BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS111D10

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13355.1|  unnamed protein product                                249   3e-73   Coffea canephora [robusta coffee]
ref|XP_006352172.1|  PREDICTED: calmodulin-binding transcription ...    244   3e-71   Solanum tuberosum [potatoes]
ref|XP_009781562.1|  PREDICTED: calmodulin-binding transcription ...    241   1e-70   Nicotiana sylvestris
ref|XP_009781561.1|  PREDICTED: calmodulin-binding transcription ...    241   2e-70   Nicotiana sylvestris
ref|XP_009617256.1|  PREDICTED: calmodulin-binding transcription ...    241   3e-70   Nicotiana tomentosiformis
ref|NP_001266135.1|  calmodulin-binding transcription factor SR2L       240   4e-70   
ref|XP_010314154.1|  PREDICTED: calmodulin-binding transcription ...    239   9e-70   Solanum lycopersicum
ref|XP_009803068.1|  PREDICTED: calmodulin-binding transcription ...    239   1e-69   Nicotiana sylvestris
ref|XP_010314152.1|  PREDICTED: calmodulin-binding transcription ...    239   1e-69   Solanum lycopersicum
ref|XP_010314150.1|  PREDICTED: calmodulin-binding transcription ...    239   1e-69   Solanum lycopersicum
ref|XP_010314153.1|  PREDICTED: calmodulin-binding transcription ...    239   1e-69   
ref|NP_001266130.1|  calmodulin-binding transcription factor SR2        239   1e-69   Solanum lycopersicum
ref|XP_009592004.1|  PREDICTED: calmodulin-binding transcription ...    239   1e-69   Nicotiana tomentosiformis
gb|KHG11198.1|  Calmodulin-binding transcription activator 4 -lik...    238   3e-69   Gossypium arboreum [tree cotton]
ref|XP_006341901.1|  PREDICTED: calmodulin-binding transcription ...    238   3e-69   Solanum tuberosum [potatoes]
ref|XP_006341902.1|  PREDICTED: calmodulin-binding transcription ...    238   3e-69   Solanum tuberosum [potatoes]
ref|XP_006341903.1|  PREDICTED: calmodulin-binding transcription ...    238   3e-69   
gb|KJB60937.1|  hypothetical protein B456_009G332200                    236   1e-68   Gossypium raimondii
ref|XP_009592003.1|  PREDICTED: calmodulin-binding transcription ...    236   1e-68   
ref|XP_009592002.1|  PREDICTED: calmodulin-binding transcription ...    236   1e-68   
ref|XP_010656043.1|  PREDICTED: calmodulin-binding transcription ...    235   4e-68   Vitis vinifera
ref|XP_002270865.2|  PREDICTED: calmodulin-binding transcription ...    235   4e-68   Vitis vinifera
ref|XP_010656077.1|  PREDICTED: calmodulin-binding transcription ...    235   4e-68   Vitis vinifera
ref|XP_010656058.1|  PREDICTED: calmodulin-binding transcription ...    234   6e-68   Vitis vinifera
ref|XP_010656071.1|  PREDICTED: calmodulin-binding transcription ...    234   6e-68   
ref|XP_010314155.1|  PREDICTED: calmodulin-binding transcription ...    234   7e-68   Solanum lycopersicum
ref|XP_007043963.1|  Calmodulin-binding transcription activator p...    233   2e-67   
gb|KDP26824.1|  hypothetical protein JCGZ_17982                         233   2e-67   Jatropha curcas
ref|XP_008222186.1|  PREDICTED: calmodulin-binding transcription ...    232   6e-67   Prunus mume [ume]
ref|XP_007225420.1|  hypothetical protein PRUPE_ppa000516mg             233   6e-67   
gb|KDO81859.1|  hypothetical protein CISIN_1g044976mg                   231   7e-67   Citrus sinensis [apfelsine]
ref|XP_007043962.1|  Calmodulin-binding transcription activator p...    231   8e-67   
ref|XP_006484133.1|  PREDICTED: calmodulin-binding transcription ...    231   1e-66   Citrus sinensis [apfelsine]
ref|XP_006484135.1|  PREDICTED: calmodulin-binding transcription ...    231   1e-66   
ref|XP_006580123.1|  PREDICTED: calmodulin-binding transcription ...    229   5e-66   Glycine max [soybeans]
ref|XP_006580122.1|  PREDICTED: calmodulin-binding transcription ...    229   5e-66   Glycine max [soybeans]
ref|XP_006580124.1|  PREDICTED: calmodulin-binding transcription ...    229   6e-66   Glycine max [soybeans]
ref|XP_003524171.1|  PREDICTED: calmodulin-binding transcription ...    229   7e-66   Glycine max [soybeans]
ref|XP_008222185.1|  PREDICTED: calmodulin-binding transcription ...    229   8e-66   
ref|XP_006438003.1|  hypothetical protein CICLE_v10030636mg             228   9e-66   Citrus clementina [clementine]
ref|XP_009372262.1|  PREDICTED: calmodulin-binding transcription ...    228   9e-66   Pyrus x bretschneideri [bai li]
ref|XP_006484134.1|  PREDICTED: calmodulin-binding transcription ...    228   1e-65   Citrus sinensis [apfelsine]
ref|XP_009372261.1|  PREDICTED: calmodulin-binding transcription ...    228   1e-65   
ref|XP_003630482.1|  Calmodulin-binding transcription activator         212   2e-65   
ref|XP_007158673.1|  hypothetical protein PHAVU_002G172800g             228   2e-65   Phaseolus vulgaris [French bean]
ref|XP_011020768.1|  PREDICTED: calmodulin-binding transcription ...    226   5e-65   Populus euphratica
ref|XP_010250675.1|  PREDICTED: calmodulin-binding transcription ...    226   7e-65   
ref|XP_010682739.1|  PREDICTED: calmodulin-binding transcription ...    225   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004140640.1|  PREDICTED: calmodulin-binding transcription ...    223   8e-64   Cucumis sativus [cucumbers]
emb|CAN76708.1|  hypothetical protein VITISV_022702                     221   9e-64   Vitis vinifera
ref|XP_010025296.1|  PREDICTED: calmodulin-binding transcription ...    222   1e-63   Eucalyptus grandis [rose gum]
ref|XP_008389876.1|  PREDICTED: calmodulin-binding transcription ...    221   2e-63   Malus domestica [apple tree]
gb|KHN34827.1|  Calmodulin-binding transcription activator 4            221   3e-63   Glycine soja [wild soybean]
ref|XP_008389875.1|  PREDICTED: calmodulin-binding transcription ...    221   3e-63   
ref|XP_009343150.1|  PREDICTED: calmodulin-binding transcription ...    221   4e-63   Pyrus x bretschneideri [bai li]
ref|XP_010556125.1|  PREDICTED: calmodulin-binding transcription ...    220   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_010556124.1|  PREDICTED: calmodulin-binding transcription ...    220   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_002303787.1|  calmodulin-binding family protein                  220   7e-63   
ref|XP_011457493.1|  PREDICTED: calmodulin-binding transcription ...    220   8e-63   Fragaria vesca subsp. vesca
ref|XP_009343149.1|  PREDICTED: calmodulin-binding transcription ...    220   9e-63   
ref|XP_008459844.1|  PREDICTED: calmodulin-binding transcription ...    219   2e-62   Cucumis melo [Oriental melon]
ref|XP_010552446.1|  PREDICTED: calmodulin-binding transcription ...    219   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_006368871.1|  calmodulin-binding family protein                  219   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011036094.1|  PREDICTED: calmodulin-binding transcription ...    218   5e-62   Populus euphratica
ref|XP_010249049.1|  PREDICTED: calmodulin-binding transcription ...    218   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_011086818.1|  PREDICTED: calmodulin-binding transcription ...    217   8e-62   Sesamum indicum [beniseed]
ref|XP_009803069.1|  PREDICTED: calmodulin-binding transcription ...    216   2e-61   Nicotiana sylvestris
ref|XP_004504403.1|  PREDICTED: calmodulin-binding transcription ...    216   2e-61   Cicer arietinum [garbanzo]
ref|XP_004504405.1|  PREDICTED: calmodulin-binding transcription ...    216   2e-61   Cicer arietinum [garbanzo]
ref|XP_004504404.1|  PREDICTED: calmodulin-binding transcription ...    216   2e-61   Cicer arietinum [garbanzo]
gb|KEH20613.1|  calmodulin-binding protein                              216   3e-61   Medicago truncatula
ref|XP_010090639.1|  Calmodulin-binding transcription activator 4       209   1e-58   
ref|XP_009592005.1|  PREDICTED: calmodulin-binding transcription ...    207   2e-58   
ref|NP_176899.2|  calmodulin-binding transcription activator 4          208   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888589.1|  calmodulin binding protein                         207   4e-58   
gb|KHN12381.1|  Calmodulin-binding transcription activator 4            206   6e-58   Glycine soja [wild soybean]
ref|XP_006391294.1|  hypothetical protein EUTSA_v10018053mg             207   8e-58   
ref|XP_006301894.1|  hypothetical protein CARUB_v10022369mg             206   9e-58   
ref|XP_010905494.1|  PREDICTED: calmodulin-binding transcription ...    205   3e-57   Elaeis guineensis
ref|XP_008807442.1|  PREDICTED: calmodulin-binding transcription ...    205   4e-57   Phoenix dactylifera
ref|XP_003552779.1|  PREDICTED: calmodulin-binding transcription ...    204   4e-57   Glycine max [soybeans]
ref|XP_006585128.1|  PREDICTED: calmodulin-binding transcription ...    204   4e-57   
ref|XP_009411793.1|  PREDICTED: calmodulin-binding transcription ...    203   5e-57   
ref|XP_006585127.1|  PREDICTED: calmodulin-binding transcription ...    204   5e-57   Glycine max [soybeans]
ref|XP_006585126.1|  PREDICTED: calmodulin-binding transcription ...    204   5e-57   Glycine max [soybeans]
ref|XP_006585125.1|  PREDICTED: calmodulin-binding transcription ...    204   5e-57   Glycine max [soybeans]
ref|XP_003532724.2|  PREDICTED: calmodulin-binding transcription ...    204   6e-57   Glycine max [soybeans]
gb|EPS61898.1|  hypothetical protein M569_12892                         188   7e-57   Genlisea aurea
emb|CDY12637.1|  BnaA02g13050D                                          204   7e-57   Brassica napus [oilseed rape]
emb|CDY51184.1|  BnaC02g45620D                                          203   1e-56   Brassica napus [oilseed rape]
ref|XP_010449343.1|  PREDICTED: probable WRKY transcription facto...    204   2e-56   
ref|XP_007163775.1|  hypothetical protein PHAVU_001G263000g             202   2e-56   Phaseolus vulgaris [French bean]
ref|XP_010439700.1|  PREDICTED: probable WRKY transcription facto...    203   5e-56   
ref|XP_010470634.1|  PREDICTED: calmodulin-binding transcription ...    200   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010470633.1|  PREDICTED: calmodulin-binding transcription ...    200   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009385485.1|  PREDICTED: calmodulin-binding transcription ...    199   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006591445.1|  PREDICTED: calmodulin-binding transcription ...    199   2e-55   Glycine max [soybeans]
gb|KHN44450.1|  Calmodulin-binding transcription activator 4            199   2e-55   Glycine soja [wild soybean]
gb|EMS56809.1|  Calmodulin-binding transcription activator 1            200   3e-55   Triticum urartu
ref|XP_003537532.1|  PREDICTED: calmodulin-binding transcription ...    199   3e-55   Glycine max [soybeans]
ref|XP_011071238.1|  PREDICTED: calmodulin-binding transcription ...    199   4e-55   Sesamum indicum [beniseed]
gb|EMT24284.1|  Calmodulin-binding transcription activator 4            200   4e-55   
ref|XP_009385487.1|  PREDICTED: calmodulin-binding transcription ...    197   1e-54   
ref|XP_009385484.1|  PREDICTED: calmodulin-binding transcription ...    197   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010439695.1|  PREDICTED: probable WRKY transcription facto...    199   2e-54   
gb|EYU42083.1|  hypothetical protein MIMGU_mgv1a000863mg                197   2e-54   Erythranthe guttata [common monkey flower]
gb|AES72007.2|  calmodulin-binding protein                              197   2e-54   Medicago truncatula
ref|XP_010415302.1|  PREDICTED: calmodulin-binding transcription ...    196   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010415300.1|  PREDICTED: calmodulin-binding transcription ...    196   2e-54   Camelina sativa [gold-of-pleasure]
gb|KFK41134.1|  hypothetical protein AALP_AA2G090200                    197   3e-54   Arabis alpina [alpine rockcress]
gb|KFK41133.1|  hypothetical protein AALP_AA2G090200                    197   3e-54   Arabis alpina [alpine rockcress]
ref|XP_010511652.1|  PREDICTED: calmodulin-binding transcription ...    196   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010511653.1|  PREDICTED: calmodulin-binding transcription ...    196   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009127544.1|  PREDICTED: calmodulin-binding transcription ...    195   8e-54   Brassica rapa
ref|XP_009412761.1|  PREDICTED: calmodulin-binding transcription ...    194   8e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008664138.1|  PREDICTED: calmodulin-binding transcription ...    194   9e-54   
ref|XP_009412760.1|  PREDICTED: calmodulin-binding transcription ...    194   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412758.1|  PREDICTED: calmodulin-binding transcription ...    194   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010239809.1|  PREDICTED: calmodulin-binding transcription ...    195   2e-53   Brachypodium distachyon [annual false brome]
gb|EEC77173.1|  hypothetical protein OsI_15659                          193   2e-53   Oryza sativa Indica Group [Indian rice]
emb|CAE05533.2|  OSJNBa0053B21.7                                        194   3e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66427.1|  OSIGBa0096P03.1                                        193   3e-53   Oryza sativa [red rice]
gb|EEE60893.1|  hypothetical protein OsJ_14576                          193   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052630.1|  Os04g0388500                                       194   4e-53   
gb|KEH35249.1|  calmodulin-binding protein                              193   4e-53   Medicago truncatula
ref|XP_009415886.1|  PREDICTED: calmodulin-binding transcription ...    194   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004502279.1|  PREDICTED: calmodulin-binding transcription ...    193   5e-53   
ref|XP_004975407.1|  PREDICTED: calmodulin-binding transcription ...    193   6e-53   Setaria italica
ref|XP_006652212.1|  PREDICTED: calmodulin-binding transcription ...    193   6e-53   Oryza brachyantha
ref|XP_008667152.1|  PREDICTED: uncharacterized protein LOC100193...    192   1e-52   
ref|XP_003601756.1|  Calmodulin-binding transcription activator         192   1e-52   
ref|XP_010239810.1|  PREDICTED: calmodulin-binding transcription ...    192   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_009385632.1|  PREDICTED: calmodulin-binding transcription ...    179   2e-52   
ref|XP_008806417.1|  PREDICTED: calmodulin-binding transcription ...    192   2e-52   Phoenix dactylifera
ref|XP_009412759.1|  PREDICTED: calmodulin-binding transcription ...    189   9e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909839.1|  PREDICTED: calmodulin-binding transcription ...    188   2e-51   Elaeis guineensis
ref|XP_010909837.1|  PREDICTED: calmodulin-binding transcription ...    188   2e-51   
ref|XP_010909834.1|  PREDICTED: calmodulin-binding transcription ...    188   3e-51   Elaeis guineensis
ref|XP_009105274.1|  PREDICTED: calmodulin-binding transcription ...    188   3e-51   Brassica rapa
ref|XP_009105273.1|  PREDICTED: calmodulin-binding transcription ...    188   3e-51   Brassica rapa
ref|XP_009105129.1|  PREDICTED: calmodulin-binding transcription ...    188   4e-51   Brassica rapa
emb|CDY28897.1|  BnaC06g26850D                                          187   5e-51   Brassica napus [oilseed rape]
emb|CDY01799.1|  BnaC06g28390D                                          187   6e-51   
dbj|BAK00552.1|  predicted protein                                      188   6e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY07431.1|  BnaA07g25100D                                          187   8e-51   Brassica napus [oilseed rape]
ref|XP_008790758.1|  PREDICTED: calmodulin-binding transcription ...    186   1e-50   Phoenix dactylifera
ref|XP_008790759.1|  PREDICTED: calmodulin-binding transcription ...    186   1e-50   
ref|XP_004971097.1|  PREDICTED: calmodulin-binding transcription ...    184   3e-50   Setaria italica
dbj|BAJ96413.1|  predicted protein                                      182   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009386381.1|  PREDICTED: calmodulin-binding transcription ...    173   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386379.1|  PREDICTED: calmodulin-binding transcription ...    173   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008673284.1|  PREDICTED: uncharacterized protein LOC100384...    182   1e-49   
ref|XP_010926833.1|  PREDICTED: calmodulin-binding transcription ...    183   2e-49   Elaeis guineensis
ref|XP_002972386.1|  hypothetical protein SELMODRAFT_413101             182   3e-49   Selaginella moellendorffii
ref|XP_002971863.1|  hypothetical protein SELMODRAFT_441667             182   3e-49   Selaginella moellendorffii
ref|XP_010449346.1|  PREDICTED: probable WRKY transcription facto...    183   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010926832.1|  PREDICTED: calmodulin-binding transcription ...    180   2e-48   Elaeis guineensis
ref|XP_004155502.1|  PREDICTED: calmodulin-binding transcription ...    170   2e-48   
ref|XP_004985394.1|  PREDICTED: calmodulin-binding transcription ...    180   2e-48   
ref|XP_002456865.1|  hypothetical protein SORBIDRAFT_03g044220          179   2e-48   Sorghum bicolor [broomcorn]
ref|XP_010547650.1|  PREDICTED: calmodulin-binding transcription ...    180   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_009409289.1|  PREDICTED: calmodulin-binding transcription ...    169   4e-48   
emb|CDX96099.1|  BnaA07g26320D                                          180   4e-48   
ref|XP_009409306.1|  PREDICTED: calmodulin-binding transcription ...    169   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782146.1|  PREDICTED: calmodulin-binding transcription ...    179   5e-48   
ref|XP_008782144.1|  PREDICTED: calmodulin-binding transcription ...    179   5e-48   
ref|XP_010680539.1|  PREDICTED: calmodulin-binding transcription ...    179   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011097567.1|  PREDICTED: calmodulin-binding transcription ...    179   1e-47   Sesamum indicum [beniseed]
ref|XP_004983220.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-47   
ref|XP_010319684.1|  PREDICTED: ER66 protein isoform X1                 178   2e-47   Solanum lycopersicum
ref|NP_001266168.1|  ER66 protein                                       178   2e-47   
gb|EPS74412.1|  calmodulin-binding protein                              163   2e-47   Genlisea aurea
gb|EMT32010.1|  Calmodulin-binding transcription activator 3            177   2e-47   
ref|XP_004504801.1|  PREDICTED: calmodulin-binding transcription ...    177   3e-47   Cicer arietinum [garbanzo]
ref|XP_009763882.1|  PREDICTED: calmodulin-binding transcription ...    177   3e-47   Nicotiana sylvestris
ref|XP_009763883.1|  PREDICTED: calmodulin-binding transcription ...    177   3e-47   Nicotiana sylvestris
ref|XP_009613617.1|  PREDICTED: calmodulin-binding transcription ...    177   3e-47   
ref|XP_009613616.1|  PREDICTED: calmodulin-binding transcription ...    177   4e-47   Nicotiana tomentosiformis
ref|XP_009613615.1|  PREDICTED: calmodulin-binding transcription ...    177   4e-47   Nicotiana tomentosiformis
ref|XP_006649535.1|  PREDICTED: calmodulin-binding transcription ...    177   5e-47   Oryza brachyantha
ref|XP_006355338.1|  PREDICTED: calmodulin-binding transcription ...    177   5e-47   Solanum tuberosum [potatoes]
ref|XP_010926296.1|  PREDICTED: calmodulin-binding transcription ...    176   6e-47   
ref|XP_010520931.1|  PREDICTED: calmodulin-binding transcription ...    176   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_004137052.1|  PREDICTED: calmodulin-binding transcription ...    176   6e-47   
ref|XP_004985392.1|  PREDICTED: calmodulin-binding transcription ...    176   6e-47   Setaria italica
gb|KJB32054.1|  hypothetical protein B456_005G220600                    175   6e-47   Gossypium raimondii
ref|XP_004985393.1|  PREDICTED: calmodulin-binding transcription ...    176   6e-47   Setaria italica
ref|XP_006853146.1|  hypothetical protein AMTR_s00038p00173360          176   7e-47   
ref|XP_010926291.1|  PREDICTED: calmodulin-binding transcription ...    176   7e-47   Elaeis guineensis
ref|XP_010926295.1|  PREDICTED: calmodulin-binding transcription ...    176   8e-47   
ref|XP_006492475.1|  PREDICTED: uncharacterized protein LOC102620...    166   9e-47   Citrus sinensis [apfelsine]
ref|XP_008651919.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Zea mays [maize]
ref|XP_008651911.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Zea mays [maize]
ref|XP_010030018.1|  PREDICTED: calmodulin-binding transcription ...    175   1e-46   Eucalyptus grandis [rose gum]
ref|XP_008455206.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Cucumis melo [Oriental melon]
ref|XP_010269272.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010269269.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   
ref|XP_008455205.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Cucumis melo [Oriental melon]
ref|XP_008455204.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   Cucumis melo [Oriental melon]
ref|XP_010099702.1|  Calmodulin-binding transcription activator 3       175   1e-46   
gb|EPS65935.1|  calmodulin-binding transcription activator 2            164   1e-46   Genlisea aurea
gb|KGN43718.1|  hypothetical protein Csa_7G062840                       176   1e-46   Cucumis sativus [cucumbers]
ref|XP_006662301.1|  PREDICTED: calmodulin-binding transcription ...    175   1e-46   Oryza brachyantha
ref|XP_008338581.1|  PREDICTED: calmodulin-binding transcription ...    176   1e-46   
emb|CDY18719.1|  BnaA09g06760D                                          175   1e-46   Brassica napus [oilseed rape]
ref|XP_009338097.1|  PREDICTED: calmodulin-binding transcription ...    175   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_003558617.1|  PREDICTED: calmodulin-binding transcription ...    175   1e-46   Brachypodium distachyon [annual false brome]
gb|EEE58472.1|  hypothetical protein OsJ_09725                          174   1e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AAM08530.1|AC079935_2  Putative calmodulin-binding protein sim...    175   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232758.1|  PREDICTED: calmodulin-binding transcription ...    173   2e-46   Brachypodium distachyon [annual false brome]
gb|EEC74662.1|  hypothetical protein OsI_10332                          175   2e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_003564956.1|  PREDICTED: calmodulin-binding transcription ...    174   2e-46   Brachypodium distachyon [annual false brome]
gb|EEE50856.1|  hypothetical protein OsJ_31300                          175   2e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52514.1|  Calmodulin-binding transcription activator 2            176   2e-46   Triticum urartu
ref|NP_001049230.1|  Os03g0191000                                       175   2e-46   
ref|XP_010030039.1|  PREDICTED: calmodulin-binding transcription ...    175   2e-46   Eucalyptus grandis [rose gum]
gb|ABF94398.1|  anther ethylene-upregulated protein ER1, putative...    175   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064470.1|  Os10g0375600                                       175   2e-46   
ref|XP_010267832.1|  PREDICTED: calmodulin-binding transcription ...    175   2e-46   
ref|XP_009404047.1|  PREDICTED: calmodulin-binding transcription ...    174   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404048.1|  PREDICTED: calmodulin-binding transcription ...    174   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC79907.1|  putative anther ethylene-upregulated protein ER1       174   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67615.1|  hypothetical protein OsJ_25176                          174   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465719.1|  hypothetical protein SORBIDRAFT_01g044480          174   3e-46   
ref|XP_008373189.1|  PREDICTED: calmodulin-binding transcription ...    174   3e-46   Malus domestica [apple tree]
gb|KJB79656.1|  hypothetical protein B456_013G061100                    172   4e-46   Gossypium raimondii
ref|XP_008795548.1|  PREDICTED: calmodulin-binding transcription ...    174   4e-46   Phoenix dactylifera
ref|XP_008795547.1|  PREDICTED: calmodulin-binding transcription ...    174   4e-46   Phoenix dactylifera
ref|NP_001045240.1|  Os01g0923600                                       173   5e-46   
gb|EEC72061.1|  hypothetical protein OsI_04984                          173   5e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009140343.1|  PREDICTED: calmodulin-binding transcription ...    173   6e-46   Brassica rapa
ref|XP_008653354.1|  PREDICTED: calmodulin-binding transcription ...    173   6e-46   Zea mays [maize]
ref|XP_008653355.1|  PREDICTED: calmodulin-binding transcription ...    173   7e-46   Zea mays [maize]
ref|XP_008653356.1|  PREDICTED: calmodulin-binding transcription ...    173   7e-46   Zea mays [maize]
ref|XP_008448831.1|  PREDICTED: calmodulin-binding transcription ...    173   8e-46   
gb|KGN54335.1|  hypothetical protein Csa_4G304810                       173   8e-46   Cucumis sativus [cucumbers]
ref|XP_004147929.1|  PREDICTED: calmodulin-binding transcription ...    172   8e-46   
ref|XP_007159108.1|  hypothetical protein PHAVU_002G209300g             173   8e-46   Phaseolus vulgaris [French bean]
emb|CDY25585.1|  BnaA04g12770D                                          173   8e-46   Brassica napus [oilseed rape]
ref|XP_008448822.1|  PREDICTED: calmodulin-binding transcription ...    172   9e-46   Cucumis melo [Oriental melon]
emb|CDO97448.1|  unnamed protein product                                173   9e-46   Coffea canephora [robusta coffee]
ref|XP_008448813.1|  PREDICTED: calmodulin-binding transcription ...    172   9e-46   Cucumis melo [Oriental melon]
ref|XP_004958361.1|  PREDICTED: calmodulin-binding transcription ...    173   1e-45   
gb|KJB32052.1|  hypothetical protein B456_005G220600                    173   1e-45   Gossypium raimondii
tpg|DAA38156.1|  TPA: hypothetical protein ZEAMMB73_559848              167   1e-45   
gb|KJB32053.1|  hypothetical protein B456_005G220600                    173   1e-45   Gossypium raimondii
gb|EEC66837.1|  hypothetical protein OsI_33300                          172   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_004504800.1|  PREDICTED: calmodulin-binding transcription ...    172   1e-45   Cicer arietinum [garbanzo]
gb|KJB32055.1|  hypothetical protein B456_005G220600                    172   1e-45   Gossypium raimondii
ref|XP_004958362.1|  PREDICTED: calmodulin-binding transcription ...    172   1e-45   Setaria italica
ref|XP_004157104.1|  PREDICTED: calmodulin-binding transcription ...    172   1e-45   
gb|KJB79657.1|  hypothetical protein B456_013G061100                    172   1e-45   Gossypium raimondii
ref|XP_002463205.1|  hypothetical protein SORBIDRAFT_02g039710          172   1e-45   
ref|XP_006579985.1|  PREDICTED: calmodulin-binding transcription ...    172   1e-45   Glycine max [soybeans]
gb|KJB79658.1|  hypothetical protein B456_013G061100                    172   1e-45   Gossypium raimondii
dbj|BAB09853.1|  ER66 protein-like                                      172   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916876.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Elaeis guineensis
ref|XP_010484193.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006404686.1|  hypothetical protein EUTSA_v10000026mg             172   2e-45   
ref|XP_006404687.1|  hypothetical protein EUTSA_v10000026mg             172   2e-45   
ref|XP_010484192.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_003571742.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_010234691.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Brachypodium distachyon [annual false brome]
ref|NP_201227.3|  calmodulin-binding transcription activator 2          172   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461530.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   
ref|XP_010444354.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010444353.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   
ref|XP_009393546.1|  PREDICTED: calmodulin-binding transcription ...    158   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82474.1|  hypothetical protein OsI_26919                          171   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_002864887.1|  calmodulin-binding protein                         172   2e-45   
ref|XP_010461536.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010461523.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010444352.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Camelina sativa [gold-of-pleasure]
gb|EMT16107.1|  Calmodulin-binding transcription activator 2            172   2e-45   
ref|XP_006279929.1|  hypothetical protein CARUB_v10025787mg             172   2e-45   Capsella rubella
ref|XP_004984162.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Setaria italica
ref|XP_002446301.1|  hypothetical protein SORBIDRAFT_06g013850          157   2e-45   
ref|XP_004984163.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Setaria italica
ref|XP_010235561.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_008644877.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   
ref|XP_008644876.1|  PREDICTED: calmodulin-binding transcription ...    172   2e-45   
ref|XP_008660102.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_008660083.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_008660096.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_008660088.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_008237378.1|  PREDICTED: calmodulin-binding transcription ...    172   3e-45   
ref|XP_009344575.1|  PREDICTED: calmodulin-binding transcription ...    172   3e-45   
gb|KDO56555.1|  hypothetical protein CISIN_1g001365mg                   169   3e-45   
ref|XP_010546341.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_010452931.1|  PREDICTED: calmodulin-binding transcription ...    171   3e-45   
ref|XP_004300026.1|  PREDICTED: calmodulin-binding transcription ...    171   4e-45   
ref|XP_002307083.2|  hypothetical protein POPTR_0005s07660g             171   4e-45   
ref|XP_011464948.1|  PREDICTED: calmodulin-binding transcription ...    171   4e-45   
ref|XP_006399418.1|  hypothetical protein EUTSA_v10012552mg             171   4e-45   
ref|XP_002489212.1|  hypothetical protein SORBIDRAFT_0012s010230        171   4e-45   
ref|XP_011031016.1|  PREDICTED: calmodulin-binding transcription ...    171   4e-45   
ref|XP_011031017.1|  PREDICTED: calmodulin-binding transcription ...    171   4e-45   
emb|CDX89451.1|  BnaC04g34700D                                          171   5e-45   
ref|XP_010422987.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
ref|XP_009793082.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
gb|KDO56554.1|  hypothetical protein CISIN_1g001365mg                   169   5e-45   
ref|XP_009391528.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
ref|XP_008660007.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
ref|XP_008660006.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
ref|XP_009391526.1|  PREDICTED: calmodulin-binding transcription ...    171   5e-45   
ref|XP_009391527.1|  PREDICTED: calmodulin-binding transcription ...    171   6e-45   
ref|XP_010938165.1|  PREDICTED: calmodulin-binding transcription ...    171   6e-45   
ref|XP_004485582.1|  PREDICTED: calmodulin-binding transcription ...    171   6e-45   
ref|XP_010025463.1|  PREDICTED: calmodulin-binding transcription ...    171   6e-45   
gb|KDO56553.1|  hypothetical protein CISIN_1g001365mg                   170   7e-45   
ref|XP_008358353.1|  PREDICTED: calmodulin-binding transcription ...    171   7e-45   
ref|XP_002467764.1|  hypothetical protein SORBIDRAFT_01g033650          170   7e-45   
ref|XP_010921342.1|  PREDICTED: calmodulin-binding transcription ...    171   7e-45   
ref|XP_010025464.1|  PREDICTED: calmodulin-binding transcription ...    170   7e-45   
gb|KDO56550.1|  hypothetical protein CISIN_1g001365mg                   171   7e-45   
ref|XP_010690492.1|  PREDICTED: calmodulin-binding transcription ...    170   7e-45   
ref|XP_007042961.1|  Calmodulin-binding transcription activator p...    170   7e-45   
ref|XP_010690491.1|  PREDICTED: calmodulin-binding transcription ...    170   7e-45   
emb|CDX81217.1|  BnaC09g06280D                                          170   8e-45   
ref|XP_002316071.2|  hypothetical protein POPTR_0010s16290g             170   8e-45   
gb|EMS58638.1|  Calmodulin-binding transcription activator 2            171   8e-45   
ref|XP_009112123.1|  PREDICTED: calmodulin-binding transcription ...    170   8e-45   
ref|XP_006428203.1|  hypothetical protein CICLE_v10024764mg             170   9e-45   
ref|XP_009337876.1|  PREDICTED: calmodulin-binding transcription ...    170   9e-45   
ref|XP_009337877.1|  PREDICTED: calmodulin-binding transcription ...    170   9e-45   
ref|XP_006428204.1|  hypothetical protein CICLE_v10024764mg             170   9e-45   
ref|XP_007042960.1|  Calmodulin-binding transcription activator p...    170   1e-44   
ref|XP_001775223.1|  predicted protein                                  169   1e-44   
gb|KDO56551.1|  hypothetical protein CISIN_1g001365mg                   170   1e-44   
ref|XP_006286969.1|  hypothetical protein CARUB_v10000120mg             170   1e-44   
ref|XP_004983218.1|  PREDICTED: calmodulin-binding transcription ...    170   1e-44   
ref|XP_004983217.1|  PREDICTED: calmodulin-binding transcription ...    170   1e-44   
emb|CDY13771.1|  BnaA09g42730D                                          169   1e-44   
ref|XP_010938166.1|  PREDICTED: calmodulin-binding transcription ...    170   1e-44   
ref|XP_006645250.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_011011458.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_009112533.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_009112535.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_011011473.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_011011482.1|  PREDICTED: calmodulin-binding transcription ...    169   1e-44   
ref|XP_006286970.1|  hypothetical protein CARUB_v10000120mg             169   1e-44   
emb|CDX76935.1|  BnaC08g35210D                                          169   1e-44   
gb|EAY90285.1|  hypothetical protein OsI_11859                          169   2e-44   
gb|KDP46823.1|  hypothetical protein JCGZ_24032                         169   2e-44   
gb|AAR06369.1|  putative calmodulin-binding transcription factor        169   2e-44   
ref|XP_008223475.1|  PREDICTED: calmodulin-binding transcription ...    169   2e-44   
ref|XP_004504802.1|  PREDICTED: calmodulin-binding transcription ...    169   2e-44   
ref|XP_002871369.1|  calmodulin-binding transcription activator 1       169   2e-44   
gb|KJB72930.1|  hypothetical protein B456_011G204700                    167   2e-44   
gb|KDP27989.1|  hypothetical protein JCGZ_19069                         169   2e-44   
gb|AFW68880.1|  hypothetical protein ZEAMMB73_840699                    156   2e-44   
gb|KEH20833.1|  calmodulin-binding transcription activator              169   2e-44   
ref|XP_010491568.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
gb|KDO72133.1|  hypothetical protein CISIN_1g001759mg                   166   3e-44   
ref|XP_004288193.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
ref|XP_008793313.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
ref|XP_004485583.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
ref|XP_010491567.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
ref|XP_009372048.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
ref|XP_010452930.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
gb|KDO72132.1|  hypothetical protein CISIN_1g001759mg                   166   3e-44   
ref|XP_010645223.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
gb|KEH20830.1|  calmodulin-binding transcription activator              169   3e-44   
gb|KHN39228.1|  Calmodulin-binding transcription activator 2            169   3e-44   
ref|XP_003532616.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
gb|KJB48843.1|  hypothetical protein B456_008G089900                    169   3e-44   
ref|XP_006650150.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-b...    168   3e-44   
ref|XP_006580273.1|  PREDICTED: calmodulin-binding transcription ...    169   3e-44   
gb|KEH20827.1|  calmodulin-binding transcription activator              169   3e-44   
gb|KHN06577.1|  Calmodulin-binding transcription activator 2            169   4e-44   
ref|XP_010452929.1|  PREDICTED: calmodulin-binding transcription ...    168   4e-44   
ref|XP_003524262.1|  PREDICTED: calmodulin-binding transcription ...    169   4e-44   
gb|KHG17312.1|  Calmodulin-binding transcription activator 3 -lik...    168   4e-44   
ref|XP_010491569.1|  PREDICTED: calmodulin-binding transcription ...    168   4e-44   
ref|XP_002310562.2|  ethylene-responsive calmodulin-binding famil...    168   4e-44   
ref|XP_006380414.1|  hypothetical protein POPTR_0007s05410g             168   4e-44   
gb|KFK32838.1|  hypothetical protein AALP_AA6G293500                    168   5e-44   
gb|KEH20829.1|  calmodulin-binding transcription activator              168   5e-44   
gb|KFK32837.1|  hypothetical protein AALP_AA6G293500                    168   5e-44   
ref|XP_010422986.1|  PREDICTED: calmodulin-binding transcription ...    168   5e-44   
gb|KHG21796.1|  Calmodulin-binding transcription activator 1 -lik...    167   5e-44   
ref|XP_011022800.1|  PREDICTED: calmodulin-binding transcription ...    168   5e-44   
ref|XP_011022796.1|  PREDICTED: calmodulin-binding transcription ...    168   5e-44   
gb|KEH20828.1|  calmodulin-binding transcription activator              168   5e-44   
ref|NP_196503.3|  calmodulin-binding transcription activator 1          167   6e-44   
ref|NP_001119195.1|  calmodulin-binding transcription activator 1       167   6e-44   
emb|CAC05467.1|  putative protein                                       167   7e-44   
ref|XP_010270930.1|  PREDICTED: calmodulin-binding transcription ...    167   7e-44   
ref|XP_009349220.1|  PREDICTED: calmodulin-binding transcription ...    167   8e-44   
gb|KDO72127.1|  hypothetical protein CISIN_1g001759mg                   167   8e-44   
ref|XP_006488762.1|  PREDICTED: calmodulin-binding transcription ...    167   8e-44   
ref|XP_007148412.1|  hypothetical protein PHAVU_006G206400g             167   8e-44   
ref|XP_006394184.1|  hypothetical protein EUTSA_v10003564mg             167   8e-44   
ref|XP_006419272.1|  hypothetical protein CICLE_v10004234mg             167   8e-44   
ref|XP_002274846.1|  PREDICTED: calmodulin-binding transcription ...    167   1e-43   
gb|KDO72128.1|  hypothetical protein CISIN_1g001759mg                   167   1e-43   
ref|XP_006487646.1|  PREDICTED: calmodulin-binding transcription ...    167   1e-43   
ref|XP_006487645.1|  PREDICTED: calmodulin-binding transcription ...    167   1e-43   
ref|XP_007047946.1|  Calmodulin-binding transcription activator p...    167   1e-43   
gb|KDP27353.1|  hypothetical protein JCGZ_20177                         167   1e-43   
ref|XP_008234047.1|  PREDICTED: calmodulin-binding transcription ...    167   1e-43   
ref|XP_007047945.1|  Calmodulin-binding transcription activator p...    167   1e-43   
ref|XP_006487647.1|  PREDICTED: calmodulin-binding transcription ...    167   1e-43   
ref|XP_009342523.1|  PREDICTED: calmodulin-binding transcription ...    167   2e-43   
ref|XP_006585273.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
gb|KFK28113.1|  hypothetical protein AALP_AA8G474400                    166   2e-43   
ref|XP_010087599.1|  Calmodulin-binding transcription activator 3       166   2e-43   
ref|XP_010228546.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
ref|XP_006585272.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
ref|XP_010555365.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
ref|XP_003547081.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
ref|XP_010228547.1|  PREDICTED: calmodulin-binding transcription ...    166   2e-43   
ref|XP_006585447.1|  PREDICTED: calmodulin-binding transcription ...    166   3e-43   
ref|XP_006840280.1|  hypothetical protein AMTR_s00045p00052450          166   3e-43   
gb|KHN29055.1|  Calmodulin-binding transcription activator 2            166   3e-43   
gb|KHN26747.1|  Calmodulin-binding transcription activator 2            166   3e-43   
ref|XP_004504077.1|  PREDICTED: calmodulin-binding transcription ...    166   3e-43   
ref|NP_850023.1|  calmodulin-binding transcription activator 3          166   3e-43   
dbj|BAE98628.1|  Calmodulin-binding transcription activator 3           166   3e-43   
ref|XP_010416993.1|  PREDICTED: calmodulin-binding transcription ...    166   3e-43   
ref|XP_002878608.1|  hypothetical protein ARALYDRAFT_481093             166   3e-43   
ref|XP_006295625.1|  hypothetical protein CARUB_v10024738mg             166   3e-43   
ref|XP_009122514.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-b...    166   4e-43   
ref|XP_010472220.1|  PREDICTED: calmodulin-binding transcription ...    166   4e-43   
emb|CDX69907.1|  BnaA10g22560D                                          165   4e-43   
ref|XP_010429151.1|  PREDICTED: calmodulin-binding transcription ...    166   4e-43   
ref|XP_003550574.1|  PREDICTED: calmodulin-binding transcription ...    165   5e-43   
ref|XP_011092424.1|  PREDICTED: calmodulin-binding transcription ...    165   5e-43   
gb|AES63450.2|  calmodulin-binding transcription activator 1            164   5e-43   
ref|XP_006600399.1|  PREDICTED: calmodulin-binding transcription ...    165   5e-43   
gb|KHN03245.1|  Calmodulin-binding transcription activator 1            165   5e-43   
emb|CDY21580.1|  BnaC09g47120D                                          165   6e-43   
ref|XP_007159660.1|  hypothetical protein PHAVU_002G256500g             165   8e-43   
ref|XP_002531267.1|  calmodulin-binding transcription activator (...    152   1e-42   
ref|XP_007035948.1|  Calmodulin-binding transcription activator p...    164   1e-42   
ref|XP_002519300.1|  calmodulin-binding transcription activator (...    164   1e-42   
gb|AES63449.2|  calmodulin-binding transcription activator 1            164   2e-42   
ref|XP_009600620.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_009600619.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_009600618.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_009600617.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_007154445.1|  hypothetical protein PHAVU_003G119800g             163   3e-42   
ref|XP_006351779.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_006351778.1|  PREDICTED: calmodulin-binding transcription ...    163   3e-42   
ref|XP_006351777.1|  PREDICTED: calmodulin-binding transcription ...    162   4e-42   
ref|XP_006351776.1|  PREDICTED: calmodulin-binding transcription ...    162   4e-42   
ref|XP_009798949.1|  PREDICTED: calmodulin-binding transcription ...    162   5e-42   
ref|XP_009798950.1|  PREDICTED: calmodulin-binding transcription ...    162   5e-42   
ref|XP_009798948.1|  PREDICTED: calmodulin-binding transcription ...    162   6e-42   
ref|XP_009798947.1|  PREDICTED: calmodulin-binding transcription ...    162   6e-42   
gb|KJB72934.1|  hypothetical protein B456_011G204700                    161   6e-42   
gb|KJB72931.1|  hypothetical protein B456_011G204700                    162   6e-42   
gb|KJB72929.1|  hypothetical protein B456_011G204700                    162   6e-42   
ref|XP_010315110.1|  PREDICTED: calmodulin-binding transcription ...    162   6e-42   
gb|KJB72933.1|  hypothetical protein B456_011G204700                    162   6e-42   
gb|KJB72932.1|  hypothetical protein B456_011G204700                    162   7e-42   
ref|XP_010315109.1|  PREDICTED: calmodulin-binding transcription ...    162   7e-42   
ref|XP_004230530.1|  PREDICTED: calmodulin-binding transcription ...    162   9e-42   
ref|XP_010315108.1|  PREDICTED: calmodulin-binding transcription ...    162   9e-42   
gb|AEX31181.1|  calmodulin-binding transcription factor SR1L            161   9e-42   
gb|KHN42746.1|  Calmodulin-binding transcription activator 2            160   3e-41   
gb|AAM10969.1|  calmodulin-binding transcription activator              159   4e-41   
emb|CDM85788.1|  unnamed protein product                                158   5e-41   
gb|KEH31217.1|  calmodulin-binding transcription activator 1            159   8e-41   
gb|KEH31218.1|  calmodulin-binding transcription activator 1            159   8e-41   
gb|KEH31219.1|  calmodulin-binding transcription activator 1            159   8e-41   
gb|AGM20577.1|  calmodulin-binding transcription activator 4            157   1e-40   
ref|NP_001190267.1|  calmodulin-binding transcription activator 1       158   1e-40   
ref|XP_003593199.1|  Calmodulin-binding transcription activator         156   6e-40   
ref|XP_004504078.1|  PREDICTED: calmodulin-binding transcription ...    155   1e-39   
ref|XP_003593198.1|  Calmodulin-binding transcription activator         155   2e-39   
ref|XP_005850100.1|  hypothetical protein CHLNCDRAFT_142166             149   8e-38   
dbj|BAK05267.1|  predicted protein                                      149   9e-38   
ref|XP_006658566.1|  PREDICTED: calmodulin-binding transcription ...    149   1e-37   
dbj|BAK06642.1|  predicted protein                                      149   2e-37   
ref|XP_006645251.1|  PREDICTED: calmodulin-binding transcription ...    148   2e-37   
ref|XP_004957726.1|  PREDICTED: calmodulin-binding transcription ...    148   3e-37   
ref|XP_004957727.1|  PREDICTED: calmodulin-binding transcription ...    148   3e-37   
gb|AAQ07306.1|  CaM-binding transcription factor                        147   1e-36   
ref|NP_001059672.1|  Os07g0490200                                       146   1e-36   
ref|XP_002968127.1|  hypothetical protein SELMODRAFT_440304             146   2e-36   
emb|CAN70716.1|  hypothetical protein VITISV_004702                     142   2e-36   
ref|XP_006337966.1|  PREDICTED: calmodulin-binding transcription ...    146   2e-36   
gb|AES65041.2|  calmodulin-binding transcription activator              146   2e-36   
ref|XP_011465502.1|  PREDICTED: calmodulin-binding transcription ...    145   2e-36   
ref|XP_002462876.1|  hypothetical protein SORBIDRAFT_02g033620          145   2e-36   
gb|EMT25503.1|  Calmodulin-binding transcription activator 4            145   3e-36   
ref|XP_008375752.1|  PREDICTED: uncharacterized protein LOC103438987    142   3e-36   
ref|XP_003547365.1|  PREDICTED: calmodulin-binding transcription ...    145   4e-36   
ref|XP_008651815.1|  PREDICTED: uncharacterized protein LOC100502...    145   5e-36   
gb|KHN12898.1|  Calmodulin-binding transcription activator 5            144   7e-36   
ref|XP_006586900.1|  PREDICTED: calmodulin-binding transcription ...    144   7e-36   
ref|XP_010318684.1|  PREDICTED: calmodulin-binding transcription ...    144   8e-36   
ref|XP_005646337.1|  CG-1-domain-containing protein                     139   8e-36   
ref|XP_003563086.1|  PREDICTED: calmodulin-binding transcription ...    144   9e-36   
ref|XP_002970364.1|  hypothetical protein SELMODRAFT_441201             144   1e-35   
ref|XP_008223309.1|  PREDICTED: calmodulin-binding transcription ...    143   2e-35   
ref|XP_008223308.1|  PREDICTED: calmodulin-binding transcription ...    143   2e-35   
ref|XP_002272118.2|  PREDICTED: calmodulin-binding transcription ...    143   2e-35   
ref|XP_006337967.1|  PREDICTED: calmodulin-binding transcription ...    143   2e-35   



>emb|CDP13355.1| unnamed protein product [Coffea canephora]
Length=976

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+++GYN +DL+REAQ RWLKPAEVLFILQNHEN  I ++PPQKPGSGSLFLFNKRVLRF
Sbjct  1    MSQSGYNLNDLVREAQSRWLKPAEVLFILQNHENQMITNQPPQKPGSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWRRKRDGRTVGEAHERLKVG+ EALNCYYAHGEQNPNFQRRSYWML+PAYEHI
Sbjct  61   FRKDGHSWRRKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPNFQRRSYWMLNPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006352172.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Solanum tuberosum]
Length=962

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GY+ +DL+REAQ RWLKPAEVLFIL+NHENHQ++ EP QKP SGSLFLFNKRVLRF
Sbjct  1    MAESGYDINDLVREAQIRWLKPAEVLFILRNHENHQLSSEPSQKPPSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAY+HI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_009781562.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Nicotiana sylvestris]
Length=936

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GY+ +DL+REAQ RWLKPAEVLFIL+NHE+HQ+++EP QKP SGSLFLFNKRVLRF
Sbjct  1    MAESGYDINDLVREAQIRWLKPAEVLFILRNHEHHQLSNEPAQKPPSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDP YEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPVYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_009781561.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nicotiana sylvestris]
Length=964

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GY+ +DL+REAQ RWLKPAEVLFIL+NHE+HQ+++EP QKP SGSLFLFNKRVLRF
Sbjct  1    MAESGYDINDLVREAQIRWLKPAEVLFILRNHEHHQLSNEPAQKPPSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDP YEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPVYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_009617256.1| PREDICTED: calmodulin-binding transcription activator 4 [Nicotiana 
tomentosiformis]
Length=964

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GY+ +DL+REAQ RWLKPAEVLFIL+NHENHQ+++E  QKP SGSLFLFNKRVLRF
Sbjct  1    MAESGYDINDLVREAQIRWLKPAEVLFILRNHENHQLSNEAAQKPPSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGEQNP FQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEQNPTFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|NP_001266135.1| calmodulin-binding transcription factor SR2L [Solanum lycopersicum]
 gb|AEX07775.1| calmodulin-binding transcription factor SR2L [Solanum lycopersicum]
Length=950

 Score =   240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GY+ +DL+REAQ RWLKPAEVLFIL+NHENHQ++ EP QKP SGSLFL+NKRVLRF
Sbjct  1    MAESGYDINDLVREAQIRWLKPAEVLFILRNHENHQLSSEPSQKPPSGSLFLYNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGEQNP+FQRRSYWMLDPAY+HI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEQNPSFQRRSYWMLDPAYDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010314154.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X4 [Solanum lycopersicum]
Length=976

 Score =   239 bits (611),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_009803068.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nicotiana sylvestris]
Length=1015

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  228  IFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLF  407
            I L    M E+GYN ++L+RE + RWL+PAEVLFILQNHE+ Q+A++PPQKP SGS+FLF
Sbjct  51   ILLLRISMAESGYNINNLVREGRFRWLRPAEVLFILQNHEDQQLANQPPQKPASGSMFLF  110

Query  408  NKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWML  587
            NKRVLR+FRKDGHSWR+K+DGRTVGEAHERLKVG+AE LNCYYAHGE+NPNFQRRSYWML
Sbjct  111  NKRVLRYFRKDGHSWRKKKDGRTVGEAHERLKVGNAETLNCYYAHGEKNPNFQRRSYWML  170

Query  588  DPAYEHIVLVHYR  626
            DPAYEHIVLVHYR
Sbjct  171  DPAYEHIVLVHYR  183



>ref|XP_010314152.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X2 [Solanum lycopersicum]
Length=1017

 Score =   239 bits (611),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010314150.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010314151.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X1 [Solanum lycopersicum]
Length=1020

 Score =   239 bits (611),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010314153.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X3 [Solanum lycopersicum]
Length=1016

 Score =   239 bits (610),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|NP_001266130.1| calmodulin-binding transcription factor SR2 [Solanum lycopersicum]
 gb|AEX07774.1| calmodulin-binding transcription factor SR2 [Solanum lycopersicum]
Length=906

 Score =   239 bits (609),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_009592004.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Nicotiana tomentosiformis]
Length=965

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL+RE   RWL+PAEV+FILQNHE+ Q+A++PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNINDLVREGHFRWLRPAEVVFILQNHEDQQLANQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+NPNFQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|KHG11198.1| Calmodulin-binding transcription activator 4 -like protein [Gossypium 
arboreum]
Length=986

 Score =   238 bits (608),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ ++L REAQ RWLKPAEVLFILQNHE +Q+  EPP KP SGSLFLFNKRVLRF
Sbjct  1    MAQSGYDINNLFREAQSRWLKPAEVLFILQNHEKYQLEQEPPHKPTSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+ E LNCYYAHGEQNP+FQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEQNPSFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006341901.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Solanum tuberosum]
Length=973

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL+RE   RWL+PAEVLFILQNH++HQ+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNINDLVREGHFRWLRPAEVLFILQNHDDHQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006341902.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Solanum tuberosum]
Length=970

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL+RE   RWL+PAEVLFILQNH++HQ+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNINDLVREGHFRWLRPAEVLFILQNHDDHQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006341903.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Solanum tuberosum]
Length=950

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL+RE   RWL+PAEVLFILQNH++HQ+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNINDLVREGHFRWLRPAEVLFILQNHDDHQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|KJB60937.1| hypothetical protein B456_009G332200 [Gossypium raimondii]
Length=873

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  246  IMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLR  425
            +M ++GY+ ++L REAQ RWLKPAEVLFILQNHE +Q+  EPP+KP SGSLFLFNKRVLR
Sbjct  1    MMAQSGYDINNLFREAQSRWLKPAEVLFILQNHEKYQLQQEPPRKPTSGSLFLFNKRVLR  60

Query  426  FFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEH  605
            FFRKDGHSWR+K+DGRTVGEAHERLKVG+ E LNCYYAHGEQNP+FQRRSYWMLDPAYEH
Sbjct  61   FFRKDGHSWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEQNPSFQRRSYWMLDPAYEH  120

Query  606  IVLVHYR  626
            IVLVHYR
Sbjct  121  IVLVHYR  127



>ref|XP_009592003.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Nicotiana tomentosiformis]
Length=1000

 Score =   236 bits (603),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL+RE   RWL+PAEV+FILQNHE+ Q+A++PPQKP SGS+FLFNKRVLR+FRKDG
Sbjct  44   YNINDLVREGHFRWLRPAEVVFILQNHEDQQLANQPPQKPASGSMFLFNKRVLRYFRKDG  103

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+NPNFQRRSYWMLDPAYEHIVLVHY
Sbjct  104  HSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNPNFQRRSYWMLDPAYEHIVLVHY  163

Query  624  R  626
            R
Sbjct  164  R  164



>ref|XP_009592002.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   236 bits (603),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 101/121 (83%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL+RE   RWL+PAEV+FILQNHE+ Q+A++PPQKP SGS+FLFNKRVLR+FRKDG
Sbjct  44   YNINDLVREGHFRWLRPAEVVFILQNHEDQQLANQPPQKPASGSMFLFNKRVLRYFRKDG  103

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+NPNFQRRSYWMLDPAYEHIVLVHY
Sbjct  104  HSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNPNFQRRSYWMLDPAYEHIVLVHY  163

Query  624  R  626
            R
Sbjct  164  R  164



>ref|XP_010656043.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Vitis vinifera]
Length=998

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +G++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRK
Sbjct  2    SGFDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRK  61

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNP+FQRRSYWMLDPAYEHIVLV
Sbjct  62   DGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWMLDPAYEHIVLV  121

Query  618  HYR  626
            HYR
Sbjct  122  HYR  124



>ref|XP_002270865.2| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Vitis vinifera]
Length=995

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +G++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRK
Sbjct  2    SGFDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRK  61

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNP+FQRRSYWMLDPAYEHIVLV
Sbjct  62   DGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWMLDPAYEHIVLV  121

Query  618  HYR  626
            HYR
Sbjct  122  HYR  124



>ref|XP_010656077.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X5 [Vitis vinifera]
Length=965

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +G++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRK
Sbjct  2    SGFDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRK  61

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNP+FQRRSYWMLDPAYEHIVLV
Sbjct  62   DGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWMLDPAYEHIVLV  121

Query  618  HYR  626
            HYR
Sbjct  122  HYR  124



>ref|XP_010656058.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X3 [Vitis vinifera]
 ref|XP_010656066.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X3 [Vitis vinifera]
 emb|CBI27676.3| unnamed protein product [Vitis vinifera]
Length=968

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +G++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRK
Sbjct  2    SGFDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRK  61

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNP+FQRRSYWMLDPAYEHIVLV
Sbjct  62   DGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWMLDPAYEHIVLV  121

Query  618  HYR  626
            HYR
Sbjct  122  HYR  124



>ref|XP_010656071.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X4 [Vitis vinifera]
Length=968

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +G++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRK
Sbjct  2    SGFDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRK  61

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNP+FQRRSYWMLDPAYEHIVLV
Sbjct  62   DGHSWRKKKDGRTVGEAHERLKVGTVETINCYYAHGEQNPSFQRRSYWMLDPAYEHIVLV  121

Query  618  HYR  626
            HYR
Sbjct  122  HYR  124



>ref|XP_010314155.1| PREDICTED: calmodulin-binding transcription factor SR2 isoform 
X5 [Solanum lycopersicum]
Length=973

 Score =   234 bits (597),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M E+GYN +DL++E + RWL+PAEVLFILQNH++ Q+AH+PPQKP SGS+FLFNKRVLR+
Sbjct  1    MAESGYNTNDLVQEGRFRWLRPAEVLFILQNHDDRQLAHQPPQKPASGSMFLFNKRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+N NFQRRSYW+LDPAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWILDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_007043963.1| Calmodulin-binding transcription activator protein with CG-1 
and Ankyrin domains isoform 2 [Theobroma cacao]
 gb|EOX99794.1| Calmodulin-binding transcription activator protein with CG-1 
and Ankyrin domains isoform 2 [Theobroma cacao]
Length=987

 Score =   233 bits (595),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++ Y+ ++L REAQ RWLKPAEV FILQNHE +++  EPPQKP  GSLFLFNKRVLRF
Sbjct  1    MAQSEYDINNLFREAQARWLKPAEVFFILQNHEKYELTQEPPQKPTGGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGHSWR+K+DGRTVGEAHERLKVG+ E LNCYYAHG QNPNFQRRSYWML+PAYEHI
Sbjct  61   FRKDGHSWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGAQNPNFQRRSYWMLEPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|KDP26824.1| hypothetical protein JCGZ_17982 [Jatropha curcas]
Length=983

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+++GY+   L++EAQ RWLKP EVL+ILQNH+ ++I  EPPQ+P SGSLFLFNKRVLRF
Sbjct  1    MSQSGYDIKALVQEAQTRWLKPVEVLYILQNHDKYKITQEPPQRPTSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGHSWR+K+DGRTVGEAHERLKVG+ EALNCYYAHGEQNPNFQRRSYWMLDPAYEHI
Sbjct  61   FRRDGHSWRKKKDGRTVGEAHERLKVGNVEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_008222186.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Prunus mume]
Length=994

 Score =   232 bits (591),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GYN +DL +EAQ RWLKPAEVL+ILQNHE  ++A EPPQ+P SGSLFLFNKRVLRF
Sbjct  1    MMQSGYNINDLFQEAQTRWLKPAEVLYILQNHEKFKLAPEPPQQPSSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGH WR+K+DGRTVGEAHERLKVG+AE LNCYYAHGE NPNFQRRSYWMLDPAYEHI
Sbjct  61   FRRDGHHWRKKKDGRTVGEAHERLKVGNAETLNCYYAHGEDNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_007225420.1| hypothetical protein PRUPE_ppa000516mg [Prunus persica]
 gb|EMJ26619.1| hypothetical protein PRUPE_ppa000516mg [Prunus persica]
Length=1116

 Score =   233 bits (593),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL++EAQ RWLKPAEVL+ILQNHE  ++A EPPQ+P SGSLFLFNKRVLRFFR+DG
Sbjct  128  YNINDLLQEAQTRWLKPAEVLYILQNHEKFKLASEPPQQPSSGSLFLFNKRVLRFFRRDG  187

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WR+K+DGRTVGEAHERLKVG+AE LNCYYAHGE NPNFQRRSYWMLDPAYEHIVLVHY
Sbjct  188  HHWRKKKDGRTVGEAHERLKVGNAETLNCYYAHGENNPNFQRRSYWMLDPAYEHIVLVHY  247

Query  624  R  626
            R
Sbjct  248  R  248



>gb|KDO81859.1| hypothetical protein CISIN_1g044976mg [Citrus sinensis]
Length=846

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  AGY+   L REAQ RWLKPAEVLFILQN++ +++  EPPQKP SGSLFLFNKRVLRF
Sbjct  1    MMLAGYDVDFLFREAQTRWLKPAEVLFILQNYDKYELTQEPPQKPNSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGR VGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRAVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_007043962.1| Calmodulin-binding transcription activator protein with CG-1 
and Ankyrin domains isoform 1 [Theobroma cacao]
 gb|EOX99793.1| Calmodulin-binding transcription activator protein with CG-1 
and Ankyrin domains isoform 1 [Theobroma cacao]
Length=987

 Score =   231 bits (590),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ ++L REAQ RWLKPAEV FILQNHE +++  EPPQKP  GSLFLFNKRVLRFFRKDG
Sbjct  7    YDINNLFREAQARWLKPAEVFFILQNHEKYELTQEPPQKPTGGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+K+DGRTVGEAHERLKVG+ E LNCYYAHG QNPNFQRRSYWML+PAYEHIVLVHY
Sbjct  67   HSWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGAQNPNFQRRSYWMLEPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006484133.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Citrus sinensis]
Length=974

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  AGY+   L REAQ RWLKPAEVLFILQN++ +++  EPPQKP SGSLFLFNKRVLRF
Sbjct  1    MMLAGYDVDILFREAQTRWLKPAEVLFILQNYDKYELTQEPPQKPNSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGR VGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRAVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006484135.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Citrus sinensis]
Length=953

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  AGY+   L REAQ RWLKPAEVLFILQN++ +++  EPPQKP SGSLFLFNKRVLRF
Sbjct  1    MMLAGYDVDILFREAQTRWLKPAEVLFILQNYDKYELTQEPPQKPNSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DGR VGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHNWRKKKDGRAVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006580123.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X3 [Glycine max]
Length=978

 Score =   229 bits (584),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ EALNCYYAHGEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPTFQRRSYWMLDPAYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006580122.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Glycine max]
Length=984

 Score =   229 bits (584),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ EALNCYYAHGEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPTFQRRSYWMLDPAYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006580124.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X4 [Glycine max]
Length=977

 Score =   229 bits (583),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ EALNCYYAHGEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPTFQRRSYWMLDPAYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_003524171.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Glycine max]
Length=983

 Score =   229 bits (583),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 100/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ EALNCYYAHGEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPTFQRRSYWMLDPAYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_008222185.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Prunus mume]
Length=995

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +GYN +DL +EAQ RWLKPAEVL+ILQNHE  ++A EPPQ+P SGSLFLFNKRVLRFFR+
Sbjct  5    SGYNINDLFQEAQTRWLKPAEVLYILQNHEKFKLAPEPPQQPSSGSLFLFNKRVLRFFRR  64

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGH WR+K+DGRTVGEAHERLKVG+AE LNCYYAHGE NPNFQRRSYWMLDPAYEHIVLV
Sbjct  65   DGHHWRKKKDGRTVGEAHERLKVGNAETLNCYYAHGEDNPNFQRRSYWMLDPAYEHIVLV  124

Query  618  HYR  626
            HYR
Sbjct  125  HYR  127



>ref|XP_006438003.1| hypothetical protein CICLE_v10030636mg [Citrus clementina]
 gb|ESR51243.1| hypothetical protein CICLE_v10030636mg [Citrus clementina]
Length=973

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + GY+   L REAQ RWLKPAEVLFILQN++ +++  EPPQKP SGSLFLFNKRVLRFFR
Sbjct  2    QGGYDVDILFREAQTRWLKPAEVLFILQNYDKYELTQEPPQKPNSGSLFLFNKRVLRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH+WR+K+DGR VGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL
Sbjct  62   KDGHNWRKKKDGRAVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009372262.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Pyrus x bretschneideri]
Length=972

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GYN +DL +EAQ RWLKPAEVLFILQNHE ++IA +PPQ+P SGSLFLFNKR+LRFFR
Sbjct  2    QSGYNINDLFQEAQTRWLKPAEVLFILQNHEKYKIAPQPPQQPSSGSLFLFNKRILRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH+WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVL
Sbjct  62   RDGHNWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_006484134.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Citrus sinensis]
Length=973

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + GY+   L REAQ RWLKPAEVLFILQN++ +++  EPPQKP SGSLFLFNKRVLRFFR
Sbjct  2    QGGYDVDILFREAQTRWLKPAEVLFILQNYDKYELTQEPPQKPNSGSLFLFNKRVLRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH+WR+K+DGR VGEAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL
Sbjct  62   KDGHNWRKKKDGRAVGEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009372261.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Pyrus x bretschneideri]
Length=975

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +GYN +DL +EAQ RWLKPAEVLFILQNHE ++IA +PPQ+P SGSLFLFNKR+LRFFR+
Sbjct  6    SGYNINDLFQEAQTRWLKPAEVLFILQNHEKYKIAPQPPQQPSSGSLFLFNKRILRFFRR  65

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGH+WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVLV
Sbjct  66   DGHNWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVLV  125

Query  618  HYR  626
            HYR
Sbjct  126  HYR  128



>ref|XP_003630482.1| Calmodulin-binding transcription activator [Medicago truncatula]
Length=201

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+  DL +EAQ RWLKPAEV++ILQNHE +Q   EPPQ+P SGSLFLFN+RVLRFFRKDG
Sbjct  7    YDIDDLYQEAQRRWLKPAEVMYILQNHEKYQFTQEPPQQPTSGSLFLFNRRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGR VGEAHERLKVG+ EA+NCYYAHGEQNP FQRRSYWML+P ++HIVLVHY
Sbjct  67   HAWRKKRDGRAVGEAHERLKVGNVEAINCYYAHGEQNPTFQRRSYWMLNPEFDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_007158673.1| hypothetical protein PHAVU_002G172800g [Phaseolus vulgaris]
 gb|ESW30667.1| hypothetical protein PHAVU_002G172800g [Phaseolus vulgaris]
Length=987

 Score =   228 bits (580),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL  EAQ RWLKPAEV++ILQNHE   +  EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHHEAQARWLKPAEVMYILQNHEKFLLTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ EALNCYYAHGEQNP+FQRRSYWMLDP YEHIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNVEALNCYYAHGEQNPSFQRRSYWMLDPEYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_011020768.1| PREDICTED: calmodulin-binding transcription activator 4 [Populus 
euphratica]
Length=980

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ + L  EAQ RWLKPAEVLFILQNH+ +Q   EP QKP SGSLFLFNKR+LRF
Sbjct  1    MLQSGYDINSLFEEAQTRWLKPAEVLFILQNHDKYQFTKEPLQKPTSGSLFLFNKRILRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGHSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNPNFQRRSYWMLDPA+EHI
Sbjct  61   FRRDGHSWRKKKDGRTVGEAHERLKVGNVETINCYYAHGEQNPNFQRRSYWMLDPAFEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010250675.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010250676.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nelumbo nucifera]
Length=1035

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GY+   L +EAQ RWLKPAEVLFILQNHEN ++  EPPQ+P SGSLFLFN+RVLRFFR
Sbjct  2    QSGYDIHKLFQEAQNRWLKPAEVLFILQNHENQKLTEEPPQRPSSGSLFLFNRRVLRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH WR+K+DGRTVGEAHERLKVG+ EALNCYYAHGEQNPNFQRRSYWMLDPA+EHIVL
Sbjct  62   RDGHVWRKKKDGRTVGEAHERLKVGNVEALNCYYAHGEQNPNFQRRSYWMLDPAHEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010682739.1| PREDICTED: calmodulin-binding transcription activator 4 [Beta 
vulgaris subsp. vulgaris]
Length=970

 Score =   225 bits (574),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  +GY+ ++L++ AQ RWLKP EVLFILQNH N+QI  E PQKP SGS+FLFNKRVLRF
Sbjct  1    MQSSGYDINELLQAAQTRWLKPVEVLFILQNHANYQITQEAPQKPPSGSVFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDG+SWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+NP FQRRSYWMLD  YEHI
Sbjct  61   FRKDGYSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEENPTFQRRSYWMLDREYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_004140640.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Cucumis sativus]
 ref|XP_004166127.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Cucumis sativus]
 gb|KGN46464.1| hypothetical protein Csa_6G095310 [Cucumis sativus]
Length=962

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  AGY+ +DL REAQ RWLKP EVLFILQNHE +Q+  E P++P SGSLFLFNKRVLRF
Sbjct  1    MMNAGYDINDLYREAQTRWLKPPEVLFILQNHEKYQLTEEAPKQPTSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGHSWR+KRDGRTVGEAHERLKVG+AEALNCYYAHGE NPNFQRRSYWMLD + +HI
Sbjct  61   FRRDGHSWRKKRDGRTVGEAHERLKVGNAEALNCYYAHGEHNPNFQRRSYWMLDLSCDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>emb|CAN76708.1| hypothetical protein VITISV_022702 [Vitis vinifera]
Length=729

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 12/133 (9%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++F+DL++EAQ RWLKPAEVLFILQN+E HQ+  EPPQKP SGSLFLFNKRVLRFFRKDG
Sbjct  86   FDFNDLLKEAQIRWLKPAEVLFILQNYEKHQLTQEPPQKPTSGSLFLFNKRVLRFFRKDG  145

Query  444  HSWRRKRDGRTVGEAHERL------------KVGSAEALNCYYAHGEQNPNFQRRSYWML  587
            HSWR+K+DGRTVGEAHERL            KVG+ E +NCYYAHGEQNP+FQRRSYWML
Sbjct  146  HSWRKKKDGRTVGEAHERLQGTTPHLKVPMTKVGTVETINCYYAHGEQNPSFQRRSYWML  205

Query  588  DPAYEHIVLVHYR  626
            DPAYEHIVLVHYR
Sbjct  206  DPAYEHIVLVHYR  218



>ref|XP_010025296.1| PREDICTED: calmodulin-binding transcription activator 4 [Eucalyptus 
grandis]
 gb|KCW61927.1| hypothetical protein EUGRSUZ_H04623 [Eucalyptus grandis]
Length=991

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  +GYN SDL +EAQ RWLKPAEVL+ILQNHE+ Q+  +PPQ+P SGSLFLFNKRVLRF
Sbjct  1    MMPSGYNISDLYQEAQYRWLKPAEVLYILQNHESCQLTQQPPQRPSSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGH+WR+K+D RTVGEAHERLKVG+ E LNCYYAHGE NPNFQRRSYWMLDPA +HI
Sbjct  61   FRRDGHNWRKKKDQRTVGEAHERLKVGNVEKLNCYYAHGEDNPNFQRRSYWMLDPACDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_008389876.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Malus domestica]
Length=977

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GYN +DL +EAQ RWLKP EVLFILQNH+ ++ A  PPQ+P SGSLFLFNKR+LRFFR
Sbjct  2    QSGYNINDLFQEAQTRWLKPVEVLFILQNHDKYKFATVPPQQPSSGSLFLFNKRILRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVL
Sbjct  62   RDGHQWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>gb|KHN34827.1| Calmodulin-binding transcription activator 4 [Glycine soja]
Length=980

 Score =   221 bits (564),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   EPPQ+P SGSLFLFNKRVLRFFRKDG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEPPQQPTSGSLFLFNKRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_008389875.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Malus domestica]
Length=980

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +GYN +DL +EAQ RWLKP EVLFILQNH+ ++ A  PPQ+P SGSLFLFNKR+LRFFR+
Sbjct  6    SGYNINDLFQEAQTRWLKPVEVLFILQNHDKYKFATVPPQQPSSGSLFLFNKRILRFFRR  65

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGH WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVLV
Sbjct  66   DGHQWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVLV  125

Query  618  HYR  626
            HYR
Sbjct  126  HYR  128



>ref|XP_009343150.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Pyrus x bretschneideri]
Length=979

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GYN +DL +EAQ RWLKPAEVLFILQNH+ ++ A  P Q+P SGSLFLFNKR+LRFFR
Sbjct  2    QSGYNINDLFQEAQARWLKPAEVLFILQNHDKYKFATVPAQQPSSGSLFLFNKRILRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVL
Sbjct  62   RDGHRWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010556125.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Tarenaya hassleriana]
Length=970

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ ++L +EAQ RWLKPAEVLFILQ+HE +Q+  + PQKP SGSLFLFNKRVL+F
Sbjct  1    MQQSGYDVNNLYQEAQTRWLKPAEVLFILQSHERYQLTPKAPQKPTSGSLFLFNKRVLKF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH WRRK+DGR V EAHERLKVG+AEALNCYYAHGE NP+FQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHQWRRKKDGRAVAEAHERLKVGNAEALNCYYAHGELNPSFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010556124.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Tarenaya hassleriana]
Length=983

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ ++L +EAQ RWLKPAEVLFILQ+HE +Q+  + PQKP SGSLFLFNKRVL+F
Sbjct  1    MQQSGYDVNNLYQEAQTRWLKPAEVLFILQSHERYQLTPKAPQKPTSGSLFLFNKRVLKF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH WRRK+DGR V EAHERLKVG+AEALNCYYAHGE NP+FQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHQWRRKKDGRAVAEAHERLKVGNAEALNCYYAHGELNPSFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_002303787.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE78766.1| calmodulin-binding family protein [Populus trichocarpa]
Length=915

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ + L  EAQ RWLKPAEVLFILQNH+ +Q   EP QKP SGSLFLFNKR+LRFFR+DG
Sbjct  11   YDINSLFEEAQTRWLKPAEVLFILQNHDKYQFTKEPLQKPTSGSLFLFNKRILRFFRRDG  70

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+K+DGRTVGEAHERLKVG+ E +NCYYAHGEQNPNFQRRSYWMLDPA+EHIVLVHY
Sbjct  71   HSWRKKKDGRTVGEAHERLKVGNVETINCYYAHGEQNPNFQRRSYWMLDPAFEHIVLVHY  130

Query  624  R  626
            R
Sbjct  131  R  131



>ref|XP_011457493.1| PREDICTