC  78

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+++    +PGTGLVIAVKRLN  G QGH EWLAE+NYLG  SHPNLVKLIGYC
Sbjct  79   VFKGWIDEHTFKSARPGTGLVIAVKRLNQEGFQGHKEWLAEINYLGSLSHPNLVKLIGYC  138



>dbj|BAJ87345.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            +TD S  GKS S + PP TP+SE EILQS NL+ FTF++LK  TR+FR DS+LGEGGFG 
Sbjct  27   ATDTSTFGKSSSSSVPP-TPRSEKEILQSSNLRKFTFSELKSCTRNFRTDSLLGEGGFGS  85

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ + +P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  86   VFKGWIDERTFTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKLIGYC  145



>emb|CDY55560.1| BnaA03g54910D [Brassica napus]
Length=391

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P++EGEILQ+ NLKSFT ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPG
Sbjct  39   HVPRTEGEILQNANLKSFTLSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPG  98

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            TGLVIAVK+LN  GLQGH EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  99   TGLVIAVKKLNQEGLQGHREWLAEINYLGQLNHPNLVKLIGYC  141



>gb|EYU41728.1| hypothetical protein MIMGU_mgv1a007413mg [Erythranthe guttata]
Length=408

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP++EGEILQS NLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+NSL+ +KP
Sbjct  47   PPTPRTEGEILQSSNLKSFGFSDLKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAASKP  106

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+ LV+AVKRLN  G QGH EWLAE+NYLGQ  HPNLV+LIGYC
Sbjct  107  GSSLVVAVKRLNQDGWQGHKEWLAEINYLGQLRHPNLVRLIGYC  150



>gb|KHG15912.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=386

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  229  SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSL  408
            SK SP   P++EG+ILQ+ NLKSF F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ 
Sbjct  24   SKMSPVSVPRTEGDILQASNLKSFNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTF  83

Query  409  SPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            + +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  84   TASKPGTGMVIAVKRLNQEGFQGHHEWLAEINYLGQLDHPNLVKLVGYC  132



>gb|KDO51148.1| hypothetical protein CISIN_1g015909mg [Citrus sinensis]
Length=398

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SEGEILQS N+K+F+++DL+ ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+P
Sbjct  44   PQTPRSEGEILQSSNIKNFSYSDLRTATRNFRPDSVLGEGGFGSVFKGWVDEHSLASTRP  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG++IAVKRLN  G QGH EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  104  GTGMLIAVKRLNQEGFQGHKEWLTEINYLGQLHHPNLVKLVGYC  147



>ref|XP_010937616.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=423

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKP
Sbjct  55   PPTPRSEGEILQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKP  114

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  115  GTGIVIAVKKLNQEGFQGHREWLTEVNYLGQLSHPNLVKLIGYC  158



>ref|XP_007027015.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07517.1| Kinase superfamily protein [Theobroma cacao]
Length=398

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQ P+SEGEILQS NLK FTF++L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKP
Sbjct  44   PQAPRSEGEILQSSNLKVFTFSELRTATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKP  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIA KRL   G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  104  GTGIVIAAKRLKQEGFQGHKEWLAEINYLGQLHHPNLVKLIGYC  147



>ref|XP_010558326.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=406

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  53   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  112

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +G+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  113  SGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNLVKLIGYC  155



>gb|KJB76054.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=397

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  30   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  89

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            LVIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  90   LVIAVKRLNQEGFQGHQEWLAEINYLGQLHHPNLVKLIGYC  130



>ref|XP_009353659.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009353660.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=391

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +1

Query  181  SKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            SKCV S DG         S  S P TP+SEGEIL+SPNLKSF++ DLK+ATR+FR DSVL
Sbjct  19   SKCV-SNDGDLSSTSSKVSSFSAPPTPRSEGEILKSPNLKSFSYNDLKLATRNFRPDSVL  77

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+NS +  KPG+G+ +AVKRLN    QGH EWLAE+NYLGQ  HPNL
Sbjct  78   GEGGFGSVFKGWIDENSFTAAKPGSGIDLAVKRLNQESFQGHREWLAEVNYLGQLYHPNL  137

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  138  VKLIGYC  144



>ref|XP_008784589.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=415

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKP
Sbjct  47   PPTPRSEGEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKP  106

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  107  GTGIVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVKLIGYC  150



>ref|XP_003567536.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=401

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            +SS     +  +     D+K++  + P+SEGEILQS  +KSF F +L+ ATR+FR DSVL
Sbjct  9    ISSDSPYRSSAASPSSGDAKSAELRAPRSEGEILQSAKVKSFAFTELRTATRNFRPDSVL  68

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+N+ +P +PGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNL
Sbjct  69   GEGGFGSVFKGWIDENTFAPARPGTGVVIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNL  128

Query  535  VKLIGYC  555
            VKL+GYC
Sbjct  129  VKLVGYC  135



>ref|XP_004171473.1| PREDICTED: probable serine/threonine-protein kinase NAK-like, 
partial [Cucumis sativus]
Length=397

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SE EILQ  NLK+F+F +LK ATR+FR DSV+GEGGFG VFKGWID++SL+PTK 
Sbjct  57   PVTPRSEDEILQCSNLKNFSFNELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKA  116

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTGLVIAVKRLN  G+QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  117  GTGLVIAVKRLNREGVQGHKEWLAEINYLGQLSHPNLVKLIGYC  160



>ref|XP_004142067.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
[Cucumis sativus]
 gb|KGN54255.1| hypothetical protein Csa_4G296090 [Cucumis sativus]
Length=384

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SE EILQ  NLK+F+F +LK ATR+FR DSV+GEGGFG VFKGWID++SL+PTK 
Sbjct  44   PVTPRSEDEILQCSNLKNFSFNELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKA  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTGLVIAVKRLN  G+QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  104  GTGLVIAVKRLNREGVQGHKEWLAEINYLGQLSHPNLVKLIGYC  147



>gb|KJB76051.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
 gb|KJB76053.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=411

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  44   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  103

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            LVIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  104  LVIAVKRLNQEGFQGHQEWLAEINYLGQLHHPNLVKLIGYC  144



>gb|KHG05340.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG05994.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
Length=411

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  432
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  44   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  103

Query  433  LVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            LVIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  104  LVIAVKRLNQEGFQGHQEWLAEINYLGQLHHPNLVKLIGYC  144



>gb|EMT08269.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=298

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSF F +LK ATR+FR DSVLGEGGFG VFKGW+D+ + +P +P
Sbjct  54   PPTPRSEGEILQSANVKSFAFNELKTATRNFRPDSVLGEGGFGSVFKGWVDETTFAPARP  113

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLV+L+GYC
Sbjct  114  GTGMVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVRLVGYC  157



>gb|AAA18853.1| protein kinase [Arabidopsis thaliana]
Length=389

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|NP_195849.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 ref|NP_850755.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 sp|P43293.2|NAK_ARATH RecName: Full=Probable serine/threonine-protein kinase NAK [Arabidopsis 
thaliana]
 emb|CAB85534.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AAM63816.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 dbj|BAF00769.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AED90455.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 gb|AED90456.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
Length=389

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>emb|CDX80814.1| BnaC03g00680D [Brassica napus]
Length=391

