BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS114C10

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008445090.1|  PREDICTED: COP9 signalosome complex subunit ...    311   2e-102   Cucumis melo [Oriental melon]
ref|XP_004138765.1|  PREDICTED: COP9 signalosome complex subunit ...    311   3e-102   Cucumis sativus [cucumbers]
ref|XP_010111938.1|  COP9 signalosome complex subunit 5b                306   2e-100   
ref|XP_002283561.1|  PREDICTED: COP9 signalosome complex subunit ...    306   2e-100   Vitis vinifera
ref|XP_002527960.1|  jun activation domain binding protein, putative    304   1e-99    Ricinus communis
ref|XP_006450163.1|  hypothetical protein CICLE_v10008736mg             303   2e-99    
gb|KDP33444.1|  hypothetical protein JCGZ_07015                         304   2e-99    Jatropha curcas
ref|XP_007221779.1|  hypothetical protein PRUPE_ppa007500mg             303   2e-99    Prunus persica
ref|XP_004291259.1|  PREDICTED: COP9 signalosome complex subunit ...    303   4e-99    Fragaria vesca subsp. vesca
ref|XP_006351153.1|  PREDICTED: COP9 signalosome complex subunit ...    303   4e-99    Solanum tuberosum [potatoes]
ref|XP_011459046.1|  PREDICTED: COP9 signalosome complex subunit ...    303   4e-99    Fragaria vesca subsp. vesca
gb|KDO67279.1|  hypothetical protein CISIN_1g018085mg                   302   6e-99    Citrus sinensis [apfelsine]
gb|KDO67280.1|  hypothetical protein CISIN_1g018085mg                   302   7e-99    Citrus sinensis [apfelsine]
ref|XP_006450165.1|  hypothetical protein CICLE_v10008736mg             302   7e-99    Citrus clementina [clementine]
ref|XP_006450164.1|  hypothetical protein CICLE_v10008736mg             302   8e-99    Citrus clementina [clementine]
ref|XP_008378244.1|  PREDICTED: COP9 signalosome complex subunit ...    301   1e-98    Malus domestica [apple tree]
ref|XP_010259860.1|  PREDICTED: COP9 signalosome complex subunit ...    301   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_004241422.1|  PREDICTED: COP9 signalosome complex subunit 5b     300   5e-98    Solanum lycopersicum
ref|XP_010669282.1|  PREDICTED: COP9 signalosome complex subunit ...    300   6e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006347307.1|  PREDICTED: COP9 signalosome complex subunit ...    300   6e-98    Solanum tuberosum [potatoes]
ref|XP_009617619.1|  PREDICTED: COP9 signalosome complex subunit ...    300   7e-98    Nicotiana tomentosiformis
ref|XP_009786152.1|  PREDICTED: COP9 signalosome complex subunit ...    299   8e-98    Nicotiana sylvestris
ref|NP_001234331.1|  JAB                                                299   1e-97    
emb|CBL87025.1|  CSN5 protein                                           299   1e-97    Solanum lycopersicum
gb|KJB55194.1|  hypothetical protein B456_009G068200                    297   3e-97    Gossypium raimondii
gb|KJB55193.1|  hypothetical protein B456_009G068200                    296   3e-97    Gossypium raimondii
gb|KJB55192.1|  hypothetical protein B456_009G068200                    297   3e-97    Gossypium raimondii
gb|KJB55196.1|  hypothetical protein B456_009G068200                    296   3e-97    Gossypium raimondii
gb|KHG19604.1|  COP9 signalosome complex subunit 5b -like protein       297   4e-97    Gossypium arboreum [tree cotton]
gb|KJB55195.1|  hypothetical protein B456_009G068200                    297   4e-97    Gossypium raimondii
ref|XP_009338826.1|  PREDICTED: COP9 signalosome complex subunit ...    298   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_008393958.1|  PREDICTED: COP9 signalosome complex subunit ...    298   5e-97    
ref|XP_007137114.1|  hypothetical protein PHAVU_009G100700g             297   1e-96    Phaseolus vulgaris [French bean]
ref|XP_007011590.1|  COP9-signalosome 5B                                295   2e-96    
ref|XP_003522659.1|  PREDICTED: COP9 signalosome complex subunit 5a     296   3e-96    Glycine max [soybeans]
ref|XP_003526451.1|  PREDICTED: COP9 signalosome complex subunit 5a     295   5e-96    Glycine max [soybeans]
ref|XP_011076561.1|  PREDICTED: COP9 signalosome complex subunit ...    294   7e-96    Sesamum indicum [beniseed]
ref|XP_011031359.1|  PREDICTED: COP9 signalosome complex subunit ...    294   1e-95    Populus euphratica
gb|KFK41544.1|  hypothetical protein AALP_AA2G143000                    293   3e-95    Arabis alpina [alpine rockcress]
ref|XP_002324396.1|  COP9 complex family protein                        292   6e-95    
ref|XP_002887356.1|  hypothetical protein ARALYDRAFT_894961             291   9e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_010471135.1|  PREDICTED: COP9 signalosome complex subunit ...    290   5e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004501247.1|  PREDICTED: COP9 signalosome complex subunit ...    289   5e-94    Cicer arietinum [garbanzo]
ref|XP_011082083.1|  PREDICTED: COP9 signalosome complex subunit ...    288   7e-94    Sesamum indicum [beniseed]
ref|XP_010551182.1|  PREDICTED: COP9 signalosome complex subunit 5b     289   9e-94    Tarenaya hassleriana [spider flower]
ref|XP_006302454.1|  hypothetical protein CARUB_v10020540mg             289   1e-93    Capsella rubella
ref|XP_011082082.1|  PREDICTED: COP9 signalosome complex subunit ...    288   1e-93    Sesamum indicum [beniseed]
ref|XP_010427950.1|  PREDICTED: COP9 signalosome complex subunit ...    288   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010048447.1|  PREDICTED: COP9 signalosome complex subunit ...    288   2e-93    Eucalyptus grandis [rose gum]
ref|XP_010415831.1|  PREDICTED: COP9 signalosome complex subunit ...    288   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_011045010.1|  PREDICTED: COP9 signalosome complex subunit ...    287   6e-93    Populus euphratica
gb|AAC36343.1|  AJH2                                                    286   9e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_177279.1|  COP9 signalosome complex subunit 5b                   286   1e-92    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34223.1|  unnamed protein product                                282   1e-92    Eutrema halophilum
ref|XP_006390791.1|  hypothetical protein EUTSA_v10018788mg             284   4e-92    Eutrema salsugineum [saltwater cress]
ref|XP_001775449.1|  predicted protein                                  285   6e-92    
gb|EPS57884.1|  hypothetical protein M569_16932                         280   7e-92    Genlisea aurea
gb|AAC26484.1|  putative JUN kinase activation domain binding pro...    283   1e-91    Medicago sativa [alfalfa]
ref|XP_003603531.1|  COP9 signalosome complex subunit 5b                283   1e-91    
ref|XP_010929274.1|  PREDICTED: COP9 signalosome complex subunit ...    283   2e-91    Elaeis guineensis
ref|XP_010914180.1|  PREDICTED: COP9 signalosome complex subunit ...    283   2e-91    Elaeis guineensis
ref|XP_010929275.1|  PREDICTED: COP9 signalosome complex subunit ...    281   4e-91    
ref|XP_008810007.1|  PREDICTED: COP9 signalosome complex subunit ...    282   5e-91    Phoenix dactylifera
gb|ACJ84456.1|  unknown                                                 282   5e-91    Medicago truncatula
gb|KFK44380.1|  hypothetical protein AALP_AA1G249900                    281   5e-91    Arabis alpina [alpine rockcress]
ref|XP_006305189.1|  hypothetical protein CARUB_v10009554mg             281   1e-90    Capsella rubella
ref|XP_006416142.1|  hypothetical protein EUTSA_v10008042mg             280   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_006382165.1|  COP9 complex family protein                        280   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010498782.1|  PREDICTED: COP9 signalosome complex subunit ...    279   5e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009115580.1|  PREDICTED: COP9 signalosome complex subunit 5b     279   7e-90    Brassica rapa
ref|XP_009420301.1|  PREDICTED: COP9 signalosome complex subunit ...    279   7e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG22386.1|  COP9 signalosome complex subunit 5a -like protein       278   1e-89    Gossypium arboreum [tree cotton]
ref|XP_010460061.1|  PREDICTED: COP9 signalosome complex subunit ...    278   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010477567.1|  PREDICTED: COP9 signalosome complex subunit 5b     277   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_002893252.1|  hypothetical protein ARALYDRAFT_472541             277   4e-89    
ref|XP_001752249.1|  predicted protein                                  277   5e-89    
gb|ABK24758.1|  unknown                                                 276   6e-89    Picea sitchensis
gb|KJB65954.1|  hypothetical protein B456_010G123100                    272   3e-88    Gossypium raimondii
gb|KJB65951.1|  hypothetical protein B456_010G123100                    273   4e-88    Gossypium raimondii
gb|KJB65952.1|  hypothetical protein B456_010G123100                    273   5e-88    Gossypium raimondii
gb|KJB65950.1|  hypothetical protein B456_010G123100                    272   6e-88    Gossypium raimondii
tpg|DAA35639.1|  TPA: hypothetical protein ZEAMMB73_882531              269   1e-87    
ref|XP_006845674.1|  hypothetical protein AMTR_s00019p00231450          273   2e-87    Amborella trichopoda
gb|AAC36344.1|  AJH1                                                    271   6e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65053.1|  putative JUN kinase activator protein                   271   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173705.1|  COP9 signalosome complex subunit 5a                   271   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_973890.1|  COP9 signalosome complex subunit 5a                   270   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149650.1|  COP9 signalosome complex subunit 5b                271   1e-86    Zea mays [maize]
ref|XP_006652935.1|  PREDICTED: COP9 signalosome complex subunit ...    270   2e-86    Oryza brachyantha
ref|XP_004960128.1|  PREDICTED: COP9 signalosome complex subunit ...    270   2e-86    Setaria italica
ref|NP_001054112.1|  Os04g0654700                                       270   3e-86    
ref|XP_009103210.1|  PREDICTED: COP9 signalosome complex subunit ...    268   9e-86    Brassica rapa
emb|CDY25761.1|  BnaA07g10210D                                          268   1e-85    Brassica napus [oilseed rape]
ref|XP_010240543.1|  PREDICTED: COP9 signalosome complex subunit ...    262   4e-83    Brachypodium distachyon [annual false brome]
ref|XP_002961002.1|  hypothetical protein SELMODRAFT_73440              261   9e-83    
dbj|BAJ93853.1|  predicted protein                                      260   2e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09486.1|  hypothetical protein F775_29820                         260   2e-82    
gb|EEC78160.1|  hypothetical protein OsI_17724                          256   2e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_002967006.1|  hypothetical protein SELMODRAFT_168868             253   1e-79    
emb|CAE03401.3|  OSJNBa0071I13.2                                        248   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EMS48301.1|  COP9 signalosome complex subunit 5b                     244   1e-76    Triticum urartu
gb|EPB91337.1|  COP9 signalosome complex subunit 5a                     231   2e-71    Mucor circinelloides f. circinelloides 1006PhL
gb|AAR10246.1|  similar to Drosophila melanogaster CSN5                 224   6e-71    Drosophila yakuba
emb|CEJ02827.1|  Putative COP9 signalosome complex subunit 5a           224   7e-71    Rhizopus microsporus
ref|XP_008485715.1|  PREDICTED: COP9 signalosome complex subunit ...    229   1e-70    Diaphorina citri
ref|XP_008479869.1|  PREDICTED: COP9 signalosome complex subunit ...    229   1e-70    Diaphorina citri
dbj|GAN00834.1|  COP9-signalosome 5B                                    231   1e-70    Mucor ambiguus
ref|XP_006675144.1|  hypothetical protein BATDEDRAFT_15731              229   1e-70    Batrachochytrium dendrobatidis JAM81
ref|XP_001990340.1|  GH19288                                            226   1e-69    Drosophila grimshawi
gb|KDR11248.1|  COP9 signalosome complex subunit 5                      226   1e-69    Zootermopsis nevadensis
ref|XP_002408598.1|  COP9 signalosome, subunit CSN5, putative           224   1e-69    
ref|XP_002422812.1|  COP9 signalosome complex subunit, putative         226   2e-69    Pediculus humanus corporis [human body lice]
ref|XP_001954897.1|  GF18500                                            225   2e-69    
gb|ADP30958.1|  COP9 constitutive photomorphogenic-like protein s...    226   2e-69    Penaeus monodon [giant tiger prawn]
dbj|BAN21083.1|  jun activation domain binding protein                  226   3e-69    Riptortus pedestris
gb|AAD27862.2|AF132563_1  LD14392p                                      226   3e-69    Drosophila melanogaster
emb|CEG64164.1|  Putative COP9 signalosome complex subunit 5a           225   4e-69    Rhizopus microsporus
ref|NP_001262639.1|  COP9 complex homolog subunit 5, isoform B          224   4e-69    Drosophila melanogaster
ref|XP_001980192.1|  GG17007                                            224   5e-69    Drosophila erecta
ref|NP_477442.1|  COP9 complex homolog subunit 5, isoform A             224   5e-69    Drosophila melanogaster
ref|XP_002074130.1|  GK14483                                            224   6e-69    Drosophila willistoni
ref|NP_001138802.1|  JAB-MPN domain protein                             225   7e-69    Bombyx mori [silk moth]
ref|XP_006565324.1|  PREDICTED: COP9 signalosome complex subunit ...    225   8e-69    Apis mellifera [bee]
ref|XP_002056387.1|  GJ10255                                            224   8e-69    Drosophila virilis
ref|XP_001998673.1|  GI23503                                            224   1e-68    Drosophila mojavensis
ref|XP_008217721.1|  PREDICTED: COP9 signalosome complex subunit ...    224   2e-68    
ref|XP_008217730.1|  PREDICTED: COP9 signalosome complex subunit ...    224   2e-68    Nasonia vitripennis
ref|XP_011267966.1|  PREDICTED: COP9 signalosome complex subunit 5      223   2e-68    Camponotus floridanus
ref|XP_011448116.1|  PREDICTED: COP9 signalosome complex subunit ...    223   2e-68    Crassostrea gigas
ref|XP_001359383.1|  GA13321                                            223   2e-68    Drosophila pseudoobscura pseudoobscura
ref|XP_008185322.1|  PREDICTED: COP9 complex homolog subunit 5 is...    223   2e-68    Acyrthosiphon pisum
ref|XP_003424702.2|  PREDICTED: COP9 signalosome complex subunit ...    224   3e-68    Nasonia vitripennis
emb|CEG78022.1|  Putative COP9 signalosome complex subunit 5a           222   3e-68    Rhizopus microsporus
ref|XP_011448117.1|  PREDICTED: COP9 signalosome complex subunit ...    223   4e-68    
ref|XP_011332242.1|  PREDICTED: COP9 signalosome complex subunit 5      223   4e-68    Ooceraea biroi
ref|XP_011171452.1|  PREDICTED: COP9 signalosome complex subunit 5      223   4e-68    Solenopsis invicta [imported red fire ant]
emb|CDS11961.1|  Putative COP9 signalosome complex subunit 5a           222   4e-68    Lichtheimia ramosa
ref|XP_011147629.1|  PREDICTED: COP9 signalosome complex subunit ...    222   6e-68    Harpegnathos saltator
ref|XP_011049626.1|  PREDICTED: COP9 signalosome complex subunit ...    222   8e-68    Acromyrmex echinatior
ref|XP_011147628.1|  PREDICTED: COP9 signalosome complex subunit ...    222   8e-68    
ref|XP_011049625.1|  PREDICTED: COP9 signalosome complex subunit ...    222   9e-68    Acromyrmex echinatior
ref|XP_005099578.1|  PREDICTED: COP9 signalosome complex subunit ...    221   1e-67    Aplysia californica
gb|EYU29154.1|  hypothetical protein MIMGU_mgv1a0088022mg               214   1e-67    Erythranthe guttata [common monkey flower]
gb|EFN79117.1|  COP9 signalosome complex subunit 5                      223   1e-67    Harpegnathos saltator
gb|EXX54839.1|  Rri1p                                                   219   1e-67    Rhizophagus irregularis DAOM 197198w
gb|EIE80444.1|  hypothetical protein RO3G_05149                         221   1e-67    Rhizopus delemar RA 99-880
gb|AAD28608.1|AF129083_1  COP9 signalosome subunit 5 CSN5               221   1e-67    Drosophila melanogaster
dbj|BAM18530.1|  COP9 complex homolog subunit 5                         221   1e-67    Papilio xuthus [Chinese swallowtail]
ref|XP_011502813.1|  PREDICTED: COP9 signalosome complex subunit 5      221   1e-67    Ceratosolen solmsi marchali
ref|XP_003486847.1|  PREDICTED: COP9 signalosome complex subunit ...    221   2e-67    Bombus impatiens
ref|XP_003399828.1|  PREDICTED: COP9 signalosome complex subunit ...    221   2e-67    
ref|XP_003700698.1|  PREDICTED: COP9 signalosome complex subunit ...    221   2e-67    Megachile rotundata
ref|XP_623836.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    221   2e-67    Apis mellifera [bee]
ref|XP_011049624.1|  PREDICTED: COP9 signalosome complex subunit ...    222   2e-67    Acromyrmex echinatior
ref|XP_011147627.1|  PREDICTED: COP9 signalosome complex subunit ...    223   2e-67    Harpegnathos saltator
ref|XP_003399827.1|  PREDICTED: COP9 signalosome complex subunit ...    221   2e-67    Bombus terrestris [large earth bumblebee]
emb|CDH56438.1|  cop9 signalosome complex subunit 5a-like               221   2e-67    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011182476.1|  PREDICTED: COP9 signalosome complex subunit 5      220   2e-67    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_638491.1|  Mov34/MPN/PAD-1 family protein                        220   2e-67    Dictyostelium discoideum AX4
ref|XP_011209192.1|  PREDICTED: COP9 signalosome complex subunit 5      220   2e-67    Bactrocera dorsalis [papaya fruit fly]
ref|XP_001649479.1|  AAEL014747-PA                                      220   3e-67    
ref|XP_011292660.1|  PREDICTED: COP9 signalosome complex subunit 5      220   3e-67    Musca domestica
ref|NP_001156462.1|  COP9 complex homolog subunit 5                     220   3e-67    Acyrthosiphon pisum
gb|AEE62710.1|  unknown                                                 220   3e-67    Dendroctonus ponderosae
gb|ESA08506.1|  hypothetical protein GLOINDRAFT_349082                  221   4e-67    
ref|XP_008548790.1|  PREDICTED: COP9 signalosome complex subunit ...    219   7e-67    Microplitis demolitor
ref|XP_001862398.1|  COP9 signalosome complex subunit 5                 221   9e-67    Culex quinquefasciatus
gb|AET43978.1|  COP9 signalosome subunit 5                              219   1e-66    Reishia clavigera
gb|ETN63713.1|  jun activation domain binding protein                   219   1e-66    Anopheles darlingi [American malaria mosquito]
ref|XP_005851620.1|  hypothetical protein CHLNCDRAFT_19207              219   2e-66    Chlorella variabilis
dbj|GAM27607.1|  hypothetical protein SAMD00019534_107830               218   3e-66    Acytostelium subglobosum LB1
ref|XP_003292126.1|  Mov34/MPN/PAD-1 family protein                     217   3e-66    Dictyostelium purpureum
ref|XP_002103175.1|  GD19103                                            217   4e-66    
gb|KFB47242.1|  hypothetical protein ZHAS_00015265                      217   5e-66    Anopheles sinensis
ref|XP_001900779.1|  COP9 signalosome complex subunit 5                 217   5e-66    Brugia malayi [agent of lymphatic filariasis]
emb|CDP99135.1|  Protein BM-CSN-5, isoform b                            217   8e-66    Brugia malayi [agent of lymphatic filariasis]
ref|XP_972769.1|  PREDICTED: COP9 signalosome complex subunit 5         217   8e-66    
emb|CDP99134.1|  Protein BM-CSN-5, isoform d                            217   9e-66    Brugia malayi [agent of lymphatic filariasis]
gb|EJW89035.1|  JAB-MPN domain-containing protein                       216   1e-65    Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_009029035.1|  hypothetical protein HELRODRAFT_185158             216   1e-65    Helobdella robusta
gb|EFA83038.1|  Mov34/MPN/PAD-1 family protein                          217   1e-65    Heterostelium album PN500
gb|ERG87648.1|  cop9 signalosome complex subunit 5                      216   1e-65    
ref|XP_005648133.1|  Mov34-domain-containing protein                    216   1e-65    Coccomyxa subellipsoidea C-169
ref|XP_004354957.1|  Mov34/MPN/PAD-1 family protein                     216   2e-65    Cavenderia fasciculata
ref|XP_004353437.1|  signalosome complex protein                        216   2e-65    Acanthamoeba castellanii str. Neff
ref|XP_009045703.1|  hypothetical protein LOTGIDRAFT_224262             215   3e-65    Lottia gigantea
ref|XP_003323591.1|  COP9 signalosome complex subunit 5                 216   4e-65    Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EPZ33258.1|  JAB1/Mov34/MPN/PAD-1 domain-containing protein          214   5e-65    Rozella allomycis CSF55
ref|XP_312032.5|  AGAP002880-PA                                         214   5e-65    Anopheles gambiae str. PEST
ref|XP_005770092.1|  hypothetical protein EMIHUDRAFT_75732              214   6e-65    Emiliania huxleyi CCMP1516
ref|XP_004524029.1|  PREDICTED: COP9 signalosome complex subunit ...    214   7e-65    Ceratitis capitata [medfly]
ref|XP_004524030.1|  PREDICTED: COP9 signalosome complex subunit ...    214   8e-65    
ref|XP_004363323.1|  constitutive photomorphogenic 9 complex chai...    214   9e-65    Capsaspora owczarzaki ATCC 30864
gb|KHN85679.1|  COP9 signalosome complex subunit 5                      214   2e-64    Toxocara canis
ref|XP_002633848.1|  C. briggsae CBR-CSN-5 protein                      214   2e-64    Caenorhabditis briggsae
gb|KIZ06923.1|  COP9 signalosome complex subunit 5                      214   2e-64    Monoraphidium neglectum
ref|XP_002952633.1|  hypothetical protein VOLCADRAFT_81927              214   2e-64    Volvox carteri f. nagariensis
ref|NP_500841.1|  Protein CSN-5                                         214   2e-64    Caenorhabditis elegans [roundworm]
ref|XP_003712833.1|  COP9 signalosome complex subunit 5                 212   6e-64    Magnaporthe oryzae 70-15
ref|XP_003101399.1|  CRE-CSN-5 protein                                  213   6e-64    Caenorhabditis remanei
emb|CCG82078.1|  putative COP9 signalosome subunit 5                    212   6e-64    Taphrina deformans PYCC 5710
gb|EFO27045.2|  COP9 signalosome complex subunit 5                      212   7e-64    Loa loa
gb|KIL64761.1|  hypothetical protein M378DRAFT_77858                    212   7e-64    Amanita muscaria Koide BX008
gb|KFH67419.1|  COP9 signalosome complex subunit 5                      212   1e-63    Mortierella verticillata NRRL 6337
gb|EHL03671.1|  putative COP9 signalosome complex subunit 5             209   2e-63    Glarea lozoyensis 74030
gb|EYC46045.1|  hypothetical protein Y032_0410g948                      211   4e-63    Ancylostoma ceylanicum
gb|EYC46046.1|  hypothetical protein Y032_0410g948                      211   4e-63    Ancylostoma ceylanicum
ref|XP_011400031.1|  COP9 signalosome complex subunit 5b                206   4e-63    Auxenochlorella protothecoides
ref|XP_007410237.1|  hypothetical protein MELLADRAFT_116525             210   4e-63    Melampsora larici-populina 98AG31
gb|EGT56002.1|  hypothetical protein CAEBREN_15614                      210   4e-63    Caenorhabditis brenneri
gb|EGT48387.1|  hypothetical protein CAEBREN_22923                      210   5e-63    Caenorhabditis brenneri
ref|XP_007914606.1|  putative cop9 signalosome complex subunit 5 ...    209   7e-63    Phaeoacremonium minimum UCRPA7
gb|ESZ94555.1|  COP9 signalosome complex subunit 5                      209   9e-63    Sclerotinia borealis F-4128
ref|XP_008083662.1|  JAB1/MPN                                           209   1e-62    Glarea lozoyensis ATCC 20868
ref|XP_001694818.1|  COP signalosome subunit 5                          208   1e-62    Chlamydomonas reinhardtii
emb|CEF98127.1|  JAB/MPN domain                                         208   1e-62    Ostreococcus tauri
ref|XP_003740357.1|  PREDICTED: COP9 signalosome complex subunit ...    208   1e-62    
gb|KDE08164.1|  COP9 signalosome complex subunit 5                      209   2e-62    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_011297758.1|  PREDICTED: COP9 signalosome complex subunit 5      208   2e-62    Fopius arisanus
dbj|GAK66062.1|  mov34-domain-containing protein                        208   2e-62    Moesziomyces antarcticus
ref|XP_001636625.1|  predicted protein                                  207   2e-62    Nematostella vectensis
ref|XP_001595259.1|  hypothetical protein SS1G_03348                    207   3e-62    Sclerotinia sclerotiorum 1980 UF-70
gb|EHJ73122.1|  JAB-MPN domain protein                                  209   3e-62    
ref|XP_002507203.1|  predicted protein                                  207   3e-62    Micromonas commoda
ref|XP_001551965.1|  hypothetical protein BC1G_09577                    207   4e-62    Botrytis cinerea B05.10
ref|XP_002114449.1|  hypothetical protein TRIADDRAFT_27810              207   5e-62    Trichoplax adhaerens
ref|XP_007779451.1|  COP9 signalosome complex subunit 5                 207   6e-62    Coniosporium apollinis CBS 100218
emb|CDJ96405.1|  Mov34 MPN PAD-1 domain containing protein              207   8e-62    Haemonchus contortus [red stomach worm]
ref|XP_003137030.1|  COP9 signalosome complex subunit 5                 207   8e-62    
dbj|GAC74200.1|  COP9 signalosome, subunit CSN5                         207   9e-62    Moesziomyces antarcticus T-34
ref|XP_007792821.1|  putative cop9 signalosome complex subunit 5 ...    206   1e-61    
gb|KFZ02747.1|  hypothetical protein V502_11539                         206   1e-61    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_001418095.1|  predicted protein                                  205   1e-61    Ostreococcus lucimarinus CCE9901
ref|XP_001882520.1|  predicted protein                                  206   2e-61    Laccaria bicolor S238N-H82
gb|KIW00274.1|  hypothetical protein PV09_08164                         205   3e-61    Verruconis gallopava
gb|KFY66915.1|  hypothetical protein V496_01853                         205   3e-61    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KIJ90495.1|  hypothetical protein K443DRAFT_686728                   206   3e-61    Laccaria amethystina LaAM-08-1
ref|XP_002486987.1|  COP9 signalosome subunit CsnE                      205   3e-61    Talaromyces stipitatus ATCC 10500
gb|KDN39096.1|  Mov34-domain-containing protein                         207   3e-61    Tilletiaria anomala UBC 951
ref|XP_002609973.1|  hypothetical protein BRAFLDRAFT_124393             199   4e-61    Branchiostoma floridae
emb|CDJ85538.1|  Mov34 MPN PAD-1 domain containing protein              206   4e-61    Haemonchus contortus [red stomach worm]
ref|XP_006956806.1|  hypothetical protein WALSEDRAFT_59607              205   4e-61    Wallemia mellicola CBS 633.66
ref|XP_007876876.1|  hypothetical protein PFL1_01182                    206   4e-61    Anthracocystis flocculosa PF-1
ref|XP_002584116.1|  COP9 signalosome complex subunit 5                 204   4e-61    Uncinocarpus reesii 1704
ref|XP_007825082.1|  signaling protein                                  204   4e-61    Metarhizium robertsii ARSEF 23
gb|KFY87142.1|  hypothetical protein V500_07158                         204   5e-61    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_002145543.1|  COP9 signalosome subunit CsnE                      204   5e-61    Talaromyces marneffei ATCC 18224
gb|KFY28089.1|  hypothetical protein V493_03095                         204   5e-61    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KID75045.1|  COP9 signalosome complex subunit 5                      204   5e-61    Metarhizium brunneum ARSEF 3297
dbj|GAD91695.1|  COP9 signalosome complex subunit 5                     204   6e-61    Byssochlamys spectabilis No. 5
ref|XP_001249856.5|  PREDICTED: COP9 signalosome complex subunit ...    200   6e-61    
gb|KID87397.1|  COP9 signalosome complex subunit 5                      204   6e-61    Metarhizium guizhouense ARSEF 977
ref|XP_003408260.1|  PREDICTED: COP9 signalosome complex subunit 5      200   6e-61    Loxodonta africana [African bush elephant]
gb|ETS64168.1|  hypothetical protein PaG_01404                          204   7e-61    Moesziomyces aphidis DSM 70725
ref|XP_007248979.1|  PREDICTED: COP9 signalosome complex subunit 5      203   9e-61    Astyanax mexicanus [blind cave fish]
gb|KHJ34882.1|  putative cop9 signalosome complex subunit 5             203   9e-61    Erysiphe necator
gb|KEZ45359.1|  COP9 signalosome complex subunit 5                      203   1e-60    Scedosporium apiospermum
gb|KFY26627.1|  hypothetical protein V491_01230                         203   1e-60    Pseudogymnoascus sp. VKM F-3775
ref|XP_004773046.1|  PREDICTED: COP9 signalosome complex subunit 5      202   1e-60    
gb|KIN05013.1|  hypothetical protein OIDMADRAFT_142793                  203   1e-60    Oidiodendron maius Zn
ref|XP_009267304.1|  COP9 signalosome complex subunit 5                 203   1e-60    Wallemia ichthyophaga EXF-994
ref|XP_007811766.1|  COP9 signalosome complex subunit 5                 203   1e-60    Metarhizium acridum CQMa 102
ref|XP_004588161.1|  PREDICTED: COP9 signalosome complex subunit 5      202   1e-60    Ochotona princeps [southern American pika]
ref|XP_006006856.1|  PREDICTED: COP9 signalosome complex subunit ...    201   2e-60    Latimeria chalumnae
ref|XP_007885051.1|  PREDICTED: COP9 signalosome complex subunit ...    202   2e-60    Callorhinchus milii [Australian ghost shark]
gb|ACO14355.1|  COP9 signalosome complex subunit 5                      197   2e-60    Esox lucius
ref|XP_008148613.1|  PREDICTED: COP9 signalosome complex subunit 5      201   2e-60    
sp|Q5BBF1.2|CSN5_EMENI  RecName: Full=COP9 signalosome complex su...    202   3e-60    Aspergillus nidulans FGSC A4
ref|XP_006752490.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    202   3e-60    Leptonychotes weddellii
ref|XP_007527171.1|  PREDICTED: COP9 signalosome complex subunit 5      202   3e-60    Erinaceus europaeus [common hedgehog]
ref|XP_006150523.1|  PREDICTED: COP9 signalosome complex subunit ...    201   3e-60    
ref|NP_001179068.1|  COP9 signalosome complex subunit 5                 202   3e-60    Bos taurus [bovine]
ref|XP_007285194.1|  cop9 signalosome complex subunit 5                 202   3e-60    
gb|EFW19686.1|  COP9 signalosome complex subunit 5                      202   4e-60    Coccidioides posadasii str. Silveira
ref|XP_535093.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    202   4e-60    Canis lupus familiaris [dogs]
ref|XP_003831400.1|  PREDICTED: COP9 signalosome complex subunit 5      202   4e-60    Pan paniscus [bonobo]
gb|ELR58372.1|  COP9 signalosome complex subunit 5                      202   4e-60    Bos mutus
ref|NP_001020866.1|  COP9 signalosome complex subunit 5                 202   4e-60    Rattus norvegicus [brown rat]
ref|NP_989109.1|  COP9 signalosome complex subunit 5                    202   4e-60    Xenopus tropicalis [western clawed frog]
ref|XP_001494265.1|  PREDICTED: COP9 signalosome complex subunit ...    202   4e-60    
gb|KDR72698.1|  hypothetical protein GALMADRAFT_252900                  202   4e-60    
gb|ENH86283.1|  cop9 signalosome complex subunit 5                      202   4e-60    
ref|XP_004602468.1|  PREDICTED: COP9 signalosome complex subunit 5      202   4e-60    
gb|AAX37104.1|  COP9 constitutive photomorphogenic-like subunit 5       202   4e-60    
gb|AAP36860.1|  Homo sapiens COP9 constitutive photomorphogenic h...    202   4e-60    
ref|NP_006828.2|  COP9 signalosome complex subunit 5                    202   4e-60    
ref|NP_038743.1|  COP9 signalosome complex subunit 5 isoform 1          202   4e-60    
ref|XP_003067409.1|  COP9 signalosome complex subunit 5, putative       202   4e-60    
ref|XP_659733.1|  hypothetical protein AN2129.2                         202   4e-60    
ref|NP_001086291.1|  COP9 signalosome complex subunit 5                 201   5e-60    
gb|EIT80237.1|  COP9 signalosome, subunit CSN5                          201   5e-60    
ref|XP_006815652.1|  PREDICTED: COP9 signalosome complex subunit ...    200   5e-60    
gb|KFY77929.1|  hypothetical protein V499_02798                         202   5e-60    
ref|XP_008106749.1|  PREDICTED: COP9 signalosome complex subunit 5      202   5e-60    
gb|KFX90480.1|  hypothetical protein V490_06441                         202   5e-60    
ref|XP_004679877.1|  PREDICTED: COP9 signalosome complex subunit 5      201   5e-60    
gb|KIO31911.1|  hypothetical protein M407DRAFT_14046                    203   5e-60    
ref|XP_006131545.1|  PREDICTED: COP9 signalosome complex subunit ...    201   6e-60    
ref|XP_002129245.1|  PREDICTED: COP9 signalosome complex subunit ...    202   6e-60    
ref|XP_007429682.1|  PREDICTED: COP9 signalosome complex subunit 5      201   6e-60    
gb|KFG82749.1|  COP9 signalosome complex subunit 5                      201   7e-60    
ref|XP_007867853.1|  Mov34-domain-containing protein                    202   8e-60    
ref|XP_004842149.1|  PREDICTED: COP9 signalosome complex subunit ...    199   8e-60    
gb|KFZ06481.1|  hypothetical protein V501_07359                         201   8e-60    
gb|KID97652.1|  COP9 signalosome complex subunit 5                      201   9e-60    
ref|XP_004842148.1|  PREDICTED: COP9 signalosome complex subunit ...    200   9e-60    
ref|XP_007332426.1|  hypothetical protein AGABI1DRAFT_62649             201   9e-60    
ref|XP_003384689.1|  PREDICTED: COP9 signalosome complex subunit ...    201   9e-60    
gb|EJT99231.1|  Mov34-domain-containing protein                         202   9e-60    
ref|XP_009217063.1|  COP9 signalosome complex subunit 5                 201   9e-60    
gb|KFY38702.1|  hypothetical protein V494_04244                         201   1e-59    
gb|KFY07234.1|  hypothetical protein V492_07331                         201   1e-59    
ref|XP_001397194.2|  COP9 signalosome complex subunit 5                 201   1e-59    
ref|NP_001098770.1|  COP9 signalosome complex subunit 5                 201   1e-59    
ref|XP_001368118.1|  PREDICTED: COP9 signalosome complex subunit 5      201   1e-59    
gb|EPS32803.1|  hypothetical protein PDE_07763                          201   1e-59    
dbj|GAA91502.1|  COP9 signalosome subunit CsnE                          201   1e-59    
ref|XP_007839403.1|  COP9 signalosome complex subunit 5                 201   1e-59    
gb|KDN64741.1|  putative Mov34/MPN/PAD-1 family protein                 201   1e-59    
emb|CEJ93266.1|  Putative COP9 signalosome complex subunit 5            200   1e-59    
ref|XP_001239887.1|  hypothetical protein CIMG_09508                    200   1e-59    
ref|XP_001822456.2|  COP9 signalosome complex subunit 5                 200   1e-59    
emb|CAK42618.1|  unnamed protein product                                201   1e-59    
emb|CDI54484.1|  probable COP9 signalosome subunit 5 CSN5               202   2e-59    
dbj|GAA97544.1|  hypothetical protein E5Q_04222                         201   2e-59    
ref|XP_005066755.1|  PREDICTED: COP9 signalosome complex subunit 5      202   2e-59    
ref|XP_003967989.1|  PREDICTED: COP9 signalosome complex subunit ...    200   2e-59    
ref|XP_006006855.1|  PREDICTED: COP9 signalosome complex subunit ...    200   2e-59    
ref|XP_003056186.1|  predicted protein                                  200   2e-59    
gb|EGW14995.1|  COP9 signalosome complex subunit 5                      200   2e-59    
ref|XP_006069587.1|  PREDICTED: COP9 signalosome complex subunit ...    200   2e-59    
ref|XP_006262064.1|  PREDICTED: COP9 signalosome complex subunit 5      199   2e-59    
emb|CAG00664.1|  unnamed protein product                                200   2e-59    
gb|ETE60341.1|  COP9 signalosome complex subunit 5                      201   2e-59    
gb|EPQ62061.1|  Catalytic subunit of the COP9 signalosome complex       199   2e-59    
ref|XP_006464013.1|  hypothetical protein AGABI2DRAFT_209023            200   2e-59    
ref|XP_009957065.1|  PREDICTED: COP9 signalosome complex subunit ...    199   2e-59    
ref|XP_001512862.1|  PREDICTED: COP9 signalosome complex subunit 5      199   3e-59    
gb|EFQ25122.1|  Mov34/MPN/PAD-1 family protein                          200   3e-59    
gb|ELR02314.1|  COP9 signalosome complex subunit 5                      200   3e-59    
emb|CCU75067.1|  COP9 signalosome complex subunit 5                     199   3e-59    
ref|XP_008072512.1|  PREDICTED: COP9 signalosome complex subunit 5      201   3e-59    
ref|XP_007651216.1|  PREDICTED: COP9 signalosome complex subunit ...    201   3e-59    
ref|XP_011109554.1|  hypothetical protein H072_3584                     200   3e-59    
ref|XP_001211499.1|  COP9 signalosome complex subunit 5                 199   3e-59    
ref|XP_005311431.1|  PREDICTED: COP9 signalosome complex subunit ...    199   3e-59    
gb|KFP96001.1|  COP9 signalosome complex subunit 5                      199   3e-59    
ref|XP_010777475.1|  PREDICTED: COP9 signalosome complex subunit 5      195   3e-59    
ref|XP_011120074.1|  hypothetical protein AOL_s00054g456                200   3e-59    
ref|XP_006069586.1|  PREDICTED: COP9 signalosome complex subunit ...    201   4e-59    
gb|AAB16847.1|  Jun activation domain binding protein                   199   4e-59    
ref|XP_003003370.1|  COP9 signalosome complex subunit 5                 200   4e-59    
ref|XP_008041270.1|  Mov34-domain-containing protein                    200   5e-59    
gb|EGU11163.1|  COP9 signalosome complex subunit 5                      200   5e-59    
ref|XP_007634273.1|  PREDICTED: COP9 signalosome complex subunit ...    201   5e-59    
ref|XP_011390212.1|  putative COP9 signalosome, subunit 5               201   5e-59    
emb|CDO75755.1|  hypothetical protein BN946_scf184921.g31               199   5e-59    
ref|XP_002678028.1|  jun kinase activation domain binding protein       199   6e-59    
ref|XP_005866406.1|  PREDICTED: COP9 signalosome complex subunit 5      199   6e-59    
ref|XP_008597491.1|  Mov34/MPN/PAD-1 family protein                     199   6e-59    
gb|AII16527.1|  COP9 signalosome complex subunit 5                      199   6e-59    
gb|ELW64697.1|  COP9 signalosome complex subunit 5                      202   8e-59    
dbj|GAM35035.1|  hypothetical protein TCE0_015r03023                    199   8e-59    
ref|XP_010756604.1|  COP9 signalosome complex subunit 5                 198   9e-59    
gb|KIO05285.1|  hypothetical protein M404DRAFT_999877                   199   9e-59    
ref|XP_001538829.1|  COP9 signalosome complex subunit 5                 199   9e-59    
ref|XP_004081080.1|  PREDICTED: COP9 signalosome complex subunit 5      198   9e-59    
gb|EEH04320.1|  COP9 signalosome complex subunit                        199   9e-59    
ref|XP_001275909.1|  COP9 signalosome subunit CsnE                      198   1e-58    
gb|KII84562.1|  hypothetical protein PLICRDRAFT_179381                  199   1e-58    
gb|EYE96574.1|  COP9 signalosome subunit CsnE                           198   1e-58    
gb|KEY80982.1|  COP9 signalosome subunit CsnE                           198   1e-58    
ref|XP_755961.2|  COP9 signalosome subunit CsnE                         198   1e-58    
gb|EDP55131.1|  COP9 signalosome subunit 5 (CsnE), putative             198   1e-58    
ref|XP_007554550.1|  PREDICTED: COP9 signalosome complex subunit 5      198   1e-58    
ref|XP_005797898.1|  PREDICTED: COP9 signalosome complex subunit ...    198   1e-58    
ref|XP_002626520.1|  COP9 signalosome complex subunit 5                 198   1e-58    
gb|KIM42468.1|  hypothetical protein M413DRAFT_444883                   199   1e-58    
gb|EPY74001.1|  COP9 signalosome complex subunit 5 isoform 1            202   1e-58    
ref|XP_008394459.1|  PREDICTED: COP9 signalosome complex subunit 5      198   1e-58    
ref|XP_007601215.1|  Mov34/MPN/PAD-1 family protein                     198   1e-58    
ref|XP_010732391.1|  PREDICTED: COP9 signalosome complex subunit 5      197   1e-58    
ref|NP_957019.1|  COP9 signalosome complex subunit 5                    197   1e-58    
ref|XP_003045242.1|  predicted protein                                  197   2e-58    
gb|EPE04275.1|  cop9 signalosome complex subunit 5                      198   2e-58    
ref|XP_008305996.1|  PREDICTED: COP9 signalosome complex subunit 5      197   2e-58    
ref|XP_009658052.1|  COP9 signalosome complex subunit 5                 198   2e-58    
ref|NP_001034400.1|  COP9 signalosome complex subunit 5                 197   2e-58    
emb|CCA72027.1|  probable COP9 signalosome subunit 5 CSN5               198   2e-58    
gb|KFO20318.1|  COP9 signalosome complex subunit 5                      203   2e-58    
ref|XP_009083861.1|  PREDICTED: COP9 signalosome complex subunit ...    197   2e-58    
ref|XP_005150843.1|  PREDICTED: COP9 signalosome complex subunit ...    197   2e-58    
ref|XP_005517166.1|  PREDICTED: COP9 signalosome complex subunit ...    197   3e-58    
ref|XP_010574204.1|  PREDICTED: COP9 signalosome complex subunit ...    197   3e-58    
ref|XP_003443502.1|  PREDICTED: COP9 signalosome complex subunit ...    197   3e-58    
ref|XP_010884175.1|  PREDICTED: COP9 signalosome complex subunit 5      197   3e-58    
ref|XP_006634059.1|  PREDICTED: COP9 signalosome complex subunit ...    197   3e-58    
ref|XP_005833249.1|  hypothetical protein GUITHDRAFT_107880             197   3e-58    
ref|NP_001232700.1|  putative JUN activation binding protein vari...    197   3e-58    
gb|EMS21844.1|  COP9 signalosome complex subunit 5                      198   3e-58    
emb|CBN81931.1|  COP9 signalosome complex subunit 5                     197   3e-58    
emb|CBQ68370.1|  probable COP9 signalosome subunit 5 CSN5               199   3e-58    
gb|ACO09632.1|  COP9 signalosome complex subunit 5                      196   4e-58    
ref|XP_007856350.1|  cop9 signalosome complex subunit 5                 197   5e-58    
ref|XP_002791463.1|  COP9 signalosome complex subunit 5                 196   5e-58    
gb|EST07993.1|  hypothetical protein PSEUBRA_SCAF19g03258               197   5e-58    
gb|EWC48220.1|  COP9 signalosome complex subunit 5                      197   6e-58    
gb|EKG20488.1|  Mov34/MPN/PAD-1                                         196   6e-58    
ref|XP_002837843.1|  hypothetical protein                               196   6e-58    
emb|CEG04727.1|  unnamed protein product                                196   7e-58    
ref|XP_009260100.1|  hypothetical protein FPSE_08707                    196   7e-58    
ref|XP_011318525.1|  COP9 signalosome complex subunit 5                 196   7e-58    
gb|KDQ60418.1|  hypothetical protein JAAARDRAFT_32821                   196   8e-58    
ref|XP_007263567.1|  Mov34-domain-containing protein                    196   9e-58    
gb|KDQ24552.1|  hypothetical protein PLEOSDRAFT_1094348                 196   9e-58    
gb|KIL95922.1|  hypothetical protein FAVG1_00660                        196   9e-58    
ref|XP_006965508.1|  signaling protein                                  196   9e-58    
gb|EGD96904.1|  COP9 signalosome complex subunit 5                      196   1e-57    
gb|ACI68431.1|  COP9 signalosome complex subunit 5                      195   1e-57    
dbj|GAC92515.1|  hypothetical protein PHSY_000069                       199   1e-57    
ref|XP_003079540.1|  COP9 signalosome, subunit CSN5 (ISS)               196   1e-57    
ref|XP_003170580.1|  COP9 signalosome complex subunit 5                 196   1e-57    
ref|XP_007289754.1|  COP9 signalosome complex subunit 5                 197   1e-57    
gb|KHN97596.1|  COP9 signalosome complex subunit 5                      195   1e-57    
ref|XP_007066265.1|  PREDICTED: COP9 signalosome complex subunit 5      195   1e-57    
gb|KIY62389.1|  Mov34-domain-containing protein                         196   1e-57    
gb|ERE86124.1|  COP9 signalosome complex subunit 5                      203   1e-57    
emb|CCF45142.1|  COP9 signalosome complex subunit 5                     189   1e-57    
gb|KJA26913.1|  hypothetical protein HYPSUDRAFT_36079                   196   2e-57    
gb|KIM86852.1|  hypothetical protein PILCRDRAFT_289786                  196   2e-57    
ref|XP_003234683.1|  COP9 signalosome complex subunit 5                 195   2e-57    
gb|EFX02985.1|  cop9 signalosome complex subunit 5                      195   2e-57    
dbj|GAA27173.1|  COP9 signalosome complex subunit 5                     195   2e-57    
gb|KIM33767.1|  hypothetical protein M408DRAFT_325370                   196   2e-57    
pdb|4D18|E  Chain E, Crystal Structure Of The Cop9 Signalosome          194   2e-57    
gb|KJB06586.1|  hypothetical protein B456_001G001700                    189   3e-57    
gb|KFM00893.1|  COP9 signalosome complex subunit 5                      194   3e-57    
gb|KIK65834.1|  hypothetical protein GYMLUDRAFT_38312                   195   3e-57    
gb|KIH87190.1|  COP9 signalosome complex subunit 5                      195   3e-57    
gb|EMD34840.1|  hypothetical protein CERSUDRAFT_117048                  195   4e-57    
ref|XP_003301972.1|  hypothetical protein PTT_13630                     195   4e-57    
ref|NP_001158520.1|  COP9 signalosome complex subunit 5                 194   4e-57    
ref|XP_003029105.1|  hypothetical protein SCHCODRAFT_70193              195   4e-57    
ref|XP_002848322.1|  COP9 signalosome complex subunit 5                 194   4e-57    
gb|EHK17806.1|  hypothetical protein TRIVIDRAFT_43384                   194   4e-57    
gb|KIP09733.1|  hypothetical protein PHLGIDRAFT_18515                   194   4e-57    
emb|CEP10016.1|  hypothetical protein                                   196   5e-57    
ref|XP_001261089.1|  COP9 signalosome subunit 5 (CsnE), putative        194   5e-57    
ref|XP_004047172.1|  PREDICTED: COP9 signalosome complex subunit 5      197   5e-57    
ref|XP_008989617.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    195   7e-57    
ref|XP_005705078.1|  COP9 signalosome complex subunit 5                 193   7e-57    
dbj|BAE61323.1|  unnamed protein product                                193   8e-57    
ref|XP_002567243.1|  Pc21g01770                                         193   9e-57    
ref|XP_006667797.1|  COP9 signalosome complex subunit 5                 193   1e-56    
ref|XP_007772746.1|  Mov34-domain-containing protein                    196   1e-56    
ref|XP_007313368.1|  hypothetical protein SERLADRAFT_456480             194   1e-56    
gb|KFQ58471.1|  COP9 signalosome complex subunit 5                      191   1e-56    
emb|CEF67816.1|  COP9 signalosome complex subunit 5                     194   1e-56    
ref|XP_009552267.1|  Metallo peptidase M67A                             193   1e-56    
gb|KIJ18085.1|  hypothetical protein PAXINDRAFT_167370                  193   2e-56    
ref|XP_007363558.1|  Mov34-domain-containing protein                    193   2e-56    
ref|XP_009274936.1|  PREDICTED: COP9 signalosome complex subunit 5      192   2e-56    
ref|XP_003842050.1|  hypothetical protein LEMA_P078100.1                194   2e-56    
emb|CCF50521.1|  probable COP9 signalosome subunit 5 CSN5               194   3e-56    
ref|XP_007674494.1|  hypothetical protein BAUCODRAFT_32485              192   3e-56    
gb|EMD90731.1|  hypothetical protein COCHEDRAFT_1022509                 192   4e-56    
gb|KIJ63800.1|  hypothetical protein HYDPIDRAFT_40823                   192   4e-56    
gb|KDQ08143.1|  hypothetical protein BOTBODRAFT_38129                   192   4e-56    
gb|KGO74703.1|  JAB1/Mov34/MPN/PAD-1                                    191   4e-56    
gb|AAD03468.1|  38 kDa Mov34 homolog                                    191   4e-56    
ref|XP_008022372.1|  hypothetical protein SETTUDRAFT_146496             192   4e-56    
gb|KGO43020.1|  JAB1/Mov34/MPN/PAD-1                                    191   5e-56    
gb|EHK48656.1|  hypothetical protein TRIATDRAFT_134074                  191   5e-56    
ref|XP_007715257.1|  hypothetical protein COCCADRAFT_103980             191   5e-56    
gb|EKV06221.1|  COP9 signalosome complex subunit 5                      191   6e-56    
ref|XP_007682348.1|  hypothetical protein COCMIDRAFT_31624              191   6e-56    
gb|EWZ38250.1|  COP9 signalosome complex subunit 5                      191   6e-56    
ref|XP_007705204.1|  hypothetical protein COCSADRAFT_31162              191   6e-56    
emb|CCD78036.1|  Jab1/MPN domain metalloenzyme (M67 family)             191   7e-56    
ref|XP_007394451.1|  hypothetical protein PHACADRAFT_253814             191   7e-56    
ref|XP_007586662.1|  putative cop9 signalosome complex subunit 5 ...    191   8e-56    
ref|XP_004638141.1|  PREDICTED: COP9 signalosome complex subunit ...    191   9e-56    
ref|XP_007303304.1|  Mov34-domain-containing protein                    191   1e-55    
ref|XP_004991817.1|  COP9 signalosome complex subunit 5                 187   1e-55    
gb|EGU77467.1|  hypothetical protein FOXB_12018                         190   1e-55    
gb|KEY69019.1|  hypothetical protein S7711_03321                        191   1e-55    
gb|ENH66122.1|  COP9 signalosome complex subunit 5                      190   1e-55    
gb|KFA65470.1|  hypothetical protein S40285_00541                       191   1e-55    
gb|EXM23599.1|  COP9 signalosome complex subunit 5                      190   1e-55    
gb|KFA52787.1|  hypothetical protein S40293_00864                       191   1e-55    
ref|XP_003663109.1|  hypothetical protein MYCTH_2034994                 189   2e-55    
ref|XP_007383497.1|  Mov34-domain-containing protein                    191   2e-55    
emb|CEL63357.1|  COP9 signalosome complex subunit 5                     191   2e-55    
gb|KEQ90620.1|  hypothetical protein AUEXF2481DRAFT_44949               190   2e-55    
gb|KIK40381.1|  hypothetical protein CY34DRAFT_807228                   190   2e-55    
gb|EMT70768.1|  COP9 signalosome complex subunit 5                      189   2e-55    
ref|XP_003010514.1|  hypothetical protein ARB_03215                     190   3e-55    
ref|XP_003023342.1|  hypothetical protein TRV_02444                     190   3e-55    
ref|XP_001384461.2|  COP9 signalosome subunit 5A / CSN subunit 5A...    186   3e-55    
gb|KIJ25292.1|  hypothetical protein M422DRAFT_785628                   191   3e-55    



>ref|XP_008445090.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Cucumis 
melo]
Length=365

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  59   QNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  118

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  172



>ref|XP_004138765.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 ref|XP_004160845.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 gb|KGN62874.1| hypothetical protein Csa_2G378560 [Cucumis sativus]
Length=365

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  59   QNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  118

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  172



>ref|XP_010111938.1| COP9 signalosome complex subunit 5b [Morus notabilis]
 gb|EXC32056.1| COP9 signalosome complex subunit 5b [Morus notabilis]
Length=368

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLP-PTsadsaaasassdaIFYYDETAQTKFQQEKP  206
            M++F SS+ IAQ+TWE+ENN+  M+ P P +   ++   SSDA+FYYDE AQ KFQQEKP
Sbjct  1    MEAFPSSSQIAQQTWELENNIIPMETPTPPATAKSSGGDSSDAVFYYDEAAQAKFQQEKP  60

Query  207  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  386
            W+NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE
Sbjct  61   WSNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  120

Query  387  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  175



>ref|XP_002283561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Vitis vinifera]
Length=360

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 156/172 (91%), Gaps = 9/172 (5%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            SFTSSA+IAQKTWE+ENN+ +MD P         SA SD+IF+YD+ AQ KFQQEKPW N
Sbjct  5    SFTSSASIAQKTWELENNIASMDAP---------SADSDSIFFYDDAAQAKFQQEKPWAN  55

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYFKRVKISALALLKMVVHARSGG IEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV
Sbjct  56   DPHYFKRVKISALALLKMVVHARSGGNIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  115

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>ref|XP_002527960.1| jun activation domain binding protein, putative [Ricinus communis]
 gb|EEF34372.1| jun activation domain binding protein, putative [Ricinus communis]
Length=367

 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +SS+ IAQKTWE+ENN+ T+D PPT+  +A  S+ +  IFYYDE AQ KFQQ++PW+NDP
Sbjct  7    SSSSVIAQKTWELENNIITVDTPPTTNSTADPSSDA--IFYYDEPAQVKFQQDRPWSNDP  64

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA
Sbjct  65   HYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  124

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  125  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_006450163.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 gb|ESR63403.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=337

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  120

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  AYEYMVDYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>gb|KDP33444.1| hypothetical protein JCGZ_07015 [Jatropha curcas]
Length=366

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 161/175 (92%), Gaps = 3/175 (2%)
 Frame = +3

Query  30   MDSFTSSAA-IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  206
            MD + SS+A IAQKTWE+ENN+ T+D  PT+  +A AS+ +  IFYYDETAQ KFQQ+KP
Sbjct  1    MDPYPSSSALIAQKTWELENNIITVDTSPTTNSTADASSDA--IFYYDETAQAKFQQDKP  58

Query  207  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  386
            W NDPHYF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE
Sbjct  59   WANDPHYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  118

Query  387  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TRVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  TRVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  173



>ref|XP_007221779.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
 ref|XP_008219932.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Prunus mume]
 gb|EMJ22978.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
Length=366

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A IAQ+TWE+ENN+  MD PP+ A S A  ++   IFYYDE AQ KFQQEKPWTNDPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKSKADPSADA-IFYYDEAAQAKFQQEKPWTNDPHYF  61

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  121

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  122  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_004291259.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=359

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  60   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  119

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  166



>ref|XP_006351153.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 164/174 (94%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_011459046.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=360

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  60   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  119

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  166



>gb|KDO67279.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=361

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  120

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  AYEYMVDYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>gb|KDO67280.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=360

 Score =   302 bits (773),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  120

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  AYEYMVDYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>ref|XP_006450165.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483570.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Citrus sinensis]
 gb|ESR63405.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=360

 Score =   302 bits (773),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  120

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  AYEYMVDYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>ref|XP_006450164.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483569.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Citrus sinensis]
 gb|ESR63404.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=361

 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  61   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  120

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  AYEYMVDYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>ref|XP_008378244.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=367

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A IAQ+TWE+ENNV  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    AQIAQQTWELENNVIPMDTPPSVAKPKADPTADA-IFYYDEAAQVKFQQEKPWANDPHYF  61

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  121

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  122  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_010259860.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nelumbo 
nucifera]
Length=363

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 157/176 (89%), Gaps = 11/176 (6%)
 Frame = +3

Query  30   MDSFT--SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  203
            MDSF+  SSAA+AQ+TWE+ENN+  M+ P          A SDAI++YDE AQ KFQQEK
Sbjct  1    MDSFSVSSSAAMAQQTWELENNIVNMEGP---------LADSDAIYFYDEAAQAKFQQEK  51

Query  204  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  383
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT
Sbjct  52   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  111

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>ref|XP_004241422.1| PREDICTED: COP9 signalosome complex subunit 5b [Solanum lycopersicum]
Length=367

 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 162/174 (93%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSKPENSASDAIFHYDDAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   ASDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_010669282.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   300 bits (768),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 165/186 (89%), Gaps = 12/186 (6%)
 Frame = +3

Query  12   PRALHLMDSFTSSAAIAQKTWEIENNVETMD------LPPTsadsaaasassdaIFYYDE  173
            P+AL      +SSAA+A++TWE+ENN+ET+D         T+  +  +S +SDAIF+YDE
Sbjct  3    PKAL------SSSAAMAKQTWELENNIETIDPTTTTTTTTTTTTTTTSSDASDAIFFYDE  56

Query  174  TAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVM  353
            +AQTKFQQEKPW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVM
Sbjct  57   SAQTKFQQEKPWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVM  116

Query  354  DAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVS  533
            DAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVS
Sbjct  117  DAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVS  176

Query  534  TQMLNQ  551
            TQMLNQ
Sbjct  177  TQMLNQ  182



>ref|XP_006347307.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 162/174 (93%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSTPENSASDAIFHYDDAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   ASDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_009617619.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
tomentosiformis]
Length=367

 Score =   300 bits (767),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 162/174 (93%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   +++SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENSASDAIFHYDEAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   ASDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVTTQMLNQ  174



>ref|XP_009786152.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
sylvestris]
Length=367

 Score =   299 bits (766),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   + +SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENLASDAIFHYDEAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   ASDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVTTQMLNQ  174



>ref|NP_001234331.1| JAB [Solanum lycopersicum]
 gb|AAG43411.1| JAB [Solanum lycopersicum]
Length=367

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVTTQMLNQ  174



>emb|CBL87025.1| CSN5 protein [Solanum lycopersicum]
Length=367

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVTTQMLNQ  174



>gb|KJB55194.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=333

 Score =   297 bits (760),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB55193.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=318

 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB55192.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=350

 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB55196.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=324

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KHG19604.1| COP9 signalosome complex subunit 5b -like protein [Gossypium 
arboreum]
 gb|KJB55191.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=352

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB55195.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=346

 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 151/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>ref|XP_009338826.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Pyrus x 
bretschneideri]
Length=367

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A IAQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW +DPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKPKADPTADA-IFYYDEAAQAKFQQEKPWASDPHYF  61

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  121

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  122  AYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_008393958.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=376

 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A +AQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    AQLAQQTWELENNIXPMDTPPSVAKPKADPKADA-IFYYDEAAQAKFQQEKPWANDPHYF  61

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  62   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  121

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV++SQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  122  AYEYMVEFSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_007137114.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
 gb|ESW09108.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
Length=374

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLP--PTsadsaaasassdaIFYYDETAQTKFQQEK  203
            M+  TSS+AIAQKTWE+ENN+  MD P   +S+ +A A+ + D+IFYYDE  Q +FQ++K
Sbjct  6    MEGLTSSSAIAQKTWELENNIIPMDTPGAASSSSTATATNADDSIFYYDEAGQNEFQRDK  65

Query  204  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  383
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD DAIIVMDAFALPVEGT
Sbjct  66   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDADAIIVMDAFALPVEGT  125

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  126  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  181



>ref|XP_007011590.1| COP9-signalosome 5B [Theobroma cacao]
 gb|EOY29209.1| COP9-signalosome 5B [Theobroma cacao]
Length=351

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 150/167 (90%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQK WE+ENN+ T+D P           SSD+IFYYD  AQTKFQQEKPW NDPHYF
Sbjct  3    SAIAQKRWELENNILTVDTP---------DPSSDSIFYYDGPAQTKFQQEKPWANDPHYF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>ref|XP_003522659.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=374

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLP--PTsadsaaasassdaIFYYDETAQTKFQQEK  203
            M+  +SS+AIAQKTWE+ENN+  MD P     + +   +++ D+IFYYDE  Q +FQ++K
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAAISSTTTTTSADDSIFYYDEAGQNEFQRDK  65

Query  204  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  383
            PW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD DAIIVMDAFALPVEGT
Sbjct  66   PWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDADAIIVMDAFALPVEGT  125

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  126  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  181



>ref|XP_003526451.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=375

 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 3/177 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLP---PTsadsaaasassdaIFYYDETAQTKFQQE  200
            M+  +SS+AIAQKTWE+ENN+  MD P    TS+ +   + + D+IFYYDE  Q +FQ++
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAATSSTATTTTNADDSIFYYDEAGQNEFQRD  65

Query  201  KPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEG  380
            KPW NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD DAIIVMDAFALPVEG
Sbjct  66   KPWANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDADAIIVMDAFALPVEG  125

Query  381  TETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  126  TETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  182



>ref|XP_011076561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Sesamum 
indicum]
Length=361

 Score =   294 bits (753),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 158/174 (91%), Gaps = 6/174 (3%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MD F SSAAIA++TWE+ENN+ +         S +++A+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDPF-SSAAIARQTWELENNIVS-----AGDASDSSAAASDAIFYYDEAAQAKFQQEKPW  54

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  55   ANDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  114

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_011031359.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=365

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MD + SS+ IAQKTWE+ENN+  +D    +     + +S DAIFYYDE AQ KFQ+EKPW
Sbjct  1    MDPYPSSS-IAQKTWELENNIIPIDTATPTTKDTPSCSSLDAIFYYDEAAQAKFQKEKPW  59

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            +NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD+IIVMDAFALPVEGTET
Sbjct  60   SNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDSIIVMDAFALPVEGTET  119

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  RVNAQADAYEYMVDYSQTNKQAGRLENVIGWYHSHPGYGCWLSGIDVSTQMLNQ  173



>gb|KFK41544.1| hypothetical protein AALP_AA2G143000 [Arabis alpina]
Length=357

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+ENN+ T+D P +++DS         IFYYD+TAQ+KFQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDQPNSASDS---------IFYYDDTAQSKFQQEKPWANDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDV+TQ LNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVATQRLNQ  163



>ref|XP_002324396.1| COP9 complex family protein [Populus trichocarpa]
 gb|EEF02961.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = +3

Query  30   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  206
            MD + +SS++IAQKTWE+ENN++T+D   T   +   S  SDAIF+YD+ AQ KF QEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKTIDTS-TPTIATGTSFLSDAIFHYDDAAQAKFLQEKP  59

Query  207  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  386
            W+NDP+YF+RV+ISALALLKMVVHARSGGTIEVMGLMQGKTDGD+IIVMDAFALPVEGTE
Sbjct  60   WSNDPNYFRRVRISALALLKMVVHARSGGTIEVMGLMQGKTDGDSIIVMDAFALPVEGTE  119

Query  387  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_002887356.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63615.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 153/169 (91%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+ENN+ T+D P +++D+         IFYYD+T+Q++FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDSPDSTSDN---------IFYYDDTSQSRFQQEKPWENDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  163



>ref|XP_010471135.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X1 [Camelina 
sativa]
 ref|XP_010471136.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X2 [Camelina 
sativa]
Length=358

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS  +A+KTWE+ENN+ T+D P +++D+         +FYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSTSDT---------VFYYDDTAQSRFQQEKPWANDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  163



>ref|XP_004501247.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cicer arietinum]
Length=356

 Score =   289 bits (740),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 150/170 (88%), Gaps = 11/170 (6%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +SS+AIAQ+TWE+ENN+  MD P           + D+IF+YDE  Q +FQ++KPW NDP
Sbjct  4    SSSSAIAQQTWELENNIIPMDTP-----------ADDSIFHYDEAGQNEFQRDKPWANDP  52

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD D+IIVMDAFALPVEGTETRVNA
Sbjct  53   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDADSIIVMDAFALPVEGTETRVNA  112

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011082083.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Sesamum indicum]
Length=318

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD DAIIVMDAFALPVEGTETRVNA
Sbjct  55   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDRDAIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_010551182.1| PREDICTED: COP9 signalosome complex subunit 5b [Tarenaya hassleriana]
Length=357

 Score =   289 bits (739),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 147/168 (88%), Gaps = 8/168 (5%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IA+KTWE+ENN+ TM+  P  A           IFYYD+ AQ KFQQEKPW NDPHY
Sbjct  4    SSEIARKTWELENNILTMEPTPDPASDG--------IFYYDDVAQAKFQQEKPWANDPHY  55

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD+IIVMDAFALPVEGTETRVNAQA
Sbjct  56   FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDSIIVMDAFALPVEGTETRVNAQA  115

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_006302454.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
 gb|EOA35352.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
Length=358

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS  IA+KTWE+ENN+ T+D P +++D+         IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTTIARKTWELENNILTVDPPDSTSDN---------IFYYDDTAQSRFQQEKPWENDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGG IE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGKIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  163



>ref|XP_011082082.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Sesamum indicum]
Length=357

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD DAIIVMDAFALPVEGTETRVNA
Sbjct  55   HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDRDAIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_010427950.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=357

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 148/169 (88%), Gaps = 10/169 (6%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS  +A+KTWE+ENN+ T+D P ++            IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSNDT----------IFYYDDTAQSRFQQEKPWANDPH  53

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGG IE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  54   YFKRVKISALALLKMVVHARSGGNIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  113

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  114  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  162



>ref|XP_010048447.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Eucalyptus 
grandis]
 gb|KCW80696.1| hypothetical protein EUGRSUZ_C02093 [Eucalyptus grandis]
Length=375

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 152/182 (84%), Gaps = 8/182 (4%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNV--------ETMDLPPTsadsaaasassdaIFYYDETAQT  185
            MD+  S AAIAQKTWE+ENN+         +           +    SD+IF+YDE  Q 
Sbjct  1    MDALASQAAIAQKTWELENNILSTTAAGSGSGSGAGAGPADPSKHDQSDSIFFYDEAGQV  60

Query  186  KFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFA  365
            +FQQEKPW+++PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFA
Sbjct  61   RFQQEKPWSHEPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFA  120

Query  366  LPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQML  545
            LPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQML
Sbjct  121  LPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQML  180

Query  546  NQ  551
            NQ
Sbjct  181  NQ  182



>ref|XP_010415831.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=358

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS  +A+KTWE+ENN+ T+D            ++SD IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNITTVD---------QLDSTSDTIFYYDDTAQSRFQQEKPWANDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  163



>ref|XP_011045010.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=366

 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = +3

Query  30   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  206
            MD + +SS++IAQKTWE+ENN++ +D P T   +   S  SDAIF+YD+  Q KFQQEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKAIDTP-TPTTATDTSFLSDAIFHYDDATQAKFQQEKP  59

Query  207  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  386
            W+NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD+IIVMDAFALPVEGTE
Sbjct  60   WSNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDSIIVMDAFALPVEGTE  119

Query  387  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>gb|AAC36343.1| AJH2 [Arabidopsis thaliana]
Length=358

 Score =   286 bits (732),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  DDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQTLNQ  163



>ref|NP_177279.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
 sp|Q9FVU9.1|CSN5A_ARATH RecName: Full=COP9 signalosome complex subunit 5a; Short=Signalosome 
subunit 5a; AltName: Full=Jun activation domain-binding 
homolog 2 [Arabidopsis thaliana]
 gb|AAG51882.1|AC016162_3 c-Jun coactivator-like protein (AJH2); 90304-88609 [Arabidopsis 
thaliana]
 gb|AAL06468.1|AF411778_1 At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AAL58104.1|AF395061_1 CSN complex subunit 5A [Arabidopsis thaliana]
 gb|AAM70525.1| At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AEE35176.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
Length=358

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  115  DDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  163



>dbj|BAJ34223.1| unnamed protein product [Thellungiella halophila]
Length=262

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 13/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPHY
Sbjct  4    SSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPHY  50

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA
Sbjct  51   FKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  110

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  111  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  158



>ref|XP_006390791.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
 gb|ESQ28077.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
Length=352

 Score =   284 bits (727),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 13/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPHY
Sbjct  4    SSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPHY  50

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA
Sbjct  51   FKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  110

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  111  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQ  158



>ref|XP_001775449.1| predicted protein [Physcomitrella patens]
 gb|EDQ59778.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   285 bits (728),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 151/174 (87%), Gaps = 7/174 (4%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M++ TSSA IA++TWEIENN+   D P       AA++ SDAIF YDE AQ+  QQ+KPW
Sbjct  1    MEASTSSAMIARQTWEIENNIVATDSP-------AATSDSDAIFEYDEAAQSSIQQQKPW  53

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            T DPHYFK VKISALALLKMVVHARSGGTIEVMGLMQGKTDGD II+MDAFALPVEGTET
Sbjct  54   TRDPHYFKNVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIIIMDAFALPVEGTET  113

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV YSQTNKQ GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  RVNAQADAYEYMVQYSQTNKQVGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>gb|EPS57884.1| hypothetical protein M569_16932, partial [Genlisea aurea]
Length=239

 Score =   280 bits (715),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 159/176 (90%), Gaps = 3/176 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNV--ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  203
            MD F+SSA IA++TWE+EN++  E       ++  ++A+A+SD+IF+YDE AQ K QQ+K
Sbjct  1    MDPFSSSA-IARQTWELENSIIAEGGVDETGASGQSSAAAASDSIFFYDEVAQAKVQQDK  59

Query  204  PWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  383
            PW NDPHYFKRVKISALALLKMVVH+RSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT
Sbjct  60   PWVNDPHYFKRVKISALALLKMVVHSRSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGT  119

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  ETRVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  175



>gb|AAC26484.1| putative JUN kinase activation domain binding protein [Medicago 
sativa]
Length=357

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 146/166 (88%), Gaps = 11/166 (7%)
 Frame = +3

Query  54   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  233
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  234  RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA  413
            RVKISALALLKMVVHARSGGTIEVMGLMQGKTD D+IIVMDAFALPVEGTETRVNAQADA
Sbjct  59   RVKISALALLKMVVHARSGGTIEVMGLMQGKTDADSIIVMDAFALPVEGTETRVNAQADA  118

Query  414  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_003603531.1| COP9 signalosome complex subunit 5b [Medicago truncatula]
 gb|AES73782.1| COP9 signalosome complex subunit 5 [Medicago truncatula]
Length=357

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 146/166 (88%), Gaps = 11/166 (7%)
 Frame = +3

Query  54   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  233
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  234  RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA  413
            RVKISALALLKMVVHARSGGTIEVMGLMQGKTD D+IIVMDAFALPVEGTETRVNAQADA
Sbjct  59   RVKISALALLKMVVHARSGGTIEVMGLMQGKTDADSIIVMDAFALPVEGTETRVNAQADA  118

Query  414  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_010929274.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Elaeis guineensis]
Length=360

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 11/174 (6%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD I+VMDAFALPVEGTET
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIVVMDAFALPVEGTET  109

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_010914180.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Elaeis guineensis]
Length=360

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 153/174 (88%), Gaps = 11/174 (6%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MDS   SAAIA++TWE+ENN+  M+         A +A +DAI+YYDE  Q KFQQEKPW
Sbjct  1    MDSM--SAAIARQTWELENNIVAME---------AGAADADAIYYYDEAVQAKFQQEKPW  49

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD I+VMDAFALPVEGTET
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIVVMDAFALPVEGTET  109

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_010929275.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Elaeis guineensis]
Length=339

 Score =   281 bits (720),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 11/174 (6%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DP++F+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD I+VMDAFALPVEGTET
Sbjct  50   AHDPNFFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIVVMDAFALPVEGTET  109

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_008810007.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=360

 Score =   282 bits (721),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 11/174 (6%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MDS   SAA+A++TWE+ENNV  M+         A +A +DAI+YYDE AQ KFQQE+PW
Sbjct  1    MDSM--SAAMARQTWELENNVVAME---------AGTAEADAIYYYDEAAQGKFQQERPW  49

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
             +DP++F+RV+ISALALLKMVVHARSGGTIEVMGLMQGKTDGD I+VMDAFALPVEGTET
Sbjct  50   AHDPNFFRRVRISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIVVMDAFALPVEGTET  109

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>gb|ACJ84456.1| unknown [Medicago truncatula]
Length=357

 Score =   282 bits (721),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 145/166 (87%), Gaps = 11/166 (7%)
 Frame = +3

Query  54   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  233
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  234  RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA  413
            RVKISAL LLKMVVHARSGGTIEVMGLMQGKTD D+IIVMDAFALPVEGTETRVNAQADA
Sbjct  59   RVKISALTLLKMVVHARSGGTIEVMGLMQGKTDADSIIVMDAFALPVEGTETRVNAQADA  118

Query  414  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  119  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>gb|KFK44380.1| hypothetical protein AALP_AA1G249900 [Arabis alpina]
Length=353

 Score =   281 bits (720),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 9/168 (5%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S++IA+KTWE+ENN+ T++ P +S+D          IFYYD++AQ K QQEKPWT DP+Y
Sbjct  4    SSSIARKTWELENNILTVEPPDSSSDG---------IFYYDDSAQAKVQQEKPWTTDPNY  54

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQA
Sbjct  55   FKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQA  114

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_006305189.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
 gb|EOA38087.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
Length=357

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIAKKTWELENNILTVEPPDSASDG---------IFHYDDAAQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_006416142.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
 dbj|BAJ34114.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34495.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
Length=355

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 9/168 (5%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IA+KTWE+ENN+ T+D P +S+D          IFYYD+TAQ K QQ+KPW +DP+Y
Sbjct  4    SSTIARKTWELENNILTVDPPDSSSDG---------IFYYDDTAQAKVQQDKPWASDPNY  54

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQA
Sbjct  55   FKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQA  114

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_006382165.1| COP9 complex family protein [Populus trichocarpa]
 gb|ERP59962.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNV-ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  206
            MD + SS+ IA+KTWE+ENN+       PT+ D++++S+SSDAIFY+DE AQ KFQ+EKP
Sbjct  1    MDPYPSSS-IAKKTWELENNIIPIDTATPTTTDTSSSSSSSDAIFYFDEAAQAKFQKEKP  59

Query  207  WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE  386
            W+NDP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD+IIVMDAFALPVEGTE
Sbjct  60   WSNDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDSIIVMDAFALPVEGTE  119

Query  387  TRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            TRVNAQADAYEYMVDYSQTNKQAGRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  TRVNAQADAYEYMVDYSQTNKQAGRLENVIGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>ref|XP_010498782.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Camelina 
sativa]
Length=360

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  6    SSSAIARKTWELENNIFTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  56

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  57   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  116

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  117  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  165



>ref|XP_009115580.1| PREDICTED: COP9 signalosome complex subunit 5b [Brassica rapa]
 emb|CDY21400.1| BnaA09g30270D [Brassica napus]
 emb|CDY04768.1| BnaC05g18210D [Brassica napus]
Length=356

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 8/168 (5%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IA+KTWE+ENN+ T++ P +S+           IFYYDE +QTK QQEKPW  DP+Y
Sbjct  4    SSTIARKTWELENNILTVEQPDSSSSDG--------IFYYDEASQTKVQQEKPWATDPNY  55

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FKRV+ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQA
Sbjct  56   FKRVQISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQA  115

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  DAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_009420301.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   279 bits (714),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 3/174 (2%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MDS  SSA +A++TWE+ENN+ ++D    S  + +  + +DAI+YYDE    KFQQEKPW
Sbjct  1    MDSSLSSA-LARQTWELENNIVSVDG--GSGGNGSGGSDADAIYYYDEAVLAKFQQEKPW  57

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            T DP+YF+RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGD IIVMDAFALPVEGTET
Sbjct  58   TQDPNYFRRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDTIIVMDAFALPVEGTET  117

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV+Y+QTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  118  RVNAQADAYEYMVEYAQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  171



>gb|KHG22386.1| COP9 signalosome complex subunit 5a -like protein [Gossypium 
arboreum]
Length=335

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 144/167 (86%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWANDPHFF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMV+HARSGGTIEVMGLM GKTDGDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVIHARSGGTIEVMGLMIGKTDGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>ref|XP_010460061.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Camelina sativa]
 ref|XP_010460063.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Camelina sativa]
Length=358

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_010477567.1| PREDICTED: COP9 signalosome complex subunit 5b [Camelina sativa]
Length=358

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW  DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWAADPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_002893252.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69511.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+ T++  PT + S +       IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNILTVE--PTDSASDS-------IFHYDDAAQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_001752249.1| predicted protein [Physcomitrella patens]
 gb|EDQ82982.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   277 bits (709),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 150/174 (86%), Gaps = 7/174 (4%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M++ TSSA +A++TWEIENN+  M+ P       AA++ SDAIF YDE +Q+  QQ KPW
Sbjct  1    MEASTSSAMVARQTWEIENNIVAMESP-------AAASDSDAIFEYDEASQSSIQQLKPW  53

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPH+FK VKISALALLKMVVH+RSGGTIEVMGLMQGKTDGD II+MDAFALPVEGTET
Sbjct  54   NRDPHFFKNVKISALALLKMVVHSRSGGTIEVMGLMQGKTDGDTIIIMDAFALPVEGTET  113

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQADAYEYMV YSQTNKQ GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  RVNAQADAYEYMVQYSQTNKQVGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  167



>gb|ABK24758.1| unknown [Picea sitchensis]
Length=363

 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 144/165 (87%), Gaps = 9/165 (5%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQ+TWE+ENN+  MD P         SA SD+I+YYDE  Q K QQ+KPW  DPHYFK+
Sbjct  12   IAQQTWELENNIVNMDGP---------SAESDSIYYYDEVTQKKIQQDKPWARDPHYFKK  62

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            VKISALALLKMVVH+RSGGTIEVMGLMQGKTDGD IIVMDAFALPVEGTETRVNAQADAY
Sbjct  63   VKISALALLKMVVHSRSGGTIEVMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQADAY  122

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMVDY+QTNKQ GRLENV+GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  123  EYMVDYAQTNKQVGRLENVIGWYHSHPGYGCWLSGIDVNTQMLNQ  167



>gb|KJB65954.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65955.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=277

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 143/167 (86%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMV+HAR+GG IEVMGLMQGKT GDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQGKTGGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB65951.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=335

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 143/167 (86%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMV+HAR+GG IEVMGLMQGKT GDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQGKTGGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB65952.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65953.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=314

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 143/167 (86%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMV+HAR+GG IEVMGLMQGKT GDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQGKTGGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>gb|KJB65950.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=303

 Score =   272 bits (695),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 143/167 (86%), Gaps = 9/167 (5%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISALALLKMV+HAR+GG IEVMGLMQGKT GDAIIVMDAFALPVEGTETRVNAQAD
Sbjct  54   KRVKISALALLKMVIHARTGGPIEVMGLMQGKTGGDAIIVMDAFALPVEGTETRVNAQAD  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  114  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  160



>tpg|DAA35639.1| TPA: hypothetical protein ZEAMMB73_882531 [Zea mays]
Length=239

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAIIVMDAFALPVEGTETRVNA
Sbjct  55   HHFRRTKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVDYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_006845674.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
 gb|ERN07349.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
Length=364

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 8/172 (5%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S ++SA +AQ+TWE+ENN+  M+ P         +  SD+I++YD+ A TK QQEKPW +
Sbjct  5    SSSNSARMAQQTWELENNIVNMESP--------GANDSDSIYFYDDAALTKIQQEKPWQS  56

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYFK+VKISALALLKMVVHARSGGTIEVMGLMQGK +GD IIVMDAFALPVEGTETRV
Sbjct  57   DPHYFKKVKISALALLKMVVHARSGGTIEVMGLMQGKIEGDTIIVMDAFALPVEGTETRV  116

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQADAYEYMV+YSQTNKQAGRLEN VGWYHSHPGYGCWLSGIDVSTQ+ NQ
Sbjct  117  NAQADAYEYMVEYSQTNKQAGRLENAVGWYHSHPGYGCWLSGIDVSTQLTNQ  168



>gb|AAC36344.1| AJH1 [Arabidopsis thaliana]
Length=357

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>gb|AAM65053.1| putative JUN kinase activator protein [Arabidopsis thaliana]
Length=357

 Score =   271 bits (693),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LRVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|NP_173705.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 sp|Q8LAZ7.2|CSN5B_ARATH RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome 
subunit 5b; AltName: Full=Jun activation domain-binding 
homolog 1 [Arabidopsis thaliana]
 gb|AAL58105.1|AF395062_1 CSN complex subunit 5B [Arabidopsis thaliana]
 gb|AAB72159.1| unknown [Arabidopsis thaliana]
 gb|AAB96974.1| JAB1 [Arabidopsis thaliana]
 gb|ABL66743.1| At1g22920 [Arabidopsis thaliana]
 gb|AEE30309.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=357

 Score =   271 bits (692),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|NP_973890.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 gb|AEE30310.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=351

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 9/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|NP_001149650.1| COP9 signalosome complex subunit 5b [Zea mays]
 gb|ACF85802.1| unknown [Zea mays]
 gb|ACG36237.1| COP9 signalosome complex subunit 5b [Zea mays]
 tpg|DAA35638.1| TPA: COP9 signalosome complex subunit 5b [Zea mays]
Length=362

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAIIVMDAFALPVEGTETRVNA
Sbjct  55   HHFRRTKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVDYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_006652935.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Oryza brachyantha]
Length=362

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 149/170 (88%), Gaps = 7/170 (4%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSAA+A++TWE+ENN+ +         +AA + + DAI+ YDE AQ + QQEKPWTNDP
Sbjct  4    TSSAAMARQTWELENNIPSA-------AAAADTDALDAIYRYDEAAQARVQQEKPWTNDP  56

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R +ISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNA
Sbjct  57   HHFRRARISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNA  116

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  117  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  166



>ref|XP_004960128.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Setaria 
italica]
Length=361

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ AQ + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAATDPDAMDA---------IYRYDDAAQARAQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAIIVMDAFALPVEGTETRVNA
Sbjct  55   HHFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|NP_001054112.1| Os04g0654700 [Oryza sativa Japonica Group]
 gb|AAC33765.1| jab1 protein [Oryza sativa Indica Group]
 dbj|BAB72093.1| JUN-activation-domain-binding protein homolog [Oryza sativa]
 dbj|BAC22747.1| JUN-activation-domain-binding protein 1 [Oryza sativa Japonica 
Group]
 emb|CAE01552.2| OSJNBb0022F16.7 [Oryza sativa Japonica Group]
 dbj|BAF16026.1| Os04g0654700 [Oryza sativa Japonica Group]
 emb|CAH66701.1| OSIGBa0147J19.5 [Oryza sativa Indica Group]
Length=360

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 143/170 (84%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNA
Sbjct  55   HPFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_009103210.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brassica 
rapa]
Length=356

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 145/169 (86%), Gaps = 8/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+ENN+ T+  P        A +SSD IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVKPP--------ADSSSDNIFHYDGAAHAKVLKEKPWATDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>emb|CDY25761.1| BnaA07g10210D [Brassica napus]
Length=356

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 145/169 (86%), Gaps = 8/169 (5%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+ IA+KTWE+ENN+ T+  P        A +SSD IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVKPP--------ADSSSDNIFHYDGAAHAKVLKEKPWATDPN  54

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFKRV+ISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct  55   YFKRVQISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ  114

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  ADAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_010240543.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brachypodium 
distachyon]
Length=360

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSS+A+A++TWE+ENN+    + P          + D ++ +DE A  +  Q+KPW NDP
Sbjct  4    TSSSAMAKQTWELENNIPAKVIDP---------EAMDEVYRFDEVANARALQQKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+++RV+ISALALLKMVVHARSGGTIE+MGLMQGK DGD ++VMDAFALPVEGTETRVNA
Sbjct  55   HHYRRVRISALALLKMVVHARSGGTIEIMGLMQGKVDGDTMVVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMVDYS  NKQAGRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVDYSTINKQAGRLENVIGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_002961002.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
 gb|EFJ38541.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
Length=361

 Score =   261 bits (666),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 11/169 (7%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            +S++IA+++WE+ENN+  M+            A+ D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME-----------HAACDSIYAYDEAAQSAIQQQKPWTRDPH  51

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK VKISALALLKMVVHARSGGT+EVMG+MQGK +GD  IVMDAFALPVEGTETRVNAQ
Sbjct  52   YFKNVKISALALLKMVVHARSGGTLEVMGIMQGKIEGDTFIVMDAFALPVEGTETRVNAQ  111

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMVDY QTNKQ GRLENVVGWYHSHPGYGCWLSGIDV+TQ+LNQ
Sbjct  112  ADAYEYMVDYVQTNKQIGRLENVVGWYHSHPGYGCWLSGIDVTTQVLNQ  160



>dbj|BAJ93853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99562.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 141/170 (83%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R +ISALALLKMVVHAR+GGTIE+MGLMQGK +GD+IIVMDAFALPVEGTETRVNA
Sbjct  55   HHFRRARISALALLKMVVHARAGGTIEIMGLMQGKFEGDSIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>gb|EMT09486.1| hypothetical protein F775_29820 [Aegilops tauschii]
Length=364

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 141/170 (83%), Gaps = 9/170 (5%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+F+R +ISALALLKMVVHAR+GGTIE+MGLMQGK +GD+IIVMDAFALPVEGTETRVNA
Sbjct  55   HHFRRARISALALLKMVVHARAGGTIEIMGLMQGKFEGDSIIVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  115  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>gb|EEC78160.1| hypothetical protein OsI_17724 [Oryza sativa Indica Group]
Length=385

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 143/195 (73%), Gaps = 34/195 (17%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNA
Sbjct  55   HPFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNA  114

Query  402  QADAYEYMVDYSQTNKQ-------------------------AGRLENVVGWYHSHPGYG  506
            QADAYEYMV+YS  NKQ                         AGRLENVVGWYHSHPGYG
Sbjct  115  QADAYEYMVEYSTINKQIGSHHAIDHNVSEVSVFANTLMTDLAGRLENVVGWYHSHPGYG  174

Query  507  CWLSGIDVSTQMLNQ  551
            CWLSGIDVSTQMLNQ
Sbjct  175  CWLSGIDVSTQMLNQ  189



>ref|XP_002967006.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
 gb|EFJ31605.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
Length=373

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 144/179 (80%), Gaps = 19/179 (11%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            +S++IA+++WE+ENN+  M+          A++  D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME---------HAASGCDSIYAYDEAAQSAIQQQKPWTRDPH  53

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK VKISALALLKMVVHARSGGT+EVMG+MQGK +GD  IVMDAFALPVEGTETRVNAQ
Sbjct  54   YFKNVKISALALLKMVVHARSGGTLEVMGIMQGKIEGDTFIVMDAFALPVEGTETRVNAQ  113

Query  405  ADAYEYMVDYSQTNKQA----------GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ADAYEYMVDY QTNKQ           GRLENVVGWYHSHPGYGCWLSGIDV+TQ+LNQ
Sbjct  114  ADAYEYMVDYVQTNKQVLTLDPFFSFIGRLENVVGWYHSHPGYGCWLSGIDVTTQVLNQ  172



>emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa Japonica Group]
Length=377

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 138/190 (73%), Gaps = 34/190 (18%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDPH F+R
Sbjct  1    MARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDPHPFRR  51

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
             KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNAQADAY
Sbjct  52   AKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNAQADAY  111

Query  417  EYMVDYSQTNKQ-------------------------AGRLENVVGWYHSHPGYGCWLSG  521
            EYMV+YS  NKQ                         AGRLENVVGWYHSHPGYGCWLSG
Sbjct  112  EYMVEYSTINKQIGSHHAIDHNVSEVSVFANTLMTDLAGRLENVVGWYHSHPGYGCWLSG  171

Query  522  IDVSTQMLNQ  551
            IDVSTQMLNQ
Sbjct  172  IDVSTQMLNQ  181



>gb|EMS48301.1| COP9 signalosome complex subunit 5b [Triticum urartu]
Length=335

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            I++YDE A  +  QEKPW  DPH+F+R +ISALALLKMVVHAR+GGTIE+MGLMQGK +G
Sbjct  4    IYHYDEAANARAHQEKPWATDPHHFRRARISALALLKMVVHARAGGTIEIMGLMQGKFEG  63

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            D+IIVMDAFALPVEGTETRVNAQADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWL
Sbjct  64   DSIIVMDAFALPVEGTETRVNAQADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWL  123

Query  516  SGIDVSTQMLNQ  551
            SGIDVSTQMLNQ
Sbjct  124  SGIDVSTQMLNQ  135



>gb|EPB91337.1| COP9 signalosome complex subunit 5a [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=334

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A+ +QK WE+ENN+ T+D  PT             +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNIITVD--PTQDQ----------VYFYDAAQDKENVAQKPWKNDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IE+MGLMQGK  GD + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEIMGLMQGKIQGDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y + +K+ GRLENV+GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  111  AYEYMVSYIEKSKEVGRLENVLGWYHSHPGYGCWLSGIDVNTQMLNQ  157



>gb|AAR10246.1| similar to Drosophila melanogaster CSN5, partial [Drosophila 
yakuba]
Length=185

 Score =   224 bits (572),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>emb|CEJ02827.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=169

 Score =   224 bits (570),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 126/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            AA A+K WE+ENNV T+D               D I++YD     +   +K W NDPHYF
Sbjct  3    AATARKNWELENNVTTVD------------PEQDRIYFYDAELDKQNVAQKLWKNDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IEVMGLMQGK   D + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KYVKISAVALIKMVMHARSGGNIEVMGLMQGKIHDDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y + +K+ GRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  111  AYEYMVSYIEKSKEVGRLENVLGWYHSHPGYGCWLSGIDVSTQMLNQ  157



>ref|XP_008485715.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
 ref|XP_008485716.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 127/171 (74%), Gaps = 13/171 (8%)
 Frame = +3

Query  39   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  218
             +  + IAQKTW +ENN+ET+              ++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETLS-------------ATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  219  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN  398
            PH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK D +++IVMDAFALPVEGTETRVN
Sbjct  67   PHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKIDANSMIVMDAFALPVEGTETRVN  126

Query  399  AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AQA AYEYM  Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  127  AQAQAYEYMTAYIEAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  177



>ref|XP_008479869.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 127/171 (74%), Gaps = 13/171 (8%)
 Frame = +3

Query  39   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  218
             +  + IAQKTW +ENN+ET+              ++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETLS-------------ATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  219  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN  398
            PH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK D +++IVMDAFALPVEGTETRVN
Sbjct  67   PHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKIDANSMIVMDAFALPVEGTETRVN  126

Query  399  AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AQA AYEYM  Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  127  AQAQAYEYMTAYIEAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  177



>dbj|GAN00834.1| COP9-signalosome 5B [Mucor ambiguus]
Length=396

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 129/167 (77%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A+ +QK WE+ENN+ T+D             + D +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNITTVD------------PAQDQVYFYDAAQDKENVAQKPWKNDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IE+MGLMQGK  GD + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEIMGLMQGKIQGDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y + +K+ GRLENV+GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  111  AYEYMVSYIEKSKEVGRLENVLGWYHSHPGYGCWLSGIDVNTQMLNQ  157



>ref|XP_006675144.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83607.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
Length=333

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 129/169 (76%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            SS+  A+K +E+ENN++ +D             S DAIFYYD   Q + Q  +PW  DPH
Sbjct  4    SSSLSARKRFELENNIKEVD-------------SRDAIFYYDSNQQKQIQNSRPWAKDPH  50

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK++KISA+AL+KMV+H+RSGG IEVMG+MQGK   D +IVMD+FALPVEGTETRVNAQ
Sbjct  51   HFKKIKISAVALIKMVIHSRSGGNIEVMGMMQGKVVDDTMIVMDSFALPVEGTETRVNAQ  110

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A+ YEYMV+Y    KQ GRLEN +GWYHSHPGYGCWLSGIDV TQMLNQ
Sbjct  111  AEGYEYMVEYMTKIKQVGRLENAIGWYHSHPGYGCWLSGIDVGTQMLNQ  159



>ref|XP_001990340.1| GH19288 [Drosophila grimshawi]
 gb|EDV93402.1| GH19288 [Drosophila grimshawi]
Length=327

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKTWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GRLE+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRLEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>gb|KDR11248.1| COP9 signalosome complex subunit 5 [Zootermopsis nevadensis]
Length=343

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 123/165 (75%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ NN+ET+ +              D I+ YD   Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANNIETISI-------------IDEIYRYDRKQQQDILAAKPWEKDPHFFKD  59

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK D + ++VMD+FALPVEGTETRVNAQA AY
Sbjct  60   IKISALALLKMVMHARSGGTLEVMGLLLGKVDANTMMVMDSFALPVEGTETRVNAQAQAY  119

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  120  EYMTAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_002408598.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
 gb|EEC10694.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
Length=257

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 126/165 (76%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +AQKTWE+ NNVET+              S D ++ Y++  Q      KPW  DPHYFK 
Sbjct  5    MAQKTWELSNNVETIQ-------------SVDDLYKYNKKQQQDILTAKPWEKDPHYFKD  51

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +K+SALALLKMV+HARSGGT+EVMGL+ GK D + ++VMD+FALPVEGTETRVNAQA AY
Sbjct  52   MKVSALALLKMVMHARSGGTLEVMGLLLGKVDANTMLVMDSFALPVEGTETRVNAQAQAY  111

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y+++ K  GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  EYMAAYTESAKTVGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_002422812.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
 gb|EEB10074.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
Length=332

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 124/169 (73%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S  +IAQKTWE  NN+ET+             +  D I+ YD+  Q      KPW  DPH
Sbjct  9    SQCSIAQKTWEFANNIETI-------------SPIDEIYRYDKKQQQDILAAKPWDKDPH  55

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGGT+EVMGL+ GK D + +IVMD+FALPVEGTETRVNAQ
Sbjct  56   FFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVDANTMIVMDSFALPVEGTETRVNAQ  115

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y +  K  GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AQAYEYMTAYIEAAKVVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  164



>ref|XP_001954897.1| GF18500 [Drosophila ananassae]
 gb|EDV43458.1| GF18500 [Drosophila ananassae]
Length=320

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 124/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+F
Sbjct  3    ADTAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA 
Sbjct  50   KDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>gb|ADP30958.1| COP9 constitutive photomorphogenic-like protein subunit 5 [Penaeus 
monodon]
Length=351

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  + + IAQ+ WE+ NN+E  +             ++D I+ YD   Q    Q KPW  
Sbjct  11   SKMNQSQIAQRMWEMANNMEYYN-------------AADEIYQYDRKQQQDILQAKPWEK  57

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPH+FK++KISALALLKMV+HARSGGT+EVMGLM GK DG  +IVMD+FALPVEGTETRV
Sbjct  58   DPHFFKQIKISALALLKMVMHARSGGTLEVMGLMLGKVDGSMMIVMDSFALPVEGTETRV  117

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y +  KQ GR ENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  118  NAQAQAYEYMTAYVEAAKQVGRQENVIGWYHSHPGYGCWLSGIDVSTQMLNQ  169



>dbj|BAN21083.1| jun activation domain binding protein [Riptortus pedestris]
Length=342

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  + A++AQ+TWE+ NN+ET+             +  D I+ YD   Q      KPW  
Sbjct  5    SSETQASMAQQTWEMSNNIETI-------------SPIDEIYRYDRKQQQDILNAKPWEK  51

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPH+F  +KISALALLKMV+HARSGGT+EVMGL+ GK D + +IVMD+FALPVEGTETRV
Sbjct  52   DPHFFTDIKISALALLKMVMHARSGGTLEVMGLLLGKVDANTMIVMDSFALPVEGTETRV  111

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y ++ KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  NAQAQAYEYMTAYIESAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>gb|AAD27862.2|AF132563_1 LD14392p, partial [Drosophila melanogaster]
Length=345

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 127/174 (73%), Gaps = 13/174 (7%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            + + T  +  AQKTWE+ENN++T  LP               IF YD   Q +    KPW
Sbjct  14   ISTITMDSDAAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPW  60

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPH+FK +KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTET
Sbjct  61   EKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTET  120

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  121  RVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  174



>emb|CEG64164.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=331

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 125/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            AA A+K WE+ENNV T+D               D I++YD         +K W NDPHYF
Sbjct  3    AATARKNWELENNVTTVD------------PEQDRIYFYDAELDKLNVAQKLWKNDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IEVMGLMQGK   D + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KHVKISAVALIKMVMHARSGGNIEVMGLMQGKIQDDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y + +K+ GRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  111  AYEYMVSYIEKSKEVGRLENVLGWYHSHPGYGCWLSGIDVSTQMLNQ  157



>ref|NP_001262639.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
 gb|AGB96019.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
Length=325

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_001980192.1| GG17007 [Drosophila erecta]
 ref|XP_002097599.1| CSN5 [Drosophila yakuba]
 gb|EDV49150.1| GG17007 [Drosophila erecta]
 gb|EDW97311.1| CSN5 [Drosophila yakuba]
Length=327

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|NP_477442.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 ref|XP_002041210.1| GM15160 [Drosophila sechellia]
 sp|Q9XZ58.1|CSN5_DROME RecName: Full=COP9 signalosome complex subunit 5; Short=Dch5; 
Short=Signalosome subunit 5; AltName: Full=JAB1 homolog [Drosophila 
melanogaster]
 gb|AAF55321.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 gb|EDW44858.1| GM15160 [Drosophila sechellia]
Length=327

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_002074130.1| GK14483 [Drosophila willistoni]
 gb|EDW85116.1| GK14483 [Drosophila willistoni]
Length=327

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|NP_001138802.1| JAB-MPN domain protein [Bombyx mori]
 gb|ACM24339.1| JAB-MPN domain protein [Bombyx mori]
Length=348

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 126/172 (73%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  S A+IAQKTW + NN+ET+              + D I+ YD+  Q      KPW  
Sbjct  5    SADSQASIAQKTWVMANNIETVS-------------NVDDIYRYDKKQQQDILAAKPWEK  51

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK D + +IVMD+FALPVEGTETRV
Sbjct  52   DPHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVDANTMIVMDSFALPVEGTETRV  111

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  NAQAQAYEYMTAYIEAAKQVGRHENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_006565324.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Apis 
mellifera]
Length=358

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 129/181 (71%), Gaps = 13/181 (7%)
 Frame = +3

Query  9    SPRALHLMDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTK  188
            S + L++  + +  + IA+KTWE+ NN+ET+              + D I+ YD   Q  
Sbjct  9    SKKLLNMASTSSDQSTIAKKTWEMSNNIETIS-------------TVDEIYRYDRKEQQD  55

Query  189  FQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFAL  368
                KPW  DPH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FAL
Sbjct  56   ILAAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFAL  115

Query  369  PVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLN  548
            PVEGTETRVNAQA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLN
Sbjct  116  PVEGTETRVNAQAQAYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLN  175

Query  549  Q  551
            Q
Sbjct  176  Q  176



>ref|XP_002056387.1| GJ10255 [Drosophila virilis]
 gb|EDW59499.1| GJ10255 [Drosophila virilis]
Length=327

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 122/164 (74%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK WE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKKWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+E+MGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEIMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GRLE+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRLEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_001998673.1| GI23503 [Drosophila mojavensis]
 gb|EDW14134.1| GI23503 [Drosophila mojavensis]
Length=327

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 122/164 (74%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK WE+ENNV+T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKKWELENNVQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GRLE+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRLEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_008217721.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Nasonia 
vitripennis]
Length=366

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 123/169 (73%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S + IAQKTWE+ENNVET+              + D I+ YD   Q      KPW  DPH
Sbjct  23   SQSNIAQKTWEMENNVETIS-------------TIDEIYRYDRKEQQDILAAKPWEKDPH  69

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + ++VMD+FALPVEGTETRVNAQ
Sbjct  70   FFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMLVMDSFALPVEGTETRVNAQ  129

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y    KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  130  AQAYEYMTAYIDAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  178



>ref|XP_008217730.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
 ref|XP_008217737.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
Length=358

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 123/169 (73%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S + IAQKTWE+ENNVET+              + D I+ YD   Q      KPW  DPH
Sbjct  15   SQSNIAQKTWEMENNVETIS-------------TIDEIYRYDRKEQQDILAAKPWEKDPH  61

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + ++VMD+FALPVEGTETRVNAQ
Sbjct  62   FFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMLVMDSFALPVEGTETRVNAQ  121

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y    KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  122  AQAYEYMTAYIDAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  170



>ref|XP_011267966.1| PREDICTED: COP9 signalosome complex subunit 5 [Camponotus floridanus]
 gb|EFN60285.1| COP9 signalosome complex subunit 5 [Camponotus floridanus]
Length=346

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 123/170 (72%), Gaps = 13/170 (8%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            T  + IAQKTWE+ NN+ET+              + D I+ YD   Q      KPW  DP
Sbjct  6    TEQSGIAQKTWELSNNIETIS-------------TMDEIYRYDRKEQHDILTAKPWEKDP  52

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNA
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNA  112

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  QAQAYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011448116.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Crassostrea 
gigas]
 gb|EKC21935.1| COP9 signalosome complex subunit 5 [Crassostrea gigas]
Length=332

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE+ NN+E +             +  D I+ YD+  Q      KPW  DPHYFK +
Sbjct  6    AMKTWELSNNLENV-------------SGVDEIYRYDKKQQQDILTAKPWEKDPHYFKHI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            K+SALALLKMV+H+RSGG +EVMGL+ GK DG+ +IVMD+FALPVEGTETRVNAQA AYE
Sbjct  53   KVSALALLKMVMHSRSGGNLEVMGLLLGKVDGNTMIVMDSFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y+++ KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMAAYTESAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_001359383.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017203.1| GL22178 [Drosophila persimilis]
 gb|EAL28529.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34303.1| GL22178 [Drosophila persimilis]
Length=327

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLK+V+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKIVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_008185322.1| PREDICTED: COP9 complex homolog subunit 5 isoform X1 [Acyrthosiphon 
pisum]
Length=339

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYFK +KISALALLKMV+HARSGG +E+MGL+ GK +G+ +IVMD+FALPVEGTETRV
Sbjct  52   DPHYFKDIKISALALLKMVMHARSGGILEIMGLLLGKVEGNTMIVMDSFALPVEGTETRV  111

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y ++ K  GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  NAQAQAYEYMTAYIESAKVVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_003424702.2| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
 ref|XP_008217716.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
Length=390

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 123/169 (73%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S + IAQKTWE+ENNVET+              + D I+ YD   Q      KPW  DPH
Sbjct  47   SQSNIAQKTWEMENNVETIS-------------TIDEIYRYDRKEQQDILAAKPWEKDPH  93

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + ++VMD+FALPVEGTETRVNAQ
Sbjct  94   FFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMLVMDSFALPVEGTETRVNAQ  153

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y    KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  154  AQAYEYMTAYIDAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  202



>emb|CEG78022.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=331

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            AA A+K WE+EN++ T+D               D I++Y+     +   +K W NDPHYF
Sbjct  3    AATARKNWELENDITTVD------------PEQDRIYFYNAEQDKQNVAQKLWKNDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IEVMGLMQGK   D + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KHVKISAVALIKMVMHARSGGNIEVMGLMQGKIQDDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y + +K+ GRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  111  AYEYMVSYIEKSKEVGRLENVLGWYHSHPGYGCWLSGIDVSTQMLNQ  157



>ref|XP_011448117.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Crassostrea 
gigas]
Length=361

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 122/164 (74%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE+ NN+E +                D I+ YD+  Q      KPW  DPHYFK +
Sbjct  35   AMKTWELSNNLENVS-------------GVDEIYRYDKKQQQDILTAKPWEKDPHYFKHI  81

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            K+SALALLKMV+H+RSGG +EVMGL+ GK DG+ +IVMD+FALPVEGTETRVNAQA AYE
Sbjct  82   KVSALALLKMVMHSRSGGNLEVMGLLLGKVDGNTMIVMDSFALPVEGTETRVNAQAQAYE  141

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y+++ KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  142  YMAAYTESAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  185



>ref|XP_011332242.1| PREDICTED: COP9 signalosome complex subunit 5 [Cerapachys biroi]
 gb|EZA58237.1| COP9 signalosome complex subunit [Cerapachys biroi]
Length=351

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 122/173 (71%), Gaps = 19/173 (11%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWT  212
            T  + IAQKTWE+ NN+E   TMD                 I+ YD   Q      KPW 
Sbjct  6    TDQSTIAQKTWELSNNIEAISTMD----------------EIYRYDRKEQQDILTAKPWE  49

Query  213  NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETR  392
             DPH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETR
Sbjct  50   KDPHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETR  109

Query  393  VNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            VNAQA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  VNAQAQAYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011171452.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
 ref|XP_011171453.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
Length=346

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 123/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ N +ET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    SSIAQKTWELSNCIETIS-------------TMDEIYRYDRKEQQDILTAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>emb|CDS11961.1| Putative COP9 signalosome complex subunit 5a [Absidia idahoensis 
var. thermophila]
Length=333

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A+K WE+ENN+ T+D  PT             I+YYD     +  +++PW  +P+++
Sbjct  3    AETARKNWELENNITTVD--PTQDQ----------IYYYDAQKNKEALEQRPWKTNPNHY  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IEVMGLMQGK  GD +I+MDAF LPVEGTETRVNAQ +
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEVMGLMQGKVHGDTMIIMDAFGLPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  111  AYEYMVSYMEQAKEVGRLENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  157



>ref|XP_011147629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Harpegnathos 
saltator]
Length=344

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 121/165 (73%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ NN+ET+              + D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELANNIETIS-------------TIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  58   IKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMIVMDSFALPVEGTETRVNAQAQAY  117

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  118  EYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011049626.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049630.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049631.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 gb|EGI68489.1| COP9 signalosome complex subunit 5 [Acromyrmex echinatior]
Length=345

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 121/165 (73%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ N +ET+              + D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELSNCIETIS-------------TMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  58   IKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQAY  117

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  118  EYMTAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011147628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Harpegnathos 
saltator]
Length=351

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 122/165 (74%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  18   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  64

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  65   IKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMIVMDSFALPVEGTETRVNAQAQAY  124

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  125  EYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  169



>ref|XP_011049625.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Acromyrmex 
echinatior]
Length=351

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 121/165 (73%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ N +ET+              + D I+ YD   Q      KPW  DPH+FK 
Sbjct  17   IAQKTWELSNCIETIS-------------TMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  63

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  64   IKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQAY  123

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  124  EYMTAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  168



>ref|XP_005099578.1| PREDICTED: COP9 signalosome complex subunit 5-like [Aplysia californica]
Length=334

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 123/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + +A+KTWE+ NNVE++             +S D I+ YD   Q      KPW  DPHYF
Sbjct  3    SKVARKTWELTNNVESV-------------SSVDEIYRYDSKQQQDILTAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +K+SALALLKMV+HARSGG +EVMGL+ GK DG+ +IVMD  ALPVEGTETRVNAQA 
Sbjct  50   KHIKVSALALLKMVMHARSGGNLEVMGLLLGKVDGNTMIVMDGVALPVEGTETRVNAQAQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y++  KQ  RLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMAAYTEAAKQVKRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>gb|EYU29154.1| hypothetical protein MIMGU_mgv1a0088022mg, partial [Erythranthe 
guttata]
 gb|EYU29173.1| hypothetical protein MIMGU_mgv1a0183041mg, partial [Erythranthe 
guttata]
Length=136

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            MD F+SS  IA++TWE+ENN+ T      +  + ++SA+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDLFSSST-IARQTWELENNIVT----TAADAADSSSAASDAIFYYDEAAQVKFQQEKPW  55

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
            + DPH+FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct  56   SIDPHFFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  115

Query  390  RVNAQADAYEYMVDYSQTNKQ  452
            RVNAQADAYEYMVDYSQTNKQ
Sbjct  116  RVNAQADAYEYMVDYSQTNKQ  136



>gb|EFN79117.1| COP9 signalosome complex subunit 5 [Harpegnathos saltator]
Length=378

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 122/165 (74%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  45   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  91

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  92   IKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMIVMDSFALPVEGTETRVNAQAQAY  151

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  152  EYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  196



>gb|EXX54839.1| Rri1p [Rhizophagus irregularis DAOM 197198w]
Length=265

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IA+  +E  NN+ T+D             + D I+ Y+   Q +  QEKPWT D HYF
Sbjct  3    SEIARTNFEFSNNIVTID------------PAQDQIYRYNNDEQVQINQEKPWTKDIHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
             +VKISA+AL+KMV+HARSGG IEVMGLMQGK DG+ +I+MDAFALPVEGTETRVNAQ++
Sbjct  51   TKVKISAVALIKMVMHARSGGNIEVMGLMQGKIDGNTMIIMDAFALPVEGTETRVNAQSE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A EYMV Y  T +Q GRLEN+VGWYHSHPGYGCWLSGIDV TQM NQ
Sbjct  111  ANEYMVQYLTTIRQVGRLENIVGWYHSHPGYGCWLSGIDVHTQMTNQ  157



>gb|EIE80444.1| hypothetical protein RO3G_05149 [Rhizopus delemar RA 99-880]
Length=319

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 124/167 (74%), Gaps = 17/167 (10%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A+IA K WE+ENN+ T+D               D I++YD     +   EKPW NDPH+F
Sbjct  3    ASIALKNWELENNITTVD------------PEEDKIYFYDSEQDKQNVAEKPWKNDPHHF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKISA AL+KMV+HARSGG IEVMGLMQGK  GD + VMD+FALPVEGTETRVNAQ +
Sbjct  51   KRVKISATALIKMVMHARSGGNIEVMGLMQGKIQGDTMYVMDSFALPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYE++  Y     + GRLENV+GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  111  AYEFLKQY-----KIGRLENVLGWYHSHPGYGCWLSGIDVSTQMLNQ  152



>gb|AAD28608.1|AF129083_1 COP9 signalosome subunit 5 CSN5 [Drosophila melanogaster]
Length=327

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AY+
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYK  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGI+VSTQMLNQ
Sbjct  113  YMTAYMEAAKKVGRMEHAVGWYHSHPGYGCWLSGINVSTQMLNQ  156



>dbj|BAM18530.1| COP9 complex homolog subunit 5 [Papilio xuthus]
Length=348

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 124/172 (72%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  S +  AQKTW + NN+ET+              S D I+ YD+  Q      KPW  
Sbjct  5    SADSQSTTAQKTWVMANNIETVS-------------SVDEIYRYDKKQQQDILAAKPWEK  51

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK D + +IVMD+FALPVEGTETRV
Sbjct  52   DPHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVDANTMIVMDSFALPVEGTETRV  111

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  112  NAQAQAYEYMTAYIEAAKQVGRHENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  163



>ref|XP_011502813.1| PREDICTED: COP9 signalosome complex subunit 5 [Ceratosolen solmsi 
marchali]
Length=342

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++IAQKTWE+ NN+ET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    SSIAQKTWEMSNNIETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + ++VMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMLVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y    KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIDAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_003486847.1| PREDICTED: COP9 signalosome complex subunit 5-like [Bombus impatiens]
Length=344

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 123/170 (72%), Gaps = 13/170 (8%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +  + IA+KTWE+ NN+ET+              + D I+ YD   Q      KPW  DP
Sbjct  6    SDQSTIAKKTWEMSNNIETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDP  52

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNA
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNA  112

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  QAQAYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_003399828.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 2 
[Bombus terrestris]
Length=345

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IA+KTWE+ NN+ET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_003700698.1| PREDICTED: COP9 signalosome complex subunit 5-like [Megachile 
rotundata]
Length=345

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IAQKTWE+ NNVET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAQKTWEMSNNVETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  K+ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIEAVKEVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_623836.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX2 [Apis 
mellifera]
 ref|XP_003695180.1| PREDICTED: COP9 signalosome complex subunit 5-like [Apis florea]
 ref|XP_006565325.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X4 [Apis 
mellifera]
 ref|XP_006612066.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X1 
[Apis dorsata]
 ref|XP_006612067.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Apis dorsata]
Length=344

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IA+KTWE+ NN+ET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_011049624.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Acromyrmex 
echinatior]
Length=384

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 122/165 (74%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  50   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  96

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  97   IKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQAY  156

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  157  EYMTAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  201



>ref|XP_011147627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Harpegnathos 
saltator]
Length=398

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 122/165 (74%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  65   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  111

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA AY
Sbjct  112  IKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMIVMDSFALPVEGTETRVNAQAQAY  171

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  172  EYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  216



>ref|XP_003399827.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 1 
[Bombus terrestris]
Length=344

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IA+KTWE+ NN+ET+              + D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETIS-------------TVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNAQA 
Sbjct  56   KDIKISALALLKMVMHARSGGTLEVMGLLLGKVAANTMIVMDSFALPVEGTETRVNAQAQ  115

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  116  AYEYMTAYIEAAKQVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>emb|CDH56438.1| cop9 signalosome complex subunit 5a-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=333

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A+K WE+ENN+ T+D             + D I+YYD        ++KPW  +P+++
Sbjct  3    AETARKNWELENNIVTVD------------PAQDQIYYYDAQKNKDALEQKPWKTNPNHY  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+AL+KMV+HARSGG IEVMGLMQGK  GD +I+MDAF LPVEGTETRVNAQ +
Sbjct  51   KHVKISAIALIKMVMHARSGGNIEVMGLMQGKVHGDTMIIMDAFGLPVEGTETRVNAQNE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  111  AYEYMVSYMEQAKEVGRLENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  157



>ref|XP_011182476.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera cucurbitae]
Length=333

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 123/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISAL+LLKMV+HARSGGT+E+MGL+ GK + + +IVMDAFALPVEGTETRVNAQ+ 
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLLLGKVEDNTMIVMDAFALPVEGTETRVNAQSQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y    K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMSAYIVAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_638491.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 sp|Q54PF3.1|CSN5_DICDI RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Dictyostelium discoideum]
 gb|EAL65137.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 gb|ABC46697.1| COP9 signalosome complex subunit 5 [Dictyostelium discoideum]
Length=332

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 14/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            AA A KT+E+ENN++T+D               D +F YD     +F Q KPW+ DPHYF
Sbjct  6    AADALKTFELENNIQTID--------------HDQLFKYDPQQYQQFLQSKPWSKDPHYF  51

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K VKISA+ALLKMV+HARSGG +EVMG++ GK + + +I+MD+FALPVEGTETRVNAQ +
Sbjct  52   KHVKISAIALLKMVMHARSGGKLEVMGMLMGKVENNTMIIMDSFALPVEGTETRVNAQVE  111

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMV+Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDV TQ +NQ
Sbjct  112  AYEYMVEYLELIKQTGRLENALGWYHSHPGYGCWLSGIDVGTQSVNQ  158



>ref|XP_011209192.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera dorsalis]
Length=333

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 123/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISAL+LLKMV+HARSGGT+E+MGL+ GK + + +IVMDAFALPVEGTETRVNAQ+ 
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLLLGKVEDNTMIVMDAFALPVEGTETRVNAQSQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y    K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMSAYIVAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_001649479.1| AAEL014747-PA [Aedes aegypti]
 ref|XP_001657987.1| AAEL001058-PA [Aedes aegypti]
 gb|EAT33001.1| AAEL014747-PA [Aedes aegypti]
 gb|EAT47818.1| AAEL001058-PA [Aedes aegypti]
Length=336

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 124/169 (73%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            + + +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  2    ADSELARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWDKDPH  48

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGG +EVMGL+ GK + D ++VMDAFALPVEGTETRVNAQ
Sbjct  49   FFKDIKISALALLKMVMHARSGGALEVMGLLLGKVEEDTMVVMDAFALPVEGTETRVNAQ  108

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            + AYEYM  Y +  K+ GR EN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  109  SQAYEYMTAYIEAAKEVGRCENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  157



>ref|XP_011292660.1| PREDICTED: COP9 signalosome complex subunit 5 [Musca domestica]
Length=334

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 124/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A+++WE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    ADAARRSWELENNIKT--LPACDE-----------IFRYDADQQRQILDAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISAL+LLKMV+HARSGGT+E+MGL+ GK + + +IVMDAFALPVEGTETRVNAQ+ 
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLLLGKVEDNTMIVMDAFALPVEGTETRVNAQSQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y  + K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMSAYIDSAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|NP_001156462.1| COP9 complex homolog subunit 5 [Acyrthosiphon pisum]
 dbj|BAH72641.1| ACYPI006786 [Acyrthosiphon pisum]
Length=339

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 126/172 (73%), Gaps = 13/172 (8%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYFK +KISALALLKMV+HARSGG +E+MGL+ GK +G+ +IVMD+FALPVEGTETRV
Sbjct  52   DPHYFKDIKISALALLKMVMHARSGGILEIMGLLLGKVEGNTMIVMDSFALPVEGTETRV  111

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y ++ K  GR EN +GWYHSHPGYGCWLS IDVSTQMLNQ
Sbjct  112  NAQAQAYEYMTAYIESAKVVGRQENAIGWYHSHPGYGCWLSCIDVSTQMLNQ  163



>gb|AEE62710.1| unknown [Dendroctonus ponderosae]
 gb|ENN70355.1| hypothetical protein YQE_12863, partial [Dendroctonus ponderosae]
 gb|ERL94202.1| hypothetical protein D910_11483 [Dendroctonus ponderosae]
Length=351

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 120/164 (73%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ NN+ET+              S D I+ YD   Q      KPW  DPH+FK +
Sbjct  16   AQKTWELSNNMETIS-------------SVDEIYKYDRKQQQDILTAKPWDKDPHFFKDI  62

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGL+ GK DG+ + VMD+FALPVEGTETRVNAQA AYE
Sbjct  63   KISALALLKMVMHARSGGTLEVMGLILGKVDGNTMFVMDSFALPVEGTETRVNAQAQAYE  122

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K  GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  123  YMSSYIEAAKMVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  166



>gb|ESA08506.1| hypothetical protein GLOINDRAFT_349082 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX54838.1| Rri1p [Rhizophagus irregularis DAOM 197198w]
Length=364

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            + IA+  +E  NN+ T+D             + D I+ Y+   Q +  QEKPWT D HYF
Sbjct  3    SEIARTNFEFSNNIVTID------------PAQDQIYRYNNDEQVQINQEKPWTKDIHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
             +VKISA+AL+KMV+HARSGG IEVMGLMQGK DG+ +I+MDAFALPVEGTETRVNAQ++
Sbjct  51   TKVKISAVALIKMVMHARSGGNIEVMGLMQGKIDGNTMIIMDAFALPVEGTETRVNAQSE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A EYMV Y  T +Q GRLEN+VGWYHSHPGYGCWLSGIDV TQM NQ
Sbjct  111  ANEYMVQYLTTIRQVGRLENIVGWYHSHPGYGCWLSGIDVHTQMTNQ  157



>ref|XP_008548790.1| PREDICTED: COP9 signalosome complex subunit 5-like [Microplitis 
demolitor]
Length=342

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 120/170 (71%), Gaps = 19/170 (11%)
 Frame = +3

Query  51   AAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            + IAQKTWE+ NNVE   TMD                 I+ YD   Q      KPW  DP
Sbjct  9    STIAQKTWEMSNNVEMISTMD----------------EIYRYDRQEQQDILAAKPWEKDP  52

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            H+FK +KISALALLKMV+HARSGGT+EVMGL+ GK   + +IVMD+FALPVEGTETRVNA
Sbjct  53   HFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVTANTMIVMDSFALPVEGTETRVNA  112

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QA AYEYM  Y +  K  GR EN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  113  QAQAYEYMTAYIENAKLVGRQENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  162



>ref|XP_001862398.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
 gb|EDS37003.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
Length=426

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            + A +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  93   ADAEMARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWEKDPH  139

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            +FK +KISALALLKMV+HARSGG +E+MGL+ GK + D ++VMDAFALPVEGTETRVNAQ
Sbjct  140  FFKDIKISALALLKMVMHARSGGALEIMGLLLGKVEEDTMVVMDAFALPVEGTETRVNAQ  199

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            + AYEYM  Y ++ K+ GR EN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  200  SQAYEYMTAYMESAKEVGRCENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  248



>gb|AET43978.1| COP9 signalosome subunit 5, partial [Reishia clavigera]
Length=334

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 120/164 (73%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK+W + NNVE++              S+D I+ YD   Q      KPW  DPHYFK +
Sbjct  3    AQKSWTLSNNVESVS-------------SADEIYRYDAKQQQDILLAKPWEKDPHYFKHI  49

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGG +EVMGL+ GK DG+ +IVMD  ALPVEGTETRVNAQA AYE
Sbjct  50   KISALALLKMVMHARSGGILEVMGLLLGKVDGNTMIVMDGVALPVEGTETRVNAQAQAYE  109

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y++  KQ  RLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  YMASYTEAAKQVRRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  153



>gb|ETN63713.1| jun activation domain binding protein [Anopheles darlingi]
Length=338

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 123/165 (75%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A+K WE+ENN+ T  LP +             IF YD   Q +    +PW  DPH+FK 
Sbjct  3    MARKNWELENNIVT--LPASDE-----------IFRYDAEQQQRILTARPWEKDPHFFKD  49

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+H+RSGG +EVMGL+ GK D DA++VMDAFALPVEGTETRVNAQ+ AY
Sbjct  50   IKISALALLKMVMHSRSGGPLEVMGLLLGKVDQDAMVVMDAFALPVEGTETRVNAQSQAY  109

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y ++ K+ GR EN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  110  EYMTAYIESAKEVGRCENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  154



>ref|XP_005851620.1| hypothetical protein CHLNCDRAFT_19207 [Chlorella variabilis]
 gb|EFN59518.1| hypothetical protein CHLNCDRAFT_19207 [Chlorella variabilis]
Length=368

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 123/164 (75%), Gaps = 11/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQ  WE+EN+V  +   P+  DS         ++ +D   Q   Q  KPW  DPHYFKRV
Sbjct  11   AQARWELENDV--LAAGPSDLDS---------LYSFDAEEQKAIQASKPWARDPHYFKRV  59

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISALALLKM +HA+SGG IEVMG+MQGK  G+  IV+D FALPVEGTETRVNAQA+AYE
Sbjct  60   RISALALLKMAMHAKSGGNIEVMGVMQGKIQGNEFIVIDTFALPVEGTETRVNAQAEAYE  119

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMVD+ +TNK +GRLEN+VGWYHSHPGYGCWLSGIDV TQ  NQ
Sbjct  120  YMVDFLETNKASGRLENIVGWYHSHPGYGCWLSGIDVGTQSTNQ  163



>dbj|GAM27607.1| hypothetical protein SAMD00019534_107830 [Acytostelium subglobosum 
LB1]
Length=341

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 14/164 (9%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A K +EIENN++++D               D+IF YD+T    F + KPW  DPHYFK V
Sbjct  10   ALKRFEIENNIQSVD--------------RDSIFKYDQTQYNDFLKSKPWAKDPHYFKTV  55

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISA+ALLKMV+H+RSGG +EVMGL+ GK +   +I+MD+FALPVEGTETRVNAQADA E
Sbjct  56   KISAIALLKMVMHSRSGGKLEVMGLLMGKVEAHTMIIMDSFALPVEGTETRVNAQADANE  115

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM++Y    ++ GRLEN +GWYHSHPGYGCWLSGIDVSTQM+NQ
Sbjct  116  YMIEYLDLIRKTGRLENAIGWYHSHPGYGCWLSGIDVSTQMVNQ  159



>ref|XP_003292126.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
 gb|EGC31350.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
Length=332

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 14/170 (8%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            +  +A A K +E+ENNV+T+D               D++F YD     +F   KPW  DP
Sbjct  2    SKGSADALKRFELENNVQTID--------------HDSLFKYDAQQYQQFLSSKPWAKDP  47

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYFK VKISA+ALLKMV+HARSGG +EVMG++ GK + + +I+MD+FALPVEGTETRVNA
Sbjct  48   HYFKHVKISAIALLKMVMHARSGGKLEVMGMLMGKVENNTMIIMDSFALPVEGTETRVNA  107

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            Q +AYEYMV+Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDV TQ++NQ
Sbjct  108  QVEAYEYMVEYLELIKQTGRLENALGWYHSHPGYGCWLSGIDVGTQLVNQ  157



>ref|XP_002103175.1| GD19103 [Drosophila simulans]
 gb|EDX12678.1| GD19103 [Drosophila simulans]
Length=321

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 120/164 (73%), Gaps = 19/164 (12%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGGT+EVMGLM GK      IVMDAFALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGTLEVMGLMLGK------IVMDAFALPVEGTETRVNAQAQAYE  106

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  107  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQ  150



>gb|KFB47242.1| hypothetical protein ZHAS_00015265 [Anopheles sinensis]
Length=338

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A+KTWE+ENN+ T  LP +             IF YD   Q +    +PW  DPH+FK +
Sbjct  4    ARKTWEMENNIVT--LPASDE-----------IFRYDAEQQQRILTARPWEKDPHFFKDI  50

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+H+RSGG +EVMGL+ GK + D ++VMDAFALPVEGTETRVNAQ+ AYE
Sbjct  51   KISALALLKMVMHSRSGGALEVMGLLLGKVEEDTMVVMDAFALPVEGTETRVNAQSQAYE  110

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y ++ K+ GR EN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  111  YMTAYIESAKEVGRCENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  154



>ref|XP_001900779.1| COP9 signalosome complex subunit 5 [Brugia malayi]
Length=331

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRV
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRV  116

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  117  NAQAQAYEYMTTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  168



>emb|CDP99135.1| Protein BM-CSN-5, isoform b [Brugia malayi]
Length=355

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRV
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRV  116

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  117  NAQAQAYEYMTTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  168



>ref|XP_972769.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198243.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198244.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 gb|EFA09688.1| hypothetical protein TcasGA2_TC011816 [Tribolium castaneum]
Length=344

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 120/165 (73%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQKTWE+ N VE ++             S D I+ YD+  Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANKVELVN-------------SVDDIYRYDKKQQQDILAAKPWEKDPHFFKD  59

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+EVMGL+ GK DG+ + VMD+FALPVEGTETRVNAQA AY
Sbjct  60   IKISALALLKMVMHARSGGTLEVMGLILGKVDGNTMFVMDSFALPVEGTETRVNAQAQAY  119

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y +  K  GR EN +GWYHSHPGYGCWLSGIDV TQMLNQ
Sbjct  120  EYMSSYIEAAKLVGRQENAIGWYHSHPGYGCWLSGIDVGTQMLNQ  164



>emb|CDP99134.1| Protein BM-CSN-5, isoform d [Brugia malayi]
Length=357

 Score =   217 bits (552),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRV
Sbjct  57   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRV  116

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  117  NAQAQAYEYMTTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  168



>gb|EJW89035.1| JAB-MPN domain-containing protein [Wuchereria bancrofti]
Length=322

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S +++ ++A + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  4    SMSTATSVAFRNWQMSNNIESLE----------------TIYQYDSAEQQAIRAVKPWEK  47

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV  395
            DPHYF+ +KI+ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRV
Sbjct  48   DPHYFREIKIAALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRV  107

Query  396  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            NAQA AYEYM  Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  108  NAQAQAYEYMTTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  159



>ref|XP_009029035.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
 gb|ESN92732.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
Length=335

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 120/168 (71%), Gaps = 13/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S  +A  TWE+ N +E +             + +D I++YDE  Q      KPW  DPHY
Sbjct  3    SKMVAYMTWELSNKIEAL-------------SGADEIYHYDEKQQKDILAAKPWEKDPHY  49

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            F  +KISALALLKMV+HARSGG +EVMGL+ GK D + +IVMD+FALPVEGTETRVNAQA
Sbjct  50   FNSIKISALALLKMVMHARSGGNLEVMGLLLGKVDINNMIVMDSFALPVEGTETRVNAQA  109

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             AYEYM  Y    KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  QAYEYMAAYIDAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  157



>gb|EFA83038.1| Mov34/MPN/PAD-1 family protein [Polysphondylium pallidum PN500]
Length=379

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = +3

Query  42   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  221
            + SA  A K +E+ENN+++++               D+IF YD +    F + KPW  DP
Sbjct  2    SQSATDALKRFEVENNIQSVE--------------HDSIFKYDPSQYQDFLKAKPWAKDP  47

Query  222  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA  401
            HYFK VKISA+ALLKMV+HARSGG +EVMGL+ GK +   +I+MD+FALPVEGTETRVNA
Sbjct  48   HYFKSVKISAIALLKMVMHARSGGKLEVMGLLMGKVEAHTMIIMDSFALPVEGTETRVNA  107

Query  402  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            QA+AYEYMV+Y    K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQM+NQ
Sbjct  108  QAEAYEYMVEYLDLIKKTGRLENALGWYHSHPGYGCWLSGIDVSTQMVNQ  157



>gb|ERG87648.1| cop9 signalosome complex subunit 5 [Ascaris suum]
Length=338

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 124/174 (71%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M++ +S A  A + W++ NNV   +                 I+ YD   Q   +  +PW
Sbjct  1    MEACSSDAPTALRNWQLANNVRLSE----------------TIYQYDANEQQLIRTVRPW  44

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPHYFK VKISALALLKMV+HARSGG++EVMGL+QGK D + +IVMD+FALPVEGTET
Sbjct  45   EKDPHYFKEVKISALALLKMVMHARSGGSLEVMGLVQGKVDANVLIVMDSFALPVEGTET  104

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  Y+++ +  GR++ VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  105  RVNAQAQAYEYMSTYTESCESIGRMDKVVGWYHSHPGYGCWLSGIDVSTQALNQ  158



>ref|XP_005648133.1| Mov34-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23589.1| Mov34-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=349

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 125/164 (76%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK WE+EN+++ ++              SDA + YD   Q   Q +KPWT DPHYFK V
Sbjct  7    AQKRWELENSIQNIE-------------GSDAYYVYDGAEQQALQHQKPWTKDPHYFKHV  53

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISALALLKM +HA+SGG +E+MG++ GK   DA IV+DAFALPVEGTETRVNAQA+AYE
Sbjct  54   RISALALLKMAMHAKSGGNLEIMGMLYGKIQDDAFIVVDAFALPVEGTETRVNAQAEAYE  113

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +MVD++++ K  GRLEN+VGWYHSHPGYGCWLSGIDVSTQ + Q
Sbjct  114  FMVDFNESTKVVGRLENMVGWYHSHPGYGCWLSGIDVSTQSIQQ  157



>ref|XP_004354957.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
 gb|EGG16557.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
Length=372

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 127/169 (75%), Gaps = 14/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            ++AA A K +E+ENN++ +D               D++F Y+E    +F   KPW  DPH
Sbjct  2    ANAADALKRFEVENNIQQVD--------------HDSLFKYNEVQYKQFLDAKPWAKDPH  47

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK VKISA+ALLK+V+HARSGG +EVMGLM GK +   +I+MD+FALPVEGTETRVNAQ
Sbjct  48   YFKHVKISAIALLKIVMHARSGGKLEVMGLMMGKIEAHTMIIMDSFALPVEGTETRVNAQ  107

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A+AYEYMV+Y    ++ GRLEN +GWYHSHPGYGCWLSGIDVSTQM+NQ
Sbjct  108  AEAYEYMVEYLDLIRKTGRLENAIGWYHSHPGYGCWLSGIDVSTQMVNQ  156



>ref|XP_004353437.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
 gb|ELR23909.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
Length=342

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 123/168 (73%), Gaps = 14/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+  A+K +E EN + T D               D I+ YDE     +  ++ W  DP+Y
Sbjct  4    SSGDARKRFEAENKIATED--------------PDHIYKYDEAKHQGWTSQRLWQKDPNY  49

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FK+VKISA+ALLKMV+HARSGG +EVMGLMQGK DGD +IVMD+FALPVEGTETRVNAQ 
Sbjct  50   FKKVKISAVALLKMVMHARSGGKLEVMGLMQGKIDGDTMIVMDSFALPVEGTETRVNAQV  109

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +AYEYMV Y +   QAGRLEN +GWYHSHPGYGCWLSGIDV TQMLNQ
Sbjct  110  EAYEYMVSYLELIGQAGRLENAIGWYHSHPGYGCWLSGIDVGTQMLNQ  157



>ref|XP_009045703.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
 gb|ESP03615.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
Length=333

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 119/164 (73%), Gaps = 13/164 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK+WE+ NN+ET++             S D I+ YD          KPW  D H+FK +
Sbjct  6    AQKSWELANNIETVN-------------SIDDIYRYDRKQHQDILTAKPWEKDNHHFKHI  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISALALLKMV+HARSGG +EVMGL+ GK DG+ +IVMD  ALPVEGTETRVNAQA AYE
Sbjct  53   KISALALLKMVMHARSGGNLEVMGLLLGKVDGNTMIVMDGVALPVEGTETRVNAQAQAYE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y+   KQ GRLEN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  113  YMAAYTDAAKQVGRLENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  156



>ref|XP_003323591.1| COP9 signalosome complex subunit 5 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
 gb|EFP79172.1| COP9 signalosome complex subunit 5 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
Length=368

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 14/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S+ IAQKT+E+EN ++ ++               D IF Y+   Q   Q+E  W  DPHY
Sbjct  3    SSRIAQKTFELENQIQPLE--------------QDKIFRYNAEEQKAIQKEARWKKDPHY  48

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FK+VK+S +AL+KMV+HARSGG  E+MGLMQGK DGD  +VMD+FALPV+GTETRVNA +
Sbjct  49   FKKVKVSGVALIKMVMHARSGGQYEIMGLMQGKIDGDTFVVMDSFALPVQGTETRVNAAS  108

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +A EYMV++ + +K  GRLENVVGWYHSHPGYGCWLSGIDVSTQ+ NQ
Sbjct  109  EANEYMVEFLERSKNVGRLENVVGWYHSHPGYGCWLSGIDVSTQLTNQ  156



>gb|EPZ33258.1| JAB1/Mov34/MPN/PAD-1 domain-containing protein [Rozella allomycis 
CSF55]
Length=330

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 124/165 (75%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A+KT+E+EN ++ +              ++D ++ +D   Q K   EKPWT DP YF  
Sbjct  7    LARKTFELENEIKPL-------------INNDEMYNFDAEEQKKILNEKPWTTDPKYFTN  53

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            VKIS++AL+KMV+HA+SGG IEVMGLMQGK  G ++IVMDAFALPVEGTETRVNA A+ Y
Sbjct  54   VKISSMALMKMVLHAKSGGDIEVMGLMQGKIKGQSMIVMDAFALPVEGTETRVNAAAEGY  113

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMVDY    KQAG+ ENV+GWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  114  EYMVDYMTVIKQAGKQENVIGWYHSHPGYGCWLSGIDVSTQHLNQ  158



>ref|XP_312032.5| AGAP002880-PA [Anopheles gambiae str. PEST]
 gb|EAA08009.5| AGAP002880-PA [Anopheles gambiae str. PEST]
Length=340

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 123/165 (75%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A+KTWE+ENN+  + LPP+             IF YD   Q +    +PW  DP++FK 
Sbjct  3    MARKTWEMENNI--VVLPPSDE-----------IFRYDAEQQQRILTARPWEKDPNFFKD  49

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALAL+KMV H+RSGG +EVMGL+ GK   D ++VMDAFALPVEGTETRVNAQ+ AY
Sbjct  50   IKISALALIKMVTHSRSGGALEVMGLLLGKVVDDTMVVMDAFALPVEGTETRVNAQSQAY  109

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM  Y ++ K+ GR+EN +GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  110  EYMAAYIESAKEVGRMENAIGWYHSHPGYGCWLSGIDVNTQMLNQ  154



>ref|XP_005770092.1| hypothetical protein EMIHUDRAFT_75732 [Emiliania huxleyi CCMP1516]
 ref|XP_005789785.1| hypothetical protein EMIHUDRAFT_70490 [Emiliania huxleyi CCMP1516]
 gb|EOD17663.1| hypothetical protein EMIHUDRAFT_75732 [Emiliania huxleyi CCMP1516]
 gb|EOD37356.1| hypothetical protein EMIHUDRAFT_70490 [Emiliania huxleyi CCMP1516]
Length=350

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 125/176 (71%), Gaps = 21/176 (12%)
 Frame = +3

Query  39   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  218
              + A+ AQ  +E+EN++  +D                A++ YD   Q K+   KPWT D
Sbjct  1    MAAGASSAQARFELENDIRAVD----------------AVYTYDNPQQQKWLSAKPWTRD  44

Query  219  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD-----GDAIIVMDAFALPVEGT  383
            P YFK V+ISALAL+KMV+HAR GGTIEVMGLMQGK D     G  +IV+DAFALPVE T
Sbjct  45   PRYFKNVRISALALIKMVMHARGGGTIEVMGLMQGKIDLDDPRGPTLIVLDAFALPVEAT  104

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNA ADAYEYMV++    ++AGR ENV+GWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  105  ETRVNAMADAYEYMVEFQSLAREAGRAENVIGWYHSHPGYGCWLSGIDVNTQMLNQ  160



>ref|XP_004524029.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X1 
[Ceratitis capitata]
Length=333

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 120/167 (72%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A  TWE+EN ++   LPP              I+ YD   Q +    KPW  DPHYF
Sbjct  3    AKRALATWELENRLKI--LPPCDE-----------IYRYDGEQQRQILDAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISAL+LLKMV+HARSGGT+E+MGL+ GK + + +IVMD FALPVEGTETRVNAQ+ 
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLLLGKVEDNTMIVMDVFALPVEGTETRVNAQSQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMSAYIEAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_004524030.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Ceratitis capitata]
Length=331

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 120/167 (72%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A  TWE+EN ++   LPP              I+ YD   Q +    KPW  DPHYF
Sbjct  3    AKRALATWELENRLKI--LPPCDE-----------IYRYDGEQQRQILDAKPWEKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISAL+LLKMV+HARSGGT+E+MGL+ GK + + +IVMD FALPVEGTETRVNAQ+ 
Sbjct  50   KDIKISALSLLKMVMHARSGGTLEIMGLLLGKVEDNTMIVMDVFALPVEGTETRVNAQSQ  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y +  K+ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQ
Sbjct  110  AYEYMSAYIEAAKEVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQ  156



>ref|XP_004363323.1| constitutive photomorphogenic 9 complex chain AJH2 [Capsaspora 
owczarzaki ATCC 30864]
 gb|KJE92678.1| constitutive photomorphogenic 9 complex chain AJH2 [Capsaspora 
owczarzaki ATCC 30864]
Length=357

 Score =   214 bits (546),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            +F +++  Q +  Q +PWT DPHYFK+VKISA+ALLKMV+HARSGG IEVMGLMQGK DG
Sbjct  27   VFRFNQQEQQQLLQSRPWTKDPHYFKKVKISAIALLKMVMHARSGGNIEVMGLMQGKIDG  86

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            D +I+MDAFALPVEGTETRVNA A+ YEYMVDY    K  GRLEN +GWYHSHPGYGCWL
Sbjct  87   DTMIIMDAFALPVEGTETRVNAAAEGYEYMVDYMTVIKDVGRLENAIGWYHSHPGYGCWL  146

Query  516  SGIDVSTQMLNQ  551
            SGIDV TQ LNQ
Sbjct  147  SGIDVGTQSLNQ  158



>gb|KHN85679.1| COP9 signalosome complex subunit 5 [Toxocara canis]
Length=375

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 125/174 (72%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            M++ +S AA A + W+  N+V+ ++                 I+ YD   Q   +  +PW
Sbjct  1    MEACSSDAATALRNWQAANDVQLVE----------------TIYRYDAGEQQVIRTVRPW  44

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPHYF  VKISALALLKMV+HARSGGT+E+MGL+QGK D + +IVMD+FALPVEGTET
Sbjct  45   EKDPHYFTEVKISALALLKMVMHARSGGTLEIMGLVQGKVDSNTLIVMDSFALPVEGTET  104

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  Y+++ +  GR++ VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  105  RVNAQAQAYEYMSTYTESCESIGRIDKVVGWYHSHPGYGCWLSGIDVSTQALNQ  158



>ref|XP_002633848.1| C. briggsae CBR-CSN-5 protein [Caenorhabditis briggsae]
 emb|CAP37056.1| Protein CBR-CSN-5 [Caenorhabditis briggsae]
Length=367

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    IDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQLEIRNAKPW  46

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPHYFK++KISA+ALLKM +HA+ GG++E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGSLEIMGLLQGRIDANSFIILDVFALPVEGTET  106

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  YS   +  GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  107  RVNAQAQAYEYMTVYSDLCETEGRQEKVVGWYHSHPGYGCWLSGIDVSTQTLNQ  160



>gb|KIZ06923.1| COP9 signalosome complex subunit 5 [Monoraphidium neglectum]
Length=383

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 126/171 (74%), Gaps = 11/171 (6%)
 Frame = +3

Query  39   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  218
              + A++AQ+ WE+EN V +             ++ +D ++ YD   Q   QQ+KPW  D
Sbjct  1    MAAGASVAQQRWELENAVASTS-----------ASEADGLYRYDLQEQQTIQQQKPWQKD  49

Query  219  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN  398
            P YFK V++SALALLKM +HARSGG +EVMGLMQGK  GD  +V+D+FALPVEGTETRVN
Sbjct  50   PQYFKHVRMSALALLKMAIHARSGGNLEVMGLMQGKVQGDTFVVIDSFALPVEGTETRVN  109

Query  399  AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AQA+AYEYMVD+  + K  GR ENVVGWYHSHPGYGCWLSGID STQMLNQ
Sbjct  110  AQAEAYEYMVDFVDSTKCVGRPENVVGWYHSHPGYGCWLSGIDCSTQMLNQ  160



>ref|XP_002952633.1| hypothetical protein VOLCADRAFT_81927 [Volvox carteri f. nagariensis]
 gb|EFJ46186.1| hypothetical protein VOLCADRAFT_81927 [Volvox carteri f. nagariensis]
Length=362

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 11/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A+ A+  WE+ENN++     PT+++   A      +F YD   Q   Q  +PW  DPH++
Sbjct  4    ASTAKARWELENNIQ-----PTTSEDVDA------LFKYDAAEQQLAQSCRPWAKDPHHY  52

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K V++SALALLK+ +HARSGG +EVMG++QGK  GD  IV+D+FALPVEGTETRVNAQA+
Sbjct  53   KHVRMSALALLKIAMHARSGGNLEVMGILQGKVQGDTFIVIDSFALPVEGTETRVNAQAE  112

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVD+  TNK   RLEN VGWYHSHPGYGCWLSGIDV+TQM NQ
Sbjct  113  AYEYMVDFLDTNKSVHRLENAVGWYHSHPGYGCWLSGIDVTTQMTNQ  159



>ref|NP_500841.1| Protein CSN-5 [Caenorhabditis elegans]
 sp|P91001.1|CSN5_CAEEL RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5; AltName: Full=JAB1 homolog [Caenorhabditis 
elegans]
 emb|CCD62206.1| CSN-5 [Caenorhabditis elegans]
Length=368

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            +D+   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNKQQVEIRNAKPW  46

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPHYFK++KISA+ALLKM +HA+ GG +E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTET  106

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  YS+     GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  107  RVNAQAQAYEYMTVYSEMCDTEGRKEKVVGWYHSHPGYGCWLSGIDVSTQTLNQ  160



>ref|XP_003712833.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|EHA53026.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|ELQ43145.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae Y34]
 gb|ELQ68262.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae P131]
Length=344

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 125/165 (76%), Gaps = 12/165 (7%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A K+WE++NNV+ +D  P+             ++ YD  +Q    Q++PW  DP+YFK 
Sbjct  3    VAMKSWELDNNVKLVD--PSRDA----------LYNYDAESQKAINQQRPWAKDPNYFKS  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISA+AL+KMV+HARSGG++EVMG+MQG  DG A++V DAF LPVEGTETRVNA  +A 
Sbjct  51   VRISAIALIKMVMHARSGGSLEVMGMMQGYVDGTALVVTDAFRLPVEGTETRVNAHDEAN  110

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EY+V+Y + +++ GRLENVVGWYHSHPGYGCWLSGIDVSTQ L Q
Sbjct  111  EYLVEYLRLSREQGRLENVVGWYHSHPGYGCWLSGIDVSTQFLQQ  155



>ref|XP_003101399.1| CRE-CSN-5 protein [Caenorhabditis remanei]
 gb|EFP07253.1| CRE-CSN-5 protein [Caenorhabditis remanei]
Length=371

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 122/174 (70%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQVEIRNAKPW  46

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DPHYFK++KISA+ALLKM +HA+ GG +E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct  47   DKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTET  106

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  YS   +  GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  107  RVNAQAQAYEYMTVYSDLCETEGRQEKVVGWYHSHPGYGCWLSGIDVSTQTLNQ  160



>emb|CCG82078.1| putative COP9 signalosome subunit 5 [Taphrina deformans PYCC 
5710]
Length=359

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 16/167 (10%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            I Q+T+E+ENNV+ +D             ++D IF YD   Q   + + PWT DPH+F+R
Sbjct  3    IPQQTFELENNVQLLD-------------NNDRIFEYDVAEQKAIRNDAPWTRDPHFFRR  49

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGK--TDGDAIIVMDAFALPVEGTETRVNAQAD  410
             +ISA+AL+KMV HARSGG IEVMGLMQGK   +GD II++DAFALPVEGTETRVNA A+
Sbjct  50   ARISAIALIKMVTHARSGGAIEVMGLMQGKITAEGD-IIILDAFALPVEGTETRVNAGAE  108

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM+ Y  +++Q  R ENVVGWYHSHPGYGCWLSGIDV TQM NQ
Sbjct  109  AYEYMIQYGTSSEQVSRPENVVGWYHSHPGYGCWLSGIDVGTQMENQ  155



>gb|EFO27045.2| COP9 signalosome complex subunit 5 [Loa loa]
Length=361

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 118/162 (73%), Gaps = 16/162 (10%)
 Frame = +3

Query  66   KTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKI  245
            + W++ NN+E+++                 I+ YD   Q   +  KPW  DPHYFK +KI
Sbjct  23   RNWQMSNNIESLE----------------TIYQYDSAEQQAIRAVKPWEKDPHYFKEIKI  66

Query  246  SALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYM  425
            +ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRVNAQA AYEYM
Sbjct  67   AALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRVNAQAQAYEYM  126

Query  426  VDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
              Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  127  TTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  168



>gb|KIL64761.1| hypothetical protein M378DRAFT_77858 [Amanita muscaria Koide 
BX008]
Length=364

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S + IA K++ +ENN+  +++ P            D I+ +D  A     QE PW  DPH
Sbjct  2    SKSKIALKSFSLENNI--LEVSP-----------GDEIYRFDAEADKSINQEAPWKKDPH  48

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK  KISA+AL+KMV+HARSG   E+MGLMQGK  GD+I+VMD+FALPV+GTETRVNA 
Sbjct  49   YFKSCKISAVALIKMVIHARSGVPHEIMGLMQGKVVGDSIVVMDSFALPVQGTETRVNAA  108

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             +AYEYMV+Y + +K+AGRLEN +GWYHSHPGYGCWLSGIDV+TQM NQ
Sbjct  109  NEAYEYMVEYLENSKKAGRLENAIGWYHSHPGYGCWLSGIDVNTQMNNQ  157



>gb|KFH67419.1| COP9 signalosome complex subunit 5 [Mortierella verticillata 
NRRL 6337]
Length=362

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 122/167 (73%), Gaps = 12/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            AA A+K +E  NN+++++               D I+++D   Q +   E PW  DPHYF
Sbjct  3    AANARKNFEFINNIKSVN------------PELDQIYHFDAAVQKQILNESPWKKDPHYF  50

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
              VKISA+AL+KMV+HARSGG IEVMG+MQGK  G+ II+MDAFALPVEGTETRVNAQ +
Sbjct  51   THVKISAVALIKMVMHARSGGNIEVMGMMQGKIAGNTIIIMDAFALPVEGTETRVNAQIE  110

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             YEYMV Y +  K+ GRLE+ VGWYHSHPGYGCWLSGIDV+TQM NQ
Sbjct  111  GYEYMVQYMENIKKVGRLEHAVGWYHSHPGYGCWLSGIDVNTQMQNQ  157



>gb|EHL03671.1| putative COP9 signalosome complex subunit 5 [Glarea lozoyensis 
74030]
Length=291

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG IEVMGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGDIEVMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV Y Q  +  G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVGYLQACRDQGKLENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>gb|EYC46045.1| hypothetical protein Y032_0410g948 [Ancylostoma ceylanicum]
Length=384

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 16/169 (9%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S  ++A + W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  20   SEESVALRNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  63

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK V+ISA+ALLKMV+HAR GG +EVMGLMQG+ DG+A I+MD FALPVEGTETRVNAQ
Sbjct  64   YFKEVRISAVALLKMVIHARRGGNLEVMGLMQGRVDGNAFIIMDTFALPVEGTETRVNAQ  123

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y+   +  G+ E VVGWYHSHPGYGCWLSGIDV+TQ LNQ
Sbjct  124  AQAYEYMSVYTDLCESEGKKEKVVGWYHSHPGYGCWLSGIDVATQALNQ  172



>gb|EYC46046.1| hypothetical protein Y032_0410g948 [Ancylostoma ceylanicum]
Length=391

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 16/169 (9%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S  ++A + W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  27   SEESVALRNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  70

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK V+ISA+ALLKMV+HAR GG +EVMGLMQG+ DG+A I+MD FALPVEGTETRVNAQ
Sbjct  71   YFKEVRISAVALLKMVIHARRGGNLEVMGLMQGRVDGNAFIIMDTFALPVEGTETRVNAQ  130

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y+   +  G+ E VVGWYHSHPGYGCWLSGIDV+TQ LNQ
Sbjct  131  AQAYEYMSVYTDLCESEGKKEKVVGWYHSHPGYGCWLSGIDVATQALNQ  179



>ref|XP_011400031.1| COP9 signalosome complex subunit 5b [Auxenochlorella protothecoides]
 gb|KFM27075.1| COP9 signalosome complex subunit 5b [Auxenochlorella protothecoides]
Length=237

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 22/176 (13%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            ++Q  WE+EN V+T+             +  DA+++++   Q + QQ +PW  DP YFKR
Sbjct  1    MSQARWELENAVQTVQ-----------DSDVDAVYHWNPAEQREMQQARPWLQDPTYFKR  49

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISALALLKM +HARSGG +EVMG+MQGK  GD  +VMDAF LPVEGTETRVNAQA+AY
Sbjct  50   VRISALALLKMAMHARSGGDLEVMGVMQGKVLGDTFVVMDAFPLPVEGTETRVNAQAEAY  109

Query  417  EYMVDYSQTNK-----------QAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMV++ +TNK            +GR EN+VGWYHSHPGYGCWLSGIDV TQ+ NQ
Sbjct  110  EYMVEFLETNKVVVGGGWRDKRASGREENIVGWYHSHPGYGCWLSGIDVGTQLTNQ  165



>ref|XP_007410237.1| hypothetical protein MELLADRAFT_116525 [Melampsora larici-populina 
98AG31]
 gb|EGG06403.1| hypothetical protein MELLADRAFT_116525 [Melampsora larici-populina 
98AG31]
Length=368

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 127/173 (73%), Gaps = 14/173 (8%)
 Frame = +3

Query  33   DSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWT  212
            +S + +  +AQKT++I NNV+T++               D IF Y+   Q     EK W 
Sbjct  5    NSSSPAGGVAQKTFDIANNVQTLE--------------EDQIFKYNSEEQKTILNEKKWK  50

Query  213  NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETR  392
            +DP+YFK+V++S +AL+KMV+HARSGG  E+MGLMQGK DGD  +VMD+FALPVEGTETR
Sbjct  51   SDPNYFKKVRVSGVALIKMVMHARSGGQYEIMGLMQGKIDGDTFVVMDSFALPVEGTETR  110

Query  393  VNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            VNA ++A EYMV++   +K+ GR ENVVGWYHSHPGYGCWLSGIDV+TQ+ NQ
Sbjct  111  VNAASEANEYMVEFLTHSKKVGRPENVVGWYHSHPGYGCWLSGIDVNTQLTNQ  163



>gb|EGT56002.1| hypothetical protein CAEBREN_15614 [Caenorhabditis brenneri]
Length=369

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            +DS   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDSVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNQQQMEIRNAKPW  46

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DP+YF  +KISA+ALLKM +HA+ GG +E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct  47   DKDPNYFTNIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTET  106

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  YS+  +  GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  107  RVNAQAQAYEYMTVYSEMCEAEGRQEKVVGWYHSHPGYGCWLSGIDVSTQTLNQ  160



>gb|EGT48387.1| hypothetical protein CAEBREN_22923 [Caenorhabditis brenneri]
Length=369

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 16/174 (9%)
 Frame = +3

Query  30   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            +DS   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDSVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNQQQMEIRNAKPW  46

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET  389
              DP+YF  +KISA+ALLKM +HA+ GG +E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct  47   DKDPNYFTNIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTET  106

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQA AYEYM  YS+  +  GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  107  RVNAQAQAYEYMTVYSEMCEAEGRQEKVVGWYHSHPGYGCWLSGIDVSTQTLNQ  160



>ref|XP_007914606.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
 gb|EOO00631.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
Length=349

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 12/160 (8%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK+WE+ENNV+ +D  PT             ++ YD  +Q   + +KPW  DP+YF+ V
Sbjct  5    AQKSWELENNVKLVD--PTRDS----------LYGYDPESQKDIRAKKPWRTDPNYFRTV  52

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+AL+KMV+HARSGG+IEVMGLMQG  DG A+++ DAF LPVEGTETRVNAQ +A E
Sbjct  53   RISAVALIKMVMHARSGGSIEVMGLMQGFVDGTALVITDAFRLPVEGTETRVNAQEEANE  112

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQ  539
            YMV+Y + +++ GRLEN++GWYHSHPGYGCWLSGIDV TQ
Sbjct  113  YMVEYPRLSREQGRLENLIGWYHSHPGYGCWLSGIDVGTQ  152



>gb|ESZ94555.1| COP9 signalosome complex subunit 5 [Sclerotinia borealis F-4157]
Length=347

 Score =   209 bits (532),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 120/164 (73%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE++NNV+ +D            A+ DA++ YD   Q   Q  KPW  DPH+FK V
Sbjct  4    AFKTWELDNNVQLVD------------ANRDALYTYDPEEQKAIQDAKPWKTDPHHFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG+IEVMGLMQGK  GD IIV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQGKIAGDTIIVTDAFRLPVEGTETRVNAQEEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV+Y    ++ G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVEYLGHCREQGKLENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>ref|XP_008083662.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
 gb|EPE29553.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
Length=345

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG IEVMGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGDIEVMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV Y Q  +  G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVGYLQACRDQGKLENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>ref|XP_001694818.1| COP signalosome subunit 5 [Chlamydomonas reinhardtii]
 gb|EDP02402.1| COP signalosome subunit 5, partial [Chlamydomonas reinhardtii]
Length=326

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 120/167 (72%), Gaps = 11/167 (7%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            ++ A+  WE+ENN+       T A           +F YD   Q   Q  KPW  DPH++
Sbjct  5    SSTARVRWELENNIAPAASEDTDA-----------LFKYDAAEQQLAQSCKPWAKDPHHY  53

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K V++SALALLK+ +HARSGG +EVMG++QGK  GD  IV+D+FALPVEGTETRVNAQA+
Sbjct  54   KHVRMSALALLKIAMHARSGGNLEVMGILQGKVVGDTFIVIDSFALPVEGTETRVNAQAE  113

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYMVD+  TNK   R EN VGWYHSHPGYGCWLSGIDV+TQM+NQ
Sbjct  114  AYEYMVDFLDTNKAVHRPENAVGWYHSHPGYGCWLSGIDVNTQMMNQ  160



>emb|CEF98127.1| JAB/MPN domain [Ostreococcus tauri]
Length=340

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +3

Query  99   MDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVH  278
            MD P     + A +++SD +F +D+TAQ    ++KPWT DPHYFK+VKISALAL+KM  H
Sbjct  1    MDPPGPDDPATARASASDELFVFDDTAQRLVAEQKPWTRDPHYFKKVKISALALMKMTQH  60

Query  279  ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAG  458
               GG IEVMG + G+T GDA +V DAF LPVEGTETRVNAQA+AYEYMV++    K+ G
Sbjct  61   CERGGEIEVMGTLLGQTRGDAFVVTDAFELPVEGTETRVNAQAEAYEYMVEHVGAMKRTG  120

Query  459  RLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            R ENVVGWYHSHPGYGCWLSGIDV+TQMLNQ
Sbjct  121  RGENVVGWYHSHPGYGCWLSGIDVNTQMLNQ  151



>ref|XP_003740357.1| PREDICTED: COP9 signalosome complex subunit 5-like [Metaseiulus 
occidentalis]
Length=333

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 118/167 (71%), Gaps = 14/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A  A K WE+EN ++ +              S+DAI+ +D          KPW  D HYF
Sbjct  3    APAALKRWELENRIDDV--------------SADAIYRFDTVQNRDILHAKPWEKDRHYF  48

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGG +EVMGL+ GK D + +IVMD FALPVEGTETRVNAQ +
Sbjct  49   KDIKISALALLKMVMHARSGGNLEVMGLLLGKVDANLMIVMDCFALPVEGTETRVNAQTE  108

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y++  KQ GRLENV+GWYHSHPGYGCWLSGIDVSTQ  NQ
Sbjct  109  AYEYMATYTEACKQVGRLENVIGWYHSHPGYGCWLSGIDVSTQTTNQ  155



>gb|KDE08164.1| COP9 signalosome complex subunit 5 [Microbotryum violaceum p1A1 
Lamole]
Length=375

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 124/168 (74%), Gaps = 16/168 (10%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            +A+ A KT+E+ N+++T+D                +IF +D+  Q +    +PW  DPHY
Sbjct  13   AASTASKTFELNNDIQTVD----------------SIFRHDQAEQRRQLAAQPWKKDPHY  56

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            F+ V+ISA+AL+KMV+HARSGG  E+MGLMQGK DGD ++VMDAFALPV GTETRVNAQ 
Sbjct  57   FQHVRISAVALIKMVMHARSGGQYEIMGLMQGKLDGDTMVVMDAFALPVVGTETRVNAQN  116

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            DA E+M+ Y +++   GRLEN++GWYHSHPGYGCWLSGIDV TQ ++Q
Sbjct  117  DANEFMIQYIESSSAIGRLENIIGWYHSHPGYGCWLSGIDVQTQKIHQ  164



>ref|XP_011297758.1| PREDICTED: COP9 signalosome complex subunit 5 [Fopius arisanus]
Length=343

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 117/165 (71%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IAQ+ WE+ N+VET+              S D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQRMWEMTNDVETIS-------------SVDEIYRYDHQEQQSILAAKPWEKDPHFFKD  57

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            +KISALALLKMV+HARSGGT+E+MGL+ GK   + +IVMD+FALPVEGTETRVNA   AY
Sbjct  58   IKISALALLKMVMHARSGGTLEIMGLLLGKVTANTMIVMDSFALPVEGTETRVNAHEQAY  117

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EY+  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQ  NQ
Sbjct  118  EYIPAYIEAAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQTNNQ  162



>dbj|GAK66062.1| mov34-domain-containing protein [Pseudozyma antarctica]
Length=364

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 126/174 (72%), Gaps = 13/174 (7%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S T S  +AQ T+E+ N++  +D           +++ D+IF YD  AQ    + +PW +
Sbjct  6    SSTPSGGMAQATFELNNSIVPLD-----------ASTLDSIFAYDTEAQRAILRAQPWKS  54

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD--GDAIIVMDAFALPVEGTET  389
            DPH+F +V+ISA+AL+KMV+HARSGG  E+MGLMQGK D     + VMD+FALPVEGTET
Sbjct  55   DPHFFTKVRISAVALIKMVMHARSGGIYEIMGLMQGKIDVENRTLYVMDSFALPVEGTET  114

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQ +AYEYMV Y   +KQ GRLENVVGWYHSHPGYGCWLSGIDV TQ  NQ
Sbjct  115  RVNAQNEAYEYMVQYLDDSKQVGRLENVVGWYHSHPGYGCWLSGIDVGTQRTNQ  168



>ref|XP_001636625.1| predicted protein [Nematostella vectensis]
 gb|EDO44562.1| predicted protein [Nematostella vectensis]
Length=333

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 124/167 (74%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +A+A K+WE+ NN+E ++               D IF YD   Q +  Q KPW  DPHYF
Sbjct  3    SAMAMKSWELANNIENVN-------------GIDEIFKYDRQQQQEILQAKPWQKDPHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K +KISALALLKMV+HARSGG +EVMGLM GK DGD +IVMDAFALPVEGTETRVNAQA 
Sbjct  50   KNIKISALALLKMVMHARSGGNLEVMGLMLGKVDGDTMIVMDAFALPVEGTETRVNAQAA  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y ++ K  GRLEN +GWYHSHPGYGCWLSGIDV TQM+NQ
Sbjct  110  AYEYMAAYIESAKSVGRLENAIGWYHSHPGYGCWLSGIDVGTQMVNQ  156



>ref|XP_001595259.1| hypothetical protein SS1G_03348 [Sclerotinia sclerotiorum 1980]
 gb|EDO00874.1| hypothetical protein SS1G_03348 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=347

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 118/164 (72%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE++NNV+ +D             + DA++ YD   Q   Q  KPW  DPH+FK V
Sbjct  4    AFKTWELDNNVQLVD------------PNRDALYTYDPKEQRAIQDAKPWKTDPHHFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG+IEVMGLMQGK  GD IIV DAF LPVEGTETRVNAQ +A  
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQGKIAGDTIIVTDAFRLPVEGTETRVNAQDEANT  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV+Y Q  +  G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVEYLQHCRDQGKLENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>gb|EHJ73122.1| JAB-MPN domain protein [Danaus plexippus]
Length=397

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            I+ YD+  Q      KPW  DPH+FK +KISALALLKMV+HARSGGT+EVMGL+ GK D 
Sbjct  14   IYRYDKKQQQDILAAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLLLGKVDA  73

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            + ++VMD+FALPVEGTETRVNAQA AYEYM  Y +  KQ GR EN +GWYHSHPGYGCWL
Sbjct  74   NTMLVMDSFALPVEGTETRVNAQAQAYEYMTAYIEAAKQVGRHENAIGWYHSHPGYGCWL  133

Query  516  SGIDVSTQMLNQ  551
            SGIDVSTQMLNQ
Sbjct  134  SGIDVSTQMLNQ  145



>ref|XP_002507203.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68461.1| predicted protein [Micromonas sp. RCC299]
Length=322

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            I  YD+T Q   QQ+K W  +PH+FK+V++SALAL KM +H RSG ++EVMG++QGKT G
Sbjct  12   IHRYDDTQQIAIQQQKLWLRNPHFFKQVRVSALALFKMTLHCRSGSSLEVMGMLQGKTIG  71

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            DA IV+D F LPVEGTETRVNAQA+AYEYMV++ QT++ AGR E V+GWYHSHPGYGCW+
Sbjct  72   DAFIVLDTFPLPVEGTETRVNAQAEAYEYMVEFVQTSRLAGRREYVIGWYHSHPGYGCWM  131

Query  516  SGIDVSTQMLNQ  551
            SGID STQMLNQ
Sbjct  132  SGIDCSTQMLNQ  143



>ref|XP_001551965.1| hypothetical protein BC1G_09577 [Botrytis cinerea B05.10]
 emb|CCD53906.1| similar to COP9 signalosome complex subunit 5 [Botrytis cinerea 
T4]
 gb|EMR88083.1| putative cop9 signalosome complex subunit 5 protein [Botrytis 
cinerea BcDW1]
Length=353

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 119/164 (73%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A KTWE++NNV+ +D             + DA++ YD   Q   Q  KPW  DP++FK V
Sbjct  4    AFKTWELDNNVQLVD------------PNRDALYTYDPEEQKAIQNAKPWKTDPNHFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG+IEVMGLMQGK  GD IIV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQGKIAGDTIIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV+Y Q  +  G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVEYLQHCRDQGKLENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>ref|XP_002114449.1| hypothetical protein TRIADDRAFT_27810 [Trichoplax adhaerens]
 gb|EDV23539.1| hypothetical protein TRIADDRAFT_27810 [Trichoplax adhaerens]
Length=337

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            I++YD T Q + Q  KPW     YFK+VKISALALLKM+ HA+SGG IE+MGLM GK   
Sbjct  39   IYHYDATEQREIQIRKPWKQSEDYFKKVKISALALLKMLTHAKSGGNIEIMGLMLGKVRN  98

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            + +I+MD+FALPVEGTETRVNAQ  AYEYM  Y +  KQ GRLENV+GWYHSHPGYGCWL
Sbjct  99   EDMIIMDSFALPVEGTETRVNAQESAYEYMTAYVEAAKQVGRLENVIGWYHSHPGYGCWL  158

Query  516  SGIDVSTQMLNQ  551
            SGIDVSTQMLNQ
Sbjct  159  SGIDVSTQMLNQ  170



>ref|XP_007779451.1| COP9 signalosome complex subunit 5 [Coniosporium apollinis CBS 
100218]
 gb|EON64134.1| COP9 signalosome complex subunit 5 [Coniosporium apollinis CBS 
100218]
Length=339

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 114/164 (70%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQKTWE+EN V+ +D  PT             ++ YD   Q      KPW  DP+YFK V
Sbjct  4    AQKTWELENVVKLVD--PTRDA----------LYNYDPDEQKAINAAKPWKKDPNYFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG+IEVMGLMQG   GD  IV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGSIEVMGLMQGSVQGDTFIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV Y Q  +  G+LEN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  112  YMVQYLQRARDVGQLENAVGWYHSHPGYGCWLSGIDVGTQFQQQ  155



>emb|CDJ96405.1| Mov34 MPN PAD-1 domain containing protein [Haemonchus contortus]
Length=385

 Score =   207 bits (528),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 118/169 (70%), Gaps = 16/169 (9%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S  ++A + W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  20   SEESVALRNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  63

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK V+ISA+ALLKMV+H++ GG +EVMGLMQG+ DG+A I+MD FALPVEGTETRVNAQ
Sbjct  64   YFKEVRISAVALLKMVIHSKRGGNLEVMGLMQGRVDGNAFIIMDTFALPVEGTETRVNAQ  123

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y+   +  G+ E VVGWYHSHPGYGCWLSGIDV+TQ LNQ
Sbjct  124  AQAYEYMSVYTDLCEAEGKKEKVVGWYHSHPGYGCWLSGIDVATQGLNQ  172



>ref|XP_003137030.1| COP9 signalosome complex subunit 5 [Loa loa]
Length=360

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 18/164 (11%)
 Frame = +3

Query  66   KTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK--RV  239
            + W++ NN+E+++                 I+ YD   Q   +  KPW  DPHYFK   +
Sbjct  20   RNWQMSNNIESLE----------------TIYQYDSAEQQAIRAVKPWEKDPHYFKAREI  63

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KI+ALALLKMV+HARSGG +EVMGL+QGK D + ++V+D+FALPVEGTETRVNAQA AYE
Sbjct  64   KIAALALLKMVMHARSGGNLEVMGLVQGKVDANTLVVVDSFALPVEGTETRVNAQAQAYE  123

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YM  Y+ +++  GRL  VVGWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  124  YMTTYTDSSEAVGRLHKVVGWYHSHPGYGCWLSGIDVSTQALNQ  167



>dbj|GAC74200.1| COP9 signalosome, subunit CSN5 [Pseudozyma antarctica T-34]
Length=363

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 125/174 (72%), Gaps = 13/174 (7%)
 Frame = +3

Query  36   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  215
            S   S  +AQ T+E+ N++  +D           +++ ++IF YD  AQ    + +PW +
Sbjct  6    SSAPSGGMAQATFELNNDIVQLD-----------ASTLNSIFAYDTEAQRAILRAQPWKS  54

Query  216  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD--GDAIIVMDAFALPVEGTET  389
            DPH+F +V+ISA+AL+KMV+HARSGG  E+MGLMQGK D     + VMD+FALPVEGTET
Sbjct  55   DPHFFTKVRISAVALIKMVMHARSGGIYEIMGLMQGKIDVENRTLYVMDSFALPVEGTET  114

Query  390  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            RVNAQ +AYEYMV Y   +KQ GRLENVVGWYHSHPGYGCWLSGIDV TQ  NQ
Sbjct  115  RVNAQNEAYEYMVQYLDDSKQVGRLENVVGWYHSHPGYGCWLSGIDVGTQRTNQ  168



>ref|XP_007792821.1| putative cop9 signalosome complex subunit 5 protein [Eutypa lata 
UCREL1]
 gb|EMR68078.1| putative cop9 signalosome complex subunit 5 protein [Eutypa lata 
UCREL1]
Length=339

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 122/166 (73%), Gaps = 13/166 (8%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A K+WE++N+V+ +D               DA++ Y    Q    + KPW  DPH+FK+
Sbjct  3    VAMKSWELDNDVKLVD------------PVRDALYSYSADRQKMANEAKPWKKDPHHFKQ  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V++SA+AL+KMV+HARSGG+IEVMGLMQG TDGD I+V DAF LPVEGTETRVNAQ DA 
Sbjct  51   VRVSAVALIKMVMHARSGGSIEVMGLMQGYTDGDTIVVTDAFGLPVEGTETRVNAQDDAN  110

Query  417  EYMVDYSQTNK-QAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYM++Y Q+++ Q  R EN VGWYHSHPGYGCWLSGIDV TQ L Q
Sbjct  111  EYMIEYLQSSRDQGSRQENAVGWYHSHPGYGCWLSGIDVDTQKLQQ  156



>gb|KFZ02747.1| hypothetical protein V502_11539 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=345

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 12/165 (7%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            IA++ WE++NNV+ +D            A  D+++ YD T Q    + KPW  +P +FK 
Sbjct  3    IARRAWELDNNVQLVD------------AHRDSLYSYDATEQKSINEAKPWKTNPRHFKN  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISA+ALLKMV+HARSGG++E+MGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A 
Sbjct  51   VRISAVALLKMVIHARSGGSVEIMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEAN  110

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMV Y +  + AG++EN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  111  EYMVGYLEACRAAGKMENAVGWYHSHPGYGCWLSGIDVGTQSTQQ  155



>ref|XP_001418095.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96388.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=328

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            ++ YDE A      +KPW  DPHYFKRVK+SALAL+KM  H + GG IEVMG++QG    
Sbjct  9    LYAYDEVAHKLLVAQKPWARDPHYFKRVKVSALALMKMTAHCKRGGDIEVMGMLQGYAKD  68

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            DA IV+D F LPVEGTETRVNAQA+AYEYMV+Y+ T K  GR ENVVGWYHSHPGYGCWL
Sbjct  69   DAFIVLDVFELPVEGTETRVNAQAEAYEYMVEYTHTCKAVGRHENVVGWYHSHPGYGCWL  128

Query  516  SGIDVSTQMLNQ  551
            SGIDV+TQ +NQ
Sbjct  129  SGIDVNTQSMNQ  140



>ref|XP_001882520.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR06673.1| predicted protein [Laccaria bicolor S238N-H82]
Length=363

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 126/168 (75%), Gaps = 13/168 (8%)
 Frame = +3

Query  48   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  227
            S++ A KT+ + N++  +++ P            D I+ +D  A  +  QE PWT DPHY
Sbjct  2    SSSTALKTFSLTNDI--LEVTP-----------QDEIYRFDAEANRRINQEAPWTKDPHY  48

Query  228  FKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA  407
            FK  KISA+AL+KMV+HARSG   E+MGLMQGK  G++I++MD+FALPV+GTETRVNA +
Sbjct  49   FKSCKISAVALIKMVIHARSGVPHEIMGLMQGKVVGNSIVIMDSFALPVQGTETRVNAAS  108

Query  408  DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            +A EYMV+Y Q +++AGRLEN +GWYHSHPGYGCWLSGIDV+TQM NQ
Sbjct  109  EANEYMVEYIQGSEKAGRLENAIGWYHSHPGYGCWLSGIDVNTQMNNQ  156



>gb|KIW00274.1| hypothetical protein PV09_08164 [Verruconis gallopava]
Length=334

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 121/162 (75%), Gaps = 12/162 (7%)
 Frame = +3

Query  66   KTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKI  245
            K+WE+EN+++ +D            ++ DA++ +DE A    Q +KPW  DP+YFK V+I
Sbjct  6    KSWELENSIQLLD------------STRDALYDFDEAAYKALQTQKPWNKDPNYFKHVRI  53

Query  246  SALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYM  425
            SA+ALLKMV+HARSGG+IEVMGLMQG   GD  IV DAF LPVE TETRVNAQ +A++Y+
Sbjct  54   SAVALLKMVMHARSGGSIEVMGLMQGTVHGDTFIVTDAFRLPVEATETRVNAQEEAFQYI  113

Query  426  VDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            V Y + +K  G+ EN+VGWYHSHPGYGCWLSGIDVSTQ L Q
Sbjct  114  VQYLEMSKANGQCENIVGWYHSHPGYGCWLSGIDVSTQNLQQ  155



>gb|KFY66915.1| hypothetical protein V496_01853 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY99144.1| hypothetical protein V498_00992 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=345

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 119/165 (72%), Gaps = 12/165 (7%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A+K WE++NNV+ +D            A  DA++ YD T Q    + KPW  +P +FK 
Sbjct  3    VARKAWELDNNVQLVD------------AHRDALYSYDATEQKAINEAKPWRTNPRHFKN  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISA+ALLKMV+HARSGG++E+MGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A 
Sbjct  51   VRISAVALLKMVMHARSGGSVEIMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEAN  110

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMV Y +  + AG++EN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  111  EYMVGYLEACRAAGKMENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>gb|KIJ90495.1| hypothetical protein K443DRAFT_686728 [Laccaria amethystina LaAM-08-1]
Length=363

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  156  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG  335
            I+ +D  A  +  QE PWT DPHYFK  KISA+AL+KMV+HARSG   E+MGLMQGK  G
Sbjct  25   IYRFDADANRRINQEAPWTKDPHYFKSCKISAVALIKMVIHARSGVPHEIMGLMQGKVMG  84

Query  336  DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL  515
            ++I++MD+FALPV+GTETRVNA ++A EYMV+Y Q +++AGRLEN +GWYHSHPGYGCWL
Sbjct  85   NSIVIMDSFALPVQGTETRVNAASEANEYMVEYIQGSEKAGRLENAIGWYHSHPGYGCWL  144

Query  516  SGIDVSTQMLNQ  551
            SGIDV+TQM NQ
Sbjct  145  SGIDVNTQMNNQ  156



>ref|XP_002486987.1| COP9 signalosome subunit CsnE [Talaromyces stipitatus ATCC 10500]
 gb|EED12876.1| COP9 signalosome subunit CsnE [Talaromyces stipitatus ATCC 10500]
Length=351

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 118/164 (72%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQ++WE EN V+ +D               DA++ YD +A       KPW+ DP YFK V
Sbjct  4    AQQSWESENVVQLID------------PRRDALYNYDASAHRALSDAKPWSTDPRYFKSV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISA+ALLKMV+HARSGG++EVMGLMQG    +  IV DAF LPVEGTETRVNAQ DA E
Sbjct  52   KISAVALLKMVMHARSGGSLEVMGLMQGYIAAETFIVTDAFRLPVEGTETRVNAQGDANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV+Y Q+ + +GR+EN VGWYHSHPGYGCWLSGIDVSTQ + Q
Sbjct  112  YMVEYLQSCRDSGRMENAVGWYHSHPGYGCWLSGIDVSTQSMQQ  155



>gb|KDN39096.1| Mov34-domain-containing protein [Tilletiaria anomala UBC 951]
Length=430

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 20/176 (11%)
 Frame = +3

Query  45   SSAAIAQKT-----WEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  209
            S++A+AQ+T     +E+ N++ T+D             +SDAIF+YD   Q +  + KPW
Sbjct  7    STSAVAQETMARQNFELNNDMVTLD-------------ASDAIFHYDPEKQREINERKPW  53

Query  210  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDA--IIVMDAFALPVEGT  383
              DPH+F++++ISA+AL+KMV+HARSGG  E+MGLMQGK D +   + VMD+FALPV+GT
Sbjct  54   KQDPHFFQKIRISAVALIKMVMHARSGGIYEIMGLMQGKVDVETRTMYVMDSFALPVQGT  113

Query  384  ETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            ETRVNAQA+AYEYMV+Y++ ++   RLEN +GWYHSHPGYGCWLSGIDVSTQ LNQ
Sbjct  114  ETRVNAQAEAYEYMVEYNEASRHVDRLENAIGWYHSHPGYGCWLSGIDVSTQSLNQ  169



>ref|XP_002609973.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
 gb|EEN65983.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
Length=168

 Score =   199 bits (506),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A +AQKTWE+ N +ET+              S D I+ YD+  Q +    KPWT D HYF
Sbjct  3    AKMAQKTWELANQMETVS-------------SVDEIYKYDKRQQQEILAAKPWTRDNHYF  49

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            K  K SALALLKMV+HARSGG +EVMGLM GK DG+ +IVMD FALPVEGTETRVNAQA 
Sbjct  50   KYCKXSALALLKMVMHARSGGNLEVMGLMLGKVDGETMIVMDCFALPVEGTETRVNAQAA  109

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            AYEYM  Y ++ KQ GRLEN +GWYHSHPGYGCWLSGIDV TQMLNQ
Sbjct  110  AYEYMAAYIESAKQVGRLENAIGWYHSHPGYGCWLSGIDVGTQMLNQ  156



>emb|CDJ85538.1| Mov34 MPN PAD-1 domain containing protein [Haemonchus contortus]
Length=385

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 117/169 (69%), Gaps = 16/169 (9%)
 Frame = +3

Query  45   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  224
            S  ++A   W++ N V  MD                + + YDE  Q + +  KPW  DPH
Sbjct  20   SEESVALCNWQLANGVTVMD----------------SAYEYDEVEQNEMRSAKPWQKDPH  63

Query  225  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ  404
            YFK V+ISA+ALLKMV+H++ GG +EVMGLMQG+ DG+A I+MD FALPVEGTETRVNAQ
Sbjct  64   YFKEVRISAVALLKMVIHSKRGGNLEVMGLMQGRVDGNAFIIMDTFALPVEGTETRVNAQ  123

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A AYEYM  Y+   +  G+ E VVGWYHSHPGYGCWLSGIDV+TQ LNQ
Sbjct  124  AQAYEYMSVYTDLCEAEGKKEKVVGWYHSHPGYGCWLSGIDVATQGLNQ  172



>ref|XP_006956806.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
 gb|EIM23431.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
Length=348

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 16/167 (10%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            +++A KT+++EN+VE +DL                I+ YDE AQ     ++PW  DPHYF
Sbjct  3    SSVAMKTFDLENDVEEVDL----------------IYTYDEDAQRDINNKRPWKQDPHYF  46

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD  410
            KRVKIS +AL+KMV+HARSG   EVMGLMQGK +GD +I+MDAFALPV+GTETRVNA ++
Sbjct  47   KRVKISTVALIKMVLHARSGVPYEVMGLMQGKLEGDTMIIMDAFALPVQGTETRVNASSE  106

Query  411  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            A E+MV++   +K   + EN +GWYHSHPGYGCWLSGIDV+TQ  NQ
Sbjct  107  ANEFMVNWLNGSKSVNKPENALGWYHSHPGYGCWLSGIDVTTQSTNQ  153



>ref|XP_007876876.1| hypothetical protein PFL1_01182 [Pseudozyma flocculosa PF-1]
 gb|EPQ30993.1| hypothetical protein PFL1_01182 [Pseudozyma flocculosa PF-1]
Length=383

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = +3

Query  51   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  230
            A+ AQ+ +E+ N++ T+D           ++S D +F YD   Q    Q  PW +DPHYF
Sbjct  3    ASTAQRNFEVSNSMVTLD-----------ASSLDQVFRYDADEQRSILQAAPWRSDPHYF  51

Query  231  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTD--GDAIIVMDAFALPVEGTETRVNAQ  404
            K V+ISA+AL+KMV+HARSGG  E+MGLMQGK D     I VMDAFALPV+GTETRVNAQ
Sbjct  52   KTVRISAVALIKMVMHARSGGIYEIMGLMQGKIDVATQTIYVMDAFALPVQGTETRVNAQ  111

Query  405  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
             +A E+MV+Y +++K+ GRLEN +GWYHSHPGYGCWLSGIDV+TQM NQ
Sbjct  112  NEANEFMVEYLESSKRVGRLENAIGWYHSHPGYGCWLSGIDVNTQMTNQ  160



>ref|XP_002584116.1| COP9 signalosome complex subunit 5 [Uncinocarpus reesii 1704]
 gb|EEP79963.1| COP9 signalosome complex subunit 5 [Uncinocarpus reesii 1704]
Length=334

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQK+WEIEN+VE +D            A  DA++ YD  A       KPW+ DPHYF  +
Sbjct  4    AQKSWEIENSVELVD------------AHRDALYKYDPAASQAVVSSKPWSKDPHYFTSI  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG++EVMGLMQG    +  IV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQGYVSANTFIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV Y Q  + +GR+EN +GWYHSHPGYGCWLSGIDVSTQ   Q
Sbjct  112  YMVSYLQACRDSGRMENAIGWYHSHPGYGCWLSGIDVSTQDTQQ  155



>ref|XP_007825082.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EFY95597.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EXU97339.1| JAB1/Mov34/MPN/PAD-1 ubiquitin protease domain protein [Metarhizium 
robertsii]
Length=335

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+AL+KM +HARSGG +EVMGLMQG  DGD  +V DAF LPVEGTETRVN Q +A E
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQGYVDGDTFVVTDAFRLPVEGTETRVNVQEEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            Y+V+Y    +  GR ENVVGWYHSHPGYGCWLSGIDV+T+ + Q
Sbjct  112  YLVEYLDLCRAQGRQENVVGWYHSHPGYGCWLSGIDVATEAMQQ  155



>gb|KFY87142.1| hypothetical protein V500_07158 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=345

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 12/165 (7%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A++ WE++NNV+ +D            A  D+++ YD T Q    + KPW  +P +FK 
Sbjct  3    VARRAWELDNNVQLVD------------AHRDSLYSYDATEQKSINEAKPWKTNPRHFKN  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISA+ALLKMV+HARSGG++E+MGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A 
Sbjct  51   VRISAVALLKMVMHARSGGSVEIMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEAN  110

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMV Y +  + AG++EN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  111  EYMVGYLEACRAAGKMENAVGWYHSHPGYGCWLSGIDVGTQSTQQ  155



>ref|XP_002145543.1| COP9 signalosome subunit CsnE [Talaromyces marneffei ATCC 18224]
 gb|EEA29028.1| COP9 signalosome subunit CsnE [Talaromyces marneffei ATCC 18224]
 gb|KFX45646.1| COP9 signalosome complex subunit 5 [Talaromyces marneffei PM1]
Length=352

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQ++WE+EN V+ +D               DA++ YD  A       KPW  DP YFK V
Sbjct  4    AQQSWELENVVQLID------------PRRDALYNYDAAAHRALSDTKPWAADPRYFKNV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            KISA+ALLKMV+HARSGG++EVMGLMQG    +  +V DAF LPVEGTETRVNAQ DA E
Sbjct  52   KISAVALLKMVMHARSGGSLEVMGLMQGYIAAETFVVTDAFRLPVEGTETRVNAQGDANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV+Y Q+ + +GR+EN VGWYHSHPGYGCWLSGIDVSTQ + Q
Sbjct  112  YMVEYLQSCRDSGRMENAVGWYHSHPGYGCWLSGIDVSTQSMQQ  155



>gb|KFY28089.1| hypothetical protein V493_03095 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=345

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 12/165 (7%)
 Frame = +3

Query  57   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  236
            +A++ WE++NNV+ +D            A  DA++ YD T Q    + KPW  +P +FK 
Sbjct  3    VARRAWELDNNVQLVD------------AHRDALYSYDATEQKAINEAKPWRTNPRHFKN  50

Query  237  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY  416
            V+ISA+ALLKMV+HARSGG++E+MGLMQGK  GD  IV DAF LPVEGTETRVNAQ +A 
Sbjct  51   VRISAVALLKMVMHARSGGSVEIMGLMQGKISGDTFIVTDAFRLPVEGTETRVNAQDEAN  110

Query  417  EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            EYMV Y +  + AG++EN VGWYHSHPGYGCWLSGIDV TQ   Q
Sbjct  111  EYMVGYLEACRAAGKMENAVGWYHSHPGYGCWLSGIDVGTQATQQ  155



>gb|KID75045.1| COP9 signalosome complex subunit 5, partial [Metarhizium brunneum 
ARSEF 3297]
Length=335

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 117/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+AL+KM +HARSGG +EVMGLMQG  DGD  +V DAF LPVEGTETRVN Q +A E
Sbjct  52   RISAVALIKMTMHARSGGNLEVMGLMQGYVDGDTFVVTDAFRLPVEGTETRVNVQEEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            Y+V+Y    +  GR ENVVGWYHSHPGYGCWLSGIDV+T+ + Q
Sbjct  112  YLVEYLDLCRAQGRQENVVGWYHSHPGYGCWLSGIDVATEAMQQ  155



>dbj|GAD91695.1| COP9 signalosome complex subunit 5 [Byssochlamys spectabilis 
No. 5]
Length=338

 Score =   204 bits (519),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 116/164 (71%), Gaps = 12/164 (7%)
 Frame = +3

Query  60   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  239
            AQ++WE EN ++ +D               DA++ YDE A       +PW  DPHYFK +
Sbjct  4    AQQSWEFENTIDLID------------PQRDALYKYDEDAHKALVAARPWAKDPHYFKSI  51

Query  240  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE  419
            +ISA+ALLKMV+HARSGG++EVMGLMQG    +  IV DAF LPVEGTETRVNAQ +A E
Sbjct  52   RISAVALLKMVMHARSGGSLEVMGLMQGYIAAETFIVTDAFRLPVEGTETRVNAQDEANE  111

Query  420  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQ  551
            YMV Y Q  + AGR+EN VGWYHSHPGYGCWLSGIDVSTQ + Q
Sbjct  112  YMVGYLQACRDAGRMENAVGWYHSHPGYGCWLSGIDVSTQDMQQ  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760