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  426
              P++EGEILQ+ NLKSFT ++LK ATR FRLDS++GEGGFG VFKGWID+ SL+P KPG
Sbjct  39   HVPRTEGEILQNANLKSFTLSELKSATRSFRLDSMVGEGGFGRVFKGWIDETSLAPCKPG  98

Query  427  TGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            TGLVIAVK+LN  GLQGH EWLAE+NYLGQ +HPNLVKLIGYC
Sbjct  99   TGLVIAVKKLNQEGLQGHREWLAEINYLGQLNHPNLVKLIGYC  141



>ref|XP_006654906.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=419

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  136  FSSLFCYLLI*PGLSSKCVISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKSFTFAD  312
            FSSL  Y+           +S +G+ L  S  S  S P TP+SEGEIL++ N+K+F F +
Sbjct  27   FSSLSSYVSELQYYGGTSKLSKNGAALSNSSVSTASVPPTPRSEGEILEAANVKAFAFNE  86

Query  313  LKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWL  492
            L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PT+PGTG+VIAVK+LN  G QGH EWL
Sbjct  87   LRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTRPGTGMVIAVKKLNQEGHQGHREWL  146

Query  493  AELNYLGQFSHPNLVKLIGYC  555
            AE+NYLGQ SHP LV+L+GYC
Sbjct  147  AEVNYLGQLSHPYLVRLVGYC  167



>gb|AAF79545.1|AC022464_3 F22G5.5 [Arabidopsis thaliana]
Length=464

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   LG   S  S   +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG 
Sbjct  22   AKDIGSLGSKASSVSVRPSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGC  81

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ SL+ ++PGTGLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  82   VFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYC  141



>ref|XP_008810614.1| PREDICTED: protein kinase APK1A, chloroplastic [Phoenix dactylifera]
Length=415

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQ+ N+KSF F +LK ATR+FR DSVLGEGGFG VFKGWID++S + TKP
Sbjct  47   PPTPRSEGEILQASNVKSFAFNELKSATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKP  106

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  107  GTGIVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVKLIGYC  150



>ref|XP_008784588.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=422

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKP
Sbjct  54   PPTPRSEGEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKP  113

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  114  GTGIVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVKLIGYC  157



>ref|XP_010490647.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010490648.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=400

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH EWLAE+NYLG+  HPNL
Sbjct  75   GEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEGLQGHREWLAEINYLGKLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|XP_010231839.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Brachypodium 
distachyon]
Length=393

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            G +SK   S +G+ L  S S  S    P+SEGEIL+S N+K+FTF +L+ ATR+FR DSV
Sbjct  20   GATSKFA-SRNGATLSNSSSYVSVASVPRSEGEILESANVKAFTFNELRTATRNFRPDSV  78

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPN
Sbjct  79   LGEGGFGSVFKGWIDEKTLTPTKPGTGMVIAVKKLNQEGYQGHREWLAEVNYLGQLSHPN  138

Query  532  LVKLIGYC  555
            LVKL+GYC
Sbjct  139  LVKLVGYC  146



>ref|XP_009766459.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=416

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S +G+    S SK S    P TP+SEGEILQS NL+SFTF +L+ ATR+FR DSV+GEG
Sbjct  26   VSGNGTETSNSYSKRSSGSVPPTPRSEGEILQSSNLRSFTFNELRAATRNFRPDSVVGEG  85

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGW+D+ +L  +KPG G+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNLVKL
Sbjct  86   GFGSVFKGWVDEQTLVASKPGAGIVIAVKKLNQEGLQGHREWLAEINYLGQLRHPNLVKL  145

Query  544  IGYC  555
            +GYC
Sbjct  146  VGYC  149



>ref|XP_006417790.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
 gb|ESQ36143.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
Length=413

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ T+PGT
Sbjct  43   SPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATRPGT  102

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GLVIAVK+LN  G QGH EWLAE+NYLGQFSH +LVKLIGYC
Sbjct  103  GLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHGHLVKLIGYC  144



>ref|NP_001141912.1| uncharacterized LOC100274061 [Zea mays]
 gb|ACF87298.1| unknown [Zea mays]
 gb|AFW67139.1| putative protein kinase superfamily protein [Zea mays]
Length=418

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +1

Query  202  DGSGLGKSDSKNSPPQTP---KSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            DGS L    S+ S    P   K+E EILQS N+K FTF +LK ATR+FR DSVLGEGGFG
Sbjct  27   DGSRLSGCSSRASSASMPPSVKTECEILQSANVKIFTFNNLKAATRNFRPDSVLGEGGFG  86

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             V+KGW+D+N+LSP +PGTG+ +AVKRLNH GLQGH EW AE+NYLGQF HPNLVKLIGY
Sbjct  87   SVYKGWVDENTLSPCRPGTGIAVAVKRLNHEGLQGHREWWAEVNYLGQFCHPNLVKLIGY  146

Query  553  C  555
            C
Sbjct  147  C  147



>gb|KJB76739.1| hypothetical protein B456_012G104300 [Gossypium raimondii]
Length=273

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = +1

Query  181  SKCVISTDGSGLG---KSDSKN------------SPPQTPKSEGEILQSPNLKSFTFADL  315
            S C+ S   SG G   +S S+N            S  QTP+SEGEI QS NLK+FTF++L
Sbjct  6    SNCIKSVSSSGTGVDSRSRSRNGNNFSSSRVSSASISQTPRSEGEIWQSSNLKTFTFSEL  65

Query  316  KMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLA  495
            K ATR+F  D+VLG GGFG VFKGWID++SL+ TKPGTG+V AVKRLN  G QGH EWLA
Sbjct  66   KTATRNFSPDTVLGAGGFGSVFKGWIDEHSLTATKPGTGIVTAVKRLNKEGFQGHKEWLA  125

Query  496  ELNYLGQFSHPNLVKLIGYC  555
            E+NYLGQ  HPNLVKLIGYC
Sbjct  126  EINYLGQLHHPNLVKLIGYC  145



>ref|XP_008447952.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
melo]
Length=384

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SE EILQ  NLK+F+F +L+ ATR+FR DSV+GEGGFG VFKGWID++SL+PTK 
Sbjct  44   PVTPRSEDEILQCSNLKNFSFNELRTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKA  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTGLVIAVKRLN  G+QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  104  GTGLVIAVKRLNRDGVQGHKEWLAEINYLGQLSHPNLVKLIGYC  147



>gb|KJB73944.1| hypothetical protein B456_011G261900 [Gossypium raimondii]
Length=386

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  229  SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSL  408
            SK SP   P +EGEILQ+ NLKSF F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ 
Sbjct  24   SKMSPVSVPITEGEILQASNLKSFNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTF  83

Query  409  SPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            + +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  84   TASKPGTGMVIAVKRLNQEGFQGHHEWLAEINYLGQLDHPNLVKLVGYC  132



>ref|XP_010557253.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEILQSPNLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGT
Sbjct  66   TPRTEGEILQSPNLKSFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGT  125

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  G QGH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  126  GMVIAVKRLNQDGWQGHKEWLAEVNYLGQFSHRHLMKLIGYC  167



>ref|XP_009364395.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=418

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  238  SPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPT  417
            + P TP+SEGEILQS NLKSF+F +LKMATR+FR DSVLGEGGFG VFKGWID+NS +  
Sbjct  38   TAPPTPRSEGEILQSSNLKSFSFNNLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAA  97

Query  418  KPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            KPGTG+V+AVKRLN    QGH EWLAE+NYLGQ  HPNLVKLIG+C
Sbjct  98   KPGTGIVLAVKRLNQESYQGHREWLAEVNYLGQLYHPNLVKLIGFC  143



>ref|XP_007009313.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18123.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=347

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
              ++EGEILQS NLKSF+F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGT
Sbjct  44   VARTEGEILQSSNLKSFSFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGT  103

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  104  GMVIAVKRLNQEGLQGHQEWLAEINYLGQLYHPNLVKLVGYC  145



>ref|XP_010557255.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Tarenaya hassleriana]
Length=412

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEILQSPNLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGT
Sbjct  46   TPRTEGEILQSPNLKSFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGT  105

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  G QGH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  106  GMVIAVKRLNQDGWQGHKEWLAEVNYLGQFSHRHLMKLIGYC  147



>gb|KJB76738.1| hypothetical protein B456_012G104300 [Gossypium raimondii]
Length=301

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = +1

Query  181  SKCVISTDGSGLG---KSDSKN------------SPPQTPKSEGEILQSPNLKSFTFADL  315
            S C+ S   SG G   +S S+N            S  QTP+SEGEI QS NLK+FTF++L
Sbjct  6    SNCIKSVSSSGTGVDSRSRSRNGNNFSSSRVSSASISQTPRSEGEIWQSSNLKTFTFSEL  65

Query  316  KMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLA  495
            K ATR+F  D+VLG GGFG VFKGWID++SL+ TKPGTG+V AVKRLN  G QGH EWLA
Sbjct  66   KTATRNFSPDTVLGAGGFGSVFKGWIDEHSLTATKPGTGIVTAVKRLNKEGFQGHKEWLA  125

Query  496  ELNYLGQFSHPNLVKLIGYC  555
            E+NYLGQ  HPNLVKLIGYC
Sbjct  126  EINYLGQLHHPNLVKLIGYC  145



>dbj|BAJ95924.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSF F +LK ATR+FR DSVLGEGGFG VFKGW+D+ + +P +P
Sbjct  56   PPTPRSEGEILQSANVKSFAFTELKTATRNFRPDSVLGEGGFGSVFKGWVDETTFAPARP  115

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLV+L+GYC
Sbjct  116  GTGMVIAVKKLNQEGFQGHREWLAEVNYLGQLSHPNLVRLVGYC  159



>ref|XP_010557252.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=435

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEILQSPNLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGT
Sbjct  69   TPRTEGEILQSPNLKSFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGT  128

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  G QGH EWLAE+NYLGQFSH +L+KLIGYC
Sbjct  129  GMVIAVKRLNQDGWQGHKEWLAEVNYLGQFSHRHLMKLIGYC  170



>emb|CDY48100.1| BnaC02g03570D [Brassica napus]
Length=388

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DS++
Sbjct  19   LSSK-FLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFSLSELKSATRNFRPDSMV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|XP_009125442.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=388

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DS++
Sbjct  19   LSSK-FLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFSLSELKSATRNFRPDSMV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>emb|CDY04848.1| BnaAnng00300D [Brassica napus]
Length=388

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DS++
Sbjct  19   LSSK-FLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFSLSELKSATRNFRPDSMV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEGLQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|XP_009143298.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Brassica 
rapa]
 emb|CDX74847.1| BnaA05g05930D [Brassica napus]
Length=382

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  211  GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGW  390
            GL  S  K++     K+EGEIL+S  +K+FTF +LK+ATR+FR DSV+GEGGFG VFKGW
Sbjct  25   GLSMSSRKSTVAAAQKTEGEILESTPVKNFTFNELKLATRNFRPDSVIGEGGFGCVFKGW  84

Query  391  IDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +D+ SL+PTKPGTGLVIAVK+LN  GLQGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  85   LDETSLTPTKPGTGLVIAVKKLNREGLQGHREWLTEINYLGQLSHPNLVKLIGYC  139



>emb|CDY10453.1| BnaCnng03540D [Brassica napus]
Length=390

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S +GS    S S  S   TP++EGEIL++ NLKSFT  +LK ATR FR DS++
Sbjct  19   LSSK-FLSREGSK--GSASATSFSHTPRTEGEILKNANLKSFTLGELKSATRSFRPDSMV  75

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  76   GEGGFGCVFKGWIDETSLAPSKPGTGIVIAVKRLNQEGLQGHREWLAEINYLGQLDHPNL  135

Query  535  VKLIGYC  555
            VKL+GYC
Sbjct  136  VKLVGYC  142



>ref|XP_004981243.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=416

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 109/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQ  279
            RIK GS +P +S         G+ SK     DGS L    S+ S    P   K+E EILQ
Sbjct  8    RIKDGSPHPGAS---------GMFSKSG-GKDGSRLSGCSSRASSASMPPNAKTECEILQ  57

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K F+F++LK ATR+FR DSVLGEGGFG V+KGWID+N+L+P +PGTG+ +AVKRLN
Sbjct  58   SANVKVFSFSNLKSATRNFRPDSVLGEGGFGSVYKGWIDENTLAPCRPGTGIAVAVKRLN  117

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
              GLQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  118  QEGLQGHREWLAEVNYLGQFCHPNLVKLIGYC  149



>ref|XP_002873046.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49305.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSTTSFSYMPRTEGEILQNANLKNFSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGCVFKGWIDEASLTPSKPGTGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKL+GYC
Sbjct  135  VKLLGYC  141



>ref|XP_011077648.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Sesamum 
indicum]
Length=417

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS NLKSFTF+DLK ATR+FR DSV+GEGGFG VFKGWID+ SL+ ++ 
Sbjct  49   PPTPRSEGEILQSSNLKSFTFSDLKAATRNFRPDSVIGEGGFGSVFKGWIDEQSLAASRA  108

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G+V+AVK+LN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  109  GAGMVVAVKKLNQEGWQGHKEWLAEINYLGQLRHPNLVKLIGYC  152



>emb|CDP00097.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            PQTP+SE EIL+S NL+SF F DLK ATR+FR DSVLGEGGFG VFKGW+D++S    KP
Sbjct  41   PQTPRSESEILESSNLRSFGFNDLKTATRNFRPDSVLGEGGFGCVFKGWVDQHSCKAAKP  100

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTGLVIAVKRLN  GLQGH EWL E+NYLGQ  HPNLVKL+GYC
Sbjct  101  GTGLVIAVKRLNQEGLQGHKEWLTEINYLGQLHHPNLVKLVGYC  144



>ref|XP_006646742.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=421

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP+SEG+ILQS N++SF F +LK ATR+FR DSVLGEGGFG VFKGW+D+N+  PT+PGT
Sbjct  47   TPRSEGDILQSANVRSFAFTELKTATRNFRPDSVLGEGGFGSVFKGWVDENTFVPTRPGT  106

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G++IAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  107  GMIIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNLVKLVGYC  148



>gb|AAO18450.1| putative protein kinase [Oryza sativa Japonica Group]
Length=416

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  208  SGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKG  387
            SG     S  S P T K+E EILQS N+K F+F+DL++ATR+FR DSVLGEGGFG V+KG
Sbjct  36   SGCSSRASSASMPPTAKTECEILQSANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKG  95

Query  388  WIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            WID+N+LS  KPGTG+ +AVKRLN   LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  96   WIDENTLSACKPGTGIAVAVKRLNQESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|XP_009122790.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=389

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S +GS    S S  S   TP++EGEIL++ NLKSFT  +LK ATR FR DS++
Sbjct  19   LSSK-FMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFTLGELKSATRSFRPDSMV  75

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  76   GEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEGLQGHREWLAEINYLGQLDHPNL  135

Query  535  VKLIGYC  555
            VKL+GYC
Sbjct  136  VKLVGYC  142



>emb|CDY40347.1| BnaA10g27210D [Brassica napus]
Length=390

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S +GS    S S  S   TP++EGEIL++ NLKSFT  +LK ATR FR DS++
Sbjct  19   LSSK-FMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFTLGELKSATRSFRPDSMV  75

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNL
Sbjct  76   GEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEGLQGHREWLAEINYLGQLDHPNL  135

Query  535  VKLIGYC  555
            VKL+GYC
Sbjct  136  VKLVGYC  142



>ref|XP_006827147.1| hypothetical protein AMTR_s00010p00251410 [Amborella trichopoda]
 gb|ERM94384.1| hypothetical protein AMTR_s00010p00251410 [Amborella trichopoda]
Length=409

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFG  372
            + T GS  GKS+ +N P  TP++EGEIL SPNLK+FTF +LK ATR+FR DS++GEGGFG
Sbjct  34   MQTSGSDSGKSNIENPP--TPRTEGEILSSPNLKAFTFNELKNATRNFRPDSLIGEGGFG  91

Query  373  PVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGY  552
             VFKGWID+ SLS +KPG+G+V+AVK+L   G QGH EWLAE+NYLGQ  HPNLVKLIGY
Sbjct  92   YVFKGWIDQQSLSASKPGSGMVVAVKKLKPEGYQGHKEWLAEVNYLGQLHHPNLVKLIGY  151

Query  553  C  555
            C
Sbjct  152  C  152



>ref|XP_010452061.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010452062.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=398

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S    P++EGEILQ+ NLK+F+ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  GLQGH EWLAE+NYLG+  HPNL
Sbjct  75   GEGGFGCVFKGWIDEASLAPSKPGAGIVIAVKRLNQEGLQGHREWLAEINYLGKLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|NP_001051730.1| Os03g0821900 [Oryza sativa Japonica Group]
 gb|ABF99600.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13644.1| Os03g0821900 [Oryza sativa Japonica Group]
 dbj|BAG92171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76429.1| hypothetical protein OsI_14109 [Oryza sativa Indica Group]
 gb|EEE60197.1| hypothetical protein OsJ_13155 [Oryza sativa Japonica Group]
Length=424

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  208  SGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKG  387
            SG     S  S P T K+E EILQS N+K F+F+DL++ATR+FR DSVLGEGGFG V+KG
Sbjct  36   SGCSSRASSASMPPTAKTECEILQSANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKG  95

Query  388  WIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            WID+N+LS  KPGTG+ +AVKRLN   LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  96   WIDENTLSACKPGTGIAVAVKRLNQESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|XP_004490898.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=397

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 8/131 (6%)
 Frame = +1

Query  172  GLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            GLSSK     DGS   GL    +  + P TP++EGEIL S N+KSFTF++LK+ATR+FR 
Sbjct  18   GLSSK-----DGSKDNGLSGRTTPTTGPPTPRTEGEILNSSNMKSFTFSELKIATRNFRP  72

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGWID++SL P KPGTG+VIAVKRLN  GLQGHSEWL E+NYLGQ  
Sbjct  73   DSVVGEGGFGAVFKGWIDEHSLVPVKPGTGVVIAVKRLNQEGLQGHSEWLTEINYLGQLH  132

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  133  HPNLVKLIGYC  143



>ref|XP_002466186.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
 gb|EER93184.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
Length=418

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  279
            RIK GS +P +S         G+ SK     DGS L    S+ S    P + K+E EILQ
Sbjct  10   RIKDGSPHPGTS---------GMFSKSG-GKDGSRLSGCSSRASSASMPTSAKTECEILQ  59

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVK+LN
Sbjct  60   SANVKVFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKKLN  119

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
              GLQGH EWLAE+NYLGQF HPNLVKLIGYC
Sbjct  120  PEGLQGHREWLAEVNYLGQFCHPNLVKLIGYC  151



>gb|AFK44181.1| unknown [Lotus japonicus]
Length=401

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP++EGEIL+S N+KSFTF +LK +TR+FR DS++GEGGFG V+KGWID+ SL+P +P
Sbjct  46   PPTPRTEGEILKSSNMKSFTFGELKTSTRNFRPDSMVGEGGFGCVYKGWIDEQSLAPARP  105

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVKRLN  GLQGHSEWL E+NYLGQ  HPNLV+L+GYC
Sbjct  106  GTGMVIAVKRLNQEGLQGHSEWLTEINYLGQLHHPNLVRLVGYC  149



>ref|XP_009414323.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KP
Sbjct  48   PPTPRSEGEILQSVNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKP  107

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHP+LVKLIGYC
Sbjct  108  GTGVVIAVKKLNQEGHQGHREWLAEVNYLGQLSHPHLVKLIGYC  151



>ref|XP_003522100.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
Length=414

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NLKS+++ +LKMAT++F  
Sbjct  18   GFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNLKSYSYNELKMATKNFCP  75

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN    QGH EWLAE+NYLGQ  
Sbjct  76   DSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQESFQGHKEWLAEINYLGQLQ  135

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  136  HPNLVKLIGYC  146



>gb|KHN47889.1| Protein kinase APK1B, chloroplastic [Glycine soja]
Length=413

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NLKS+++ +LKMAT++F  
Sbjct  18   GFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNLKSYSYNELKMATKNFCP  75

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN    QGH EWLAE+NYLGQ  
Sbjct  76   DSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQESFQGHKEWLAEINYLGQLQ  135

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  136  HPNLVKLIGYC  146



>ref|XP_006365700.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=394

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            ++DG  L    S +S P TP+S+ EIL+  NL SF+F +L++ATR+FR DSVLGEGGFG 
Sbjct  19   ASDGRELSSRHSYSSAPLTPRSQSEILELSNLNSFSFNELRVATRNFRPDSVLGEGGFGC  78

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+N+    +PGTGLVIAVKRLN  G QGH EWLAE+ YL Q SHPNLVKLIGYC
Sbjct  79   VFKGWIDENTFKAARPGTGLVIAVKRLNQEGFQGHKEWLAEITYLSQLSHPNLVKLIGYC  138



>ref|XP_007009312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18122.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
              ++EGEILQS NLKSF+F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGT
Sbjct  44   VARTEGEILQSSNLKSFSFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGT  103

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  104  GMVIAVKRLNQEGLQGHQEWLAEINYLGQLYHPNLVKLVGYC  145



>ref|XP_010067409.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW65537.1| hypothetical protein EUGRSUZ_G02935 [Eucalyptus grandis]
Length=392

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  211  GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGW  390
            GL    S  S PQTP++E EILQS NLKSF++ +L++ATR+FR DSVLGEGGFG V+KGW
Sbjct  25   GLSGRVSSYSGPQTPRTEDEILQSTNLKSFSYTELRVATRNFRPDSVLGEGGFGSVYKGW  84

Query  391  IDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +D+ + + TKPGTG+VIAVKRLN  G QGH EWL E+NYLGQ  HPNLVKLIG+C
Sbjct  85   VDEQTFAATKPGTGIVIAVKRLNQEGFQGHKEWLTEINYLGQLYHPNLVKLIGFC  139



>gb|ABD39229.1| protein kinase ABC1063 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            +TD S  GKS S + PP TP+SE EILQS NL+ FTF++LK  TR+FR DS+LGEGGFG 
Sbjct  34   ATDTSTFGKSSSSSVPP-TPRSEKEILQSSNLRKFTFSELKSCTRNFRTDSLLGEGGFGS  92

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ + +P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  93   VFKGWIDERTFTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKLIGYC  152



>ref|XP_009414322.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KP
Sbjct  55   PPTPRSEGEILQSVNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKP  114

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHP+LVKLIGYC
Sbjct  115  GTGVVIAVKKLNQEGHQGHREWLAEVNYLGQLSHPHLVKLIGYC  158



>ref|NP_001045548.1| Os01g0973500 [Oryza sativa Japonica Group]
 dbj|BAD87376.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD87420.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF07462.1| Os01g0973500 [Oryza sativa Japonica Group]
 dbj|BAG91482.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  GSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFK  384
            G+GL    S +    TP+SEGEIL+  N++SF F +LK ATR+FR DSVLGEGGFG VFK
Sbjct  32   GTGLSSRVSSSVAAVTPRSEGEILRCANVRSFAFNELKTATRNFRPDSVLGEGGFGSVFK  91

Query  385  GWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GW+D+N+  P++PGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  92   GWVDENTFLPSRPGTGMVIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNLVKLVGYC  148



>ref|XP_011091519.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=397

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GLSS+ V S DG       S +S P TP++EGEIL S NLKSF F DL++ATR+FR DSV
Sbjct  19   GLSSRFV-SVDGKDTSSRRSSSSMPLTPRNEGEILDSSNLKSFGFNDLRIATRNFRPDSV  77

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            LGEGGFG VFKGWID+++    KPGTG VIAVKRLN  G QGH EWL E+NYLGQ  HPN
Sbjct  78   LGEGGFGCVFKGWIDEHTFKAAKPGTGTVIAVKRLNQEGFQGHKEWLTEINYLGQLYHPN  137

Query  532  LVKLIGYC  555
            LVKL+GYC
Sbjct  138  LVKLLGYC  145



>gb|EEC72262.1| hypothetical protein OsI_05407 [Oryza sativa Indica Group]
Length=408

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  GSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFK  384
            G+GL    S +    TP+SEGEIL+  N++SF F +LK ATR+FR DSVLGEGGFG VFK
Sbjct  32   GTGLSSRVSSSVAAVTPRSEGEILRCANVRSFAFNELKTATRNFRPDSVLGEGGFGSVFK  91

Query  385  GWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GW+D+N+  P++PGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  92   GWVDENTFLPSRPGTGMVIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNLVKLVGYC  148



>ref|XP_010507635.1| PREDICTED: serine/threonine-protein kinase BIK1-like, partial 
[Camelina sativa]
Length=183

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  256  KSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGL  435
            K+EGEIL S  +KSFTF +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGL
Sbjct  41   KTEGEILSSTPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGL  100

Query  436  VIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VIAVKRLN  G QGH EWL E+NYLGQ SHPNLVKLIGYC
Sbjct  101  VIAVKRLNKEGFQGHREWLTEINYLGQLSHPNLVKLIGYC  140



>gb|EAZ15004.1| hypothetical protein OsJ_04942 [Oryza sativa Japonica Group]
Length=402

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  GSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFK  384
            G+GL    S +    TP+SEGEIL+  N++SF F +LK ATR+FR DSVLGEGGFG VFK
Sbjct  32   GTGLSSRVSSSVAAVTPRSEGEILRCANVRSFAFNELKTATRNFRPDSVLGEGGFGSVFK  91

Query  385  GWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GW+D+N+  P++PGTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  92   GWVDENTFLPSRPGTGMVIAVKKLNQDGFQGHREWLAEVNYLGQLSHPNLVKLVGYC  148



>ref|XP_006287879.1| hypothetical protein CARUB_v10001106mg [Capsella rubella]
 gb|EOA20777.1| hypothetical protein CARUB_v10001106mg [Capsella rubella]
Length=405

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 101/128 (79%), Gaps = 4/128 (3%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  351
            GLSSK  +S D S   K  S  S    P++EGEIL++ NLK+F+ ++LK ATR+FR DSV
Sbjct  19   GLSSK-FLSRDES---KGSSTTSFSHMPRTEGEILKNANLKNFSLSELKSATRNFRPDSV  74

Query  352  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPN  531
            +GEGGFG VFKGWID+ S +P+KPGTG+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPN
Sbjct  75   VGEGGFGCVFKGWIDEASFAPSKPGTGIVIAVKRLNQEGLQGHREWLAEINYLGQLDHPN  134

Query  532  LVKLIGYC  555
            LVKL+GYC
Sbjct  135  LVKLVGYC  142



>ref|XP_009588344.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
tomentosiformis]
Length=417

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S DG+    S SK S    P TP+SEGEILQS NL+SFTF +L+ ATR+FR DSV+GEG
Sbjct  26   VSGDGTETSNSYSKRSSGSVPPTPRSEGEILQSSNLRSFTFNELRAATRNFRPDSVVGEG  85

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGW+D  +L  +KPG G+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNLVKL
Sbjct  86   GFGSVFKGWVDDQTLVASKPGAGIVIAVKKLNQEGLQGHREWLAEINYLGQLRHPNLVKL  145

Query  544  IGY  552
            +GY
Sbjct  146  VGY  148



>ref|XP_007140532.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
 gb|ESW12526.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
Length=410

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            T +SEGEILQS NLKSF++++L++ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPG 
Sbjct  45   TSRSEGEILQSSNLKSFSYSELRVATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKPGI  104

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+++AVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  105  GMIVAVKRLNQEGFQGHREWLAEINYLGQLQHPNLVKLIGYC  146



>gb|ABF18545.1| serine/threonine kinase-like protein ABC1063 [Hordeum vulgare 
subsp. vulgare]
Length=372

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            +TD S  GKS S + PP TP+SE EILQS NL+ FTF++LK  TR+FR DS+LGEGGFG 
Sbjct  34   ATDTSTFGKSSSSSVPP-TPRSEKEILQSSNLRKFTFSELKSCTRNFRTDSLLGEGGFGS  92

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ + +P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVK+IGYC
Sbjct  93   VFKGWIDERTFTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKVIGYC  152



>ref|XP_010111458.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
 gb|EXC30981.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
Length=394

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SE +IL+SPN+KSF+F++LK ATR+FR DSVLGEGGFG VFKGWID+  L+  KP
Sbjct  36   PLTPRSEDDILRSPNIKSFSFSELKTATRNFRPDSVLGEGGFGSVFKGWIDEQLLTAAKP  95

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVKRLN  G QGH EWL E+NYLGQ  HPNLVKLIGYC
Sbjct  96   GTGIVIAVKRLNQEGFQGHKEWLTEINYLGQLHHPNLVKLIGYC  139



>ref|NP_001274846.1| protein kinase APK1B, chloroplastic-like [Solanum tuberosum]
 gb|ABN69037.1| protein kinase [Solanum tuberosum]
Length=416

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  193  ISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEG  363
            +S +G+    S+SK    S P TP+SEGEILQS NL+SFTF +L+ +TR+FR DSVLG G
Sbjct  26   VSGNGTETSNSNSKVSSGSVPPTPRSEGEILQSSNLRSFTFNELRASTRNFRPDSVLGGG  85

Query  364  GFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKL  543
            GFG VFKGWID+ +L  +KPG G+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNLV+L
Sbjct  86   GFGSVFKGWIDEQTLLASKPGAGIVIAVKKLNQEGLQGHREWLAEINYLGQLRHPNLVRL  145

Query  544  IGYC  555
            +GYC
Sbjct  146  VGYC  149



>ref|XP_010423878.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010423879.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=398

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S DGS   K  S  S     ++EGEILQ+ NLK+++ ++LK ATR+FR DSV+
Sbjct  19   LSSK-FLSRDGS---KGSSNTSFSHMSRTEGEILQNANLKNYSLSELKSATRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  GLQGH EWLAE+NYLG+  HPNL
Sbjct  75   GEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEGLQGHREWLAEINYLGKLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>ref|XP_009384874.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384875.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEIL S NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KP
Sbjct  38   PPTPRSEGEILTSSNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKP  97

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYL Q SHPNLVKLIGYC
Sbjct  98   GTGMVIAVKKLNQEGFQGHKEWLAEVNYLSQLSHPNLVKLIGYC  141



>gb|EMT20337.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=373

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            +TD S  GKS S + PP TP++E EILQS NL+ FTF++L+ +TR+FR DS+LGEGGFG 
Sbjct  35   ATDTSTFGKSSSSSVPP-TPRTEKEILQSSNLRKFTFSELRSSTRNFRTDSLLGEGGFGS  93

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ + +P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  94   VFKGWIDERTFTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKLIGYC  153



>gb|KHG15911.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=596

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  229  SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSL  408
            SK SP   P++EG+ILQ+ NLKSF F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ 
Sbjct  24   SKMSPVSVPRTEGDILQASNLKSFNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTF  83

Query  409  SPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            + +KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNLVKL+GYC
Sbjct  84   TASKPGTGMVIAVKRLNQEGFQGHHEWLAEINYLGQLDHPNLVKLVGYC  132



>ref|XP_011030315.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Populus 
euphratica]
Length=415

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP+++GEILQS NLKSF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGT
Sbjct  46   TPRTQGEILQSSNLKSFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGT  105

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN    QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  106  GIVIAVKRLNQESFQGHQEWLAEINYLGQLYHPNLVKLIGYC  147



>gb|EPS63220.1| protein kinase 1b, partial [Genlisea aurea]
Length=346

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  235  NSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSP  414
            +S     ++EGEILQSPNL+SF+F+DLK ATR+FRLDS LG GGFG V+KGWID NS +P
Sbjct  28   SSAAIVSRTEGEILQSPNLRSFSFSDLKAATRNFRLDSNLGGGGFGTVYKGWIDANSSAP  87

Query  415  TKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
             KPG+GLV+AVK+LN    QGH EWLAE+N+LGQFSHPNLVKLIGYC
Sbjct  88   AKPGSGLVVAVKKLNQESFQGHEEWLAEVNHLGQFSHPNLVKLIGYC  134



>ref|XP_008240890.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=396

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            S +GS      S  S P TP+SEGEILQS  LKS  F++LK ATR+FR DSVLG+GGFG 
Sbjct  21   SKNGSASNSKASSGSMPVTPRSEGEILQSTKLKSIGFSELKNATRNFRPDSVLGDGGFGS  80

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID++SL  TK GTG+VIAVKRLN  G+QGH EWL E+NYLG+  HPNLVKLIGYC
Sbjct  81   VFKGWIDESSLIATKAGTGMVIAVKRLNQDGIQGHKEWLTEINYLGELHHPNLVKLIGYC  140



>ref|XP_009384873.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEIL S NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KP
Sbjct  48   PPTPRSEGEILTSSNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKP  107

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYL Q SHPNLVKLIGYC
Sbjct  108  GTGMVIAVKKLNQEGFQGHKEWLAEVNYLSQLSHPNLVKLIGYC  151



>ref|XP_004246420.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=416

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS NL+SFTF +L+ +TR+FR DSVLGEGGFG VFKGW+D+ +L  +KP
Sbjct  46   PPTPRSEGEILQSSNLRSFTFNELRASTRNFRPDSVLGEGGFGSVFKGWVDEQTLLASKP  105

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNLV+L+GYC
Sbjct  106  GAGIVIAVKKLNQEGLQGHREWLAEINYLGQLRHPNLVRLLGYC  149



>ref|XP_003558236.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Brachypodium 
distachyon]
Length=372

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            +TD +   K  S + PP TP+SE EILQS NL+ FTF++LK +TR+FR DS+LGEGGFG 
Sbjct  34   ATDTNTFSKGSSSSVPP-TPRSEKEILQSSNLRKFTFSELKGSTRNFRPDSLLGEGGFGS  92

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGW+D+ +L+P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  93   VFKGWMDERTLTPVKPGTGMIVAVKKLKLDSFQGHKEWLAEVNYLGQLSHPNLVKLIGYC  152



>ref|XP_009384872.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=419

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEIL S NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KP
Sbjct  55   PPTPRSEGEILTSSNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKP  114

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYL Q SHPNLVKLIGYC
Sbjct  115  GTGMVIAVKKLNQEGFQGHKEWLAEVNYLSQLSHPNLVKLIGYC  158



>gb|EEC78387.1| hypothetical protein OsI_18165 [Oryza sativa Indica Group]
Length=395

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEIL++ N+K+F F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKP
Sbjct  40   PPTPRSEGEILEAANVKAFAFNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTKP  99

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G QGH EWLAE+NYLGQ SHP LV+L+GYC
Sbjct  100  GTGMVIAVKKLNQEGHQGHREWLAEVNYLGQLSHPYLVRLVGYC  143



>ref|XP_010325852.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Solanum lycopersicum]
Length=422

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS NL+SFTF +L+ +TR+FR DSVLGEGGFG VFKGW+D+ +L  +KP
Sbjct  52   PPTPRSEGEILQSSNLRSFTFNELRASTRNFRPDSVLGEGGFGSVFKGWVDEQTLLASKP  111

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G+VIAVK+LN  GLQGH EWLAE+NYLGQ  HPNLV+L+GYC
Sbjct  112  GAGIVIAVKKLNQEGLQGHREWLAEINYLGQLRHPNLVRLLGYC  155



>gb|KDP44953.1| hypothetical protein JCGZ_01453 [Jatropha curcas]
Length=415

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP++EGEILQS NLKSFTF++L+ ATR+FR DS+LGEGGFG VFKGWID+ +L+  KP
Sbjct  44   PSTPRTEGEILQSSNLKSFTFSELRAATRNFRPDSMLGEGGFGSVFKGWIDEQTLTAAKP  103

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G VIAVKRLN  G QGH EWL E+NYLGQ  HPNLVKLIG+C
Sbjct  104  GMGTVIAVKRLNQDGFQGHQEWLTEINYLGQLYHPNLVKLIGFC  147



>ref|XP_009414410.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP++E +ILQS NLKSF+F++L+ ATR+FR DSV+GEGGFG VFKGWID+ +L+ +KP
Sbjct  47   PLTPRTEVDILQSSNLKSFSFSELRAATRNFRPDSVVGEGGFGSVFKGWIDERTLTASKP  106

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+G+V+AVKRLN  GLQGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  107  GSGIVVAVKRLNQEGLQGHKEWLAEINYLGQLRHPNLVKLIGYC  150



>ref|XP_008802716.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Phoenix 
dactylifera]
Length=382

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            T +SE EILQS  L+ FTF+DLK ATR+FR DSVLGEGGFG VFKGWID+++L+ +KPGT
Sbjct  16   TSRSEDEILQSSKLRCFTFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHALTASKPGT  75

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIA KRLNH G QGH EWLAE+NYLGQ  HPNLV+LIGYC
Sbjct  76   GMVIAAKRLNHEGFQGHREWLAEVNYLGQLYHPNLVRLIGYC  117



>ref|XP_002316286.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
 gb|EEF02457.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
Length=415

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP+++GEILQS NLKSF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGT
Sbjct  46   TPRTQGEILQSSNLKSFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGT  105

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G VIAVKRLN    QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  106  GTVIAVKRLNQESSQGHQEWLAEINYLGQLYHPNLVKLIGYC  147



>ref|XP_007133997.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
 gb|ESW05991.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
Length=413

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SEGEILQS NLKS+++ +L++AT+ F  D+VLGEGGFG VFKGWID++SLS TKP
Sbjct  43   PMTPRSEGEILQSSNLKSYSYNELRIATKHFSPDNVLGEGGFGSVFKGWIDEHSLSVTKP  102

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G+V+AVKRLN  G QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  103  GIGMVVAVKRLNQEGFQGHKEWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_011027201.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=415

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP+++GEILQS NLKSF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGT
Sbjct  46   TPRTQGEILQSSNLKSFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGT  105

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G VIAVKRLN    QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  106  GTVIAVKRLNQESSQGHQEWLAEINYLGQLYHPNLVKLIGYC  147



>gb|KJB16970.1| hypothetical protein B456_002G257500 [Gossypium raimondii]
Length=286

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  241  PPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTK  420
            P Q  +SEGEILQS NLKSFTF +L+ +TR+FR DSVLG+GGFG V+KGW+D++SL+ TK
Sbjct  44   PQQPSRSEGEILQSSNLKSFTFIELRASTRNFRPDSVLGQGGFGSVYKGWVDEHSLTATK  103

Query  421  PGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            PG+G++IAVKRLN  G+QGH EWLAE+ YLGQ  HPNLVKLIGYC
Sbjct  104  PGSGILIAVKRLNQDGIQGHKEWLAEIYYLGQLDHPNLVKLIGYC  148



>ref|NP_001049704.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|ABF95245.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11618.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|EAY89440.1| hypothetical protein OsI_10947 [Oryza sativa Indica Group]
 gb|EAZ26435.1| hypothetical protein OsJ_10320 [Oryza sativa Japonica Group]
 dbj|BAG95774.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +1

Query  199  TDGSGLG-KSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
             D S  G K+ + +S P TP+SE EILQS NL+ FTF +LK +TR+FR DS+LGEGGFG 
Sbjct  35   ADSSTFGTKASASSSVPPTPRSETEILQSSNLRKFTFGELKGSTRNFRPDSLLGEGGFGS  94

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ +L+P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  95   VFKGWIDERTLTPVKPGTGMIVAVKKLKLDSFQGHREWLAEVNYLGQLSHPNLVKLIGYC  154



>ref|XP_004307510.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEIL S NLK+F F +LK ATR+FR DS++GEGGFG VFKGW+D+N+L+  KPGT
Sbjct  32   TPRTEGEILMSSNLKNFFFNELKTATRNFRPDSMVGEGGFGCVFKGWVDENALTAAKPGT  91

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  GLQGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  92   GMVIAVKRLNQEGLQGHKEWLAEINYLGQLRHPNLVKLIGYC  133



>ref|XP_002283701.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI31685.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP----PQTPKSEGEILQSPNLKSFTFADLKMATRDFR  339
            G+ S+C  S DG  L  S S        P TP+++GEILQS NLKSF F++L+ ATR+FR
Sbjct  18   GIKSRCG-SNDGKYLSGSSSSKVSSASVPTTPRTDGEILQSSNLKSFFFSELRTATRNFR  76

Query  340  LDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQF  519
             DSVLGEGGFG VFKGWID+ + +  KPGTG+VIAVK+LN  G QGH EWLAE+NYLGQ 
Sbjct  77   PDSVLGEGGFGCVFKGWIDEKAFTAAKPGTGMVIAVKKLNQEGFQGHKEWLAEINYLGQL  136

Query  520  SHPNLVKLIGYC  555
             HPNLVKLIGYC
Sbjct  137  YHPNLVKLIGYC  148



>gb|ABF95246.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=372

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +1

Query  199  TDGSGLG-KSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
             D S  G K+ + +S P TP+SE EILQS NL+ FTF +LK +TR+FR DS+LGEGGFG 
Sbjct  33   ADSSTFGTKASASSSVPPTPRSETEILQSSNLRKFTFGELKGSTRNFRPDSLLGEGGFGS  92

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWID+ +L+P KPGTG+++AVK+L     QGH EWLAE+NYLGQ SHPNLVKLIGYC
Sbjct  93   VFKGWIDERTLTPVKPGTGMIVAVKKLKLDSFQGHREWLAEVNYLGQLSHPNLVKLIGYC  152



>ref|XP_010690630.1| PREDICTED: probable serine/threonine-protein kinase NAK [Beta 
vulgaris subsp. vulgaris]
Length=408

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 4/125 (3%)
 Frame = +1

Query  193  ISTDGSGL----GKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGE  360
            +  DGS +    G SD   SP    +SEGEILQS NLK+F++ DL  ATR+FR DSVLGE
Sbjct  10   LKADGSPVHQNSGDSDRIQSPGLNQRSEGEILQSSNLKNFSYNDLCTATRNFRPDSVLGE  69

Query  361  GGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVK  540
            GGFG V+KGWID+++ +P KPG+G++IAVKRLNH G QGH EWL E+NYLGQ  HPNLV 
Sbjct  70   GGFGCVYKGWIDEHTFAPAKPGSGMIIAVKRLNHEGYQGHREWLTEINYLGQLRHPNLVN  129

Query  541  LIGYC  555
            LIGYC
Sbjct  130  LIGYC  134



>ref|NP_001241128.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006601852.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 ref|XP_006601853.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Glycine max]
 gb|ACM89535.1| protein kinase [Glycine max]
 gb|KHN13986.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P T +SEGEILQS NLKSF++ +L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKP
Sbjct  43   PVTSRSEGEILQSSNLKSFSYHELRAATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKP  102

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G G ++AVK+LN  GLQGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  103  GIGKIVAVKKLNQDGLQGHREWLAEINYLGQLQHPNLVKLIGYC  146



>ref|XP_006398693.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
 gb|ESQ40146.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
Length=396

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 4/127 (3%)
 Frame = +1

Query  175  LSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVL  354
            LSSK  +S D S   K  S  S    P++EGEILQ+ NLK+F+ ++LK +TR+FR DSV+
Sbjct  19   LSSK-FLSRDTS---KGSSNTSFSHMPRTEGEILQNANLKNFSLSELKSSTRNFRPDSVV  74

Query  355  GEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNL  534
            GEGGFG VFKGWID+ + +P+KPGTG+VIAVKRLN  G QGH EWLAE+NYLGQ  HPNL
Sbjct  75   GEGGFGCVFKGWIDETTFAPSKPGTGIVIAVKRLNQEGFQGHREWLAEINYLGQLDHPNL  134

Query  535  VKLIGYC  555
            VKLIGYC
Sbjct  135  VKLIGYC  141



>emb|CDY20465.1| BnaC04g05790D [Brassica napus]
Length=386

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  211  GLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGW  390
            GL  S  K++     K+EGEIL+S  +K+FTF +LK+ATR+FR DSV+GEGGFG VFKGW
Sbjct  25   GLSMSSGKSTVAAAQKTEGEILESTPVKNFTFNELKLATRNFRPDSVIGEGGFGCVFKGW  84

Query  391  IDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            +D+ +L+PTKPGTGLVIAVK+LN  GLQGH EWL E+NYLG+ SHPNLVKL+GYC
Sbjct  85   LDETNLTPTKPGTGLVIAVKKLNREGLQGHREWLTEINYLGRLSHPNLVKLVGYC  139



>ref|XP_002311169.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|EEE88536.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP+++GEILQS NLKSF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGT
Sbjct  46   TPRTQGEILQSSNLKSFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGT  105

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRL+    QGH EWLAE+NYLGQ  HPNLVKLIGYC
Sbjct  106  GIVIAVKRLSQESFQGHQEWLAEINYLGQLYHPNLVKLIGYC  147



>ref|XP_008343582.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=395

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEILQS NLKSF F +LK ATR+FR DS++GEGGFG V+KGW+D+NSL+  KPGT
Sbjct  26   TPRTEGEILQSSNLKSFAFNELKTATRNFRPDSMVGEGGFGSVYKGWVDENSLTAAKPGT  85

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  GLQGH EWL E+NYLGQ  H NLV+LIGYC
Sbjct  86   GMVIAVKRLNQEGLQGHKEWLTEINYLGQLHHENLVRLIGYC  127



>ref|XP_009140954.1| PREDICTED: protein kinase APK1B, chloroplastic [Brassica rapa]
Length=418

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  375
            + D   +G   S  S    P++EGEILQSPNLKSF+ A++K  TR+FR D VLGEGGFG 
Sbjct  28   ANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFSVAEVKSETRNFRPDIVLGEGGFGC  87

Query  376  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            VFKGWI + SL+ +KPGTG+VIAVKR+N  G QGH EWLAE++YLG+FSHPNLVKLIGYC
Sbjct  88   VFKGWIYEQSLTASKPGTGMVIAVKRINQDGWQGHQEWLAEVDYLGKFSHPNLVKLIGYC  147



>ref|XP_008354131.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=427

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
            TP++EGEILQS NLKSF F +LK ATR+FR DS++GEGGFG V+KGW+D+NSL+  KPGT
Sbjct  58   TPRTEGEILQSSNLKSFAFNELKTATRNFRPDSMVGEGGFGSVYKGWVDENSLTAAKPGT  117

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVKRLN  GLQGH EWL E+NYLGQ  H NLV+LIGYC
Sbjct  118  GMVIAVKRLNQEGLQGHKEWLTEINYLGQLHHENLVRLIGYC  159



>ref|XP_010922319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=409

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P T +SE EILQ   L+ F F+DLK ATR+FR DSVLGEGGFG VFKGWID+++L+ +KP
Sbjct  48   PLTCRSEDEILQCSKLRCFAFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHALTASKP  107

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVKRLNH G QGH EWLAE+NYLGQ  HPNLV+LIGYC
Sbjct  108  GTGMVIAVKRLNHDGFQGHREWLAEVNYLGQLYHPNLVRLIGYC  151



>gb|EYU26593.1| hypothetical protein MIMGU_mgv1a007265mg [Erythranthe guttata]
Length=413

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +1

Query  172  GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  342
            G +S  ++S DG+ L  S SK S    P TP+SEGEIL S N+KSF   DLK ATR+FR 
Sbjct  22   GATSSKMVSGDGTELSNSSSKTSSASIPPTPRSEGEILNSSNMKSFQLFDLKAATRNFRP  81

Query  343  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFS  522
            DSV+GEGGFG VFKGWID++SL+ ++ G+G+VIAVKRLN  G QGH EWLAE+NYLGQ  
Sbjct  82   DSVIGEGGFGSVFKGWIDEHSLAASRAGSGIVIAVKRLNQDGWQGHKEWLAEINYLGQLR  141

Query  523  HPNLVKLIGYC  555
            HPNLVKLIGYC
Sbjct  142  HPNLVKLIGYC  152



>ref|XP_006650809.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=423

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 107/152 (70%), Gaps = 13/152 (9%)
 Frame = +1

Query  109  RIKIGSFYPFSSLFCYLLI*PGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQ  279
            RIK GS +P +S         G+ S+   + DGS L    S+ S    P   K+E EILQ
Sbjct  10   RIKDGSPHPGAS---------GMFSRSG-AKDGSRLSGCSSRASSASMPPMGKTECEILQ  59

Query  280  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  459
            S N+K F+F DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN
Sbjct  60   SANVKIFSFTDLRVATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLN  119

Query  460  HGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
               LQGH EWLAE+NYLGQF HPNLVKL GYC
Sbjct  120  QESLQGHREWLAEVNYLGQFCHPNLVKLFGYC  151



>ref|XP_009380641.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380642.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  423
            P TP+SE +ILQS N++SFTF +LK ATR+FR DSVLGEGGFG VFKGWID+++ +  KP
Sbjct  55   PATPRSEDDILQSVNVRSFTFNELKTATRNFRPDSVLGEGGFGSVFKGWIDEHTFAAAKP  114

Query  424  GTGLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            GTG+VIAVK+LN  G+QGH EWL E+NYLGQ SHP+LVKLIGYC
Sbjct  115  GTGMVIAVKKLNQEGVQGHREWLTEVNYLGQLSHPHLVKLIGYC  158



>gb|EMS53821.1| putative serine/threonine-protein kinase NAK [Triticum urartu]
Length=493

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  250  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  429
             P+SEGEIL+S N+K+F+F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGT
Sbjct  45   VPRSEGEILESANVKAFSFNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLTPTKPGT  104

Query  430  GLVIAVKRLNHGGLQGHSEWLAELNYLGQFSHPNLVKLIGYC  555
            G+VIAVK+LN    QGH EWLAE+NYLGQ SHPNLVKL+GYC
Sbjct  105  GMVIAVKKLNQESYQGHREWLAEVNYLGQLSHPNLVKLVGYC  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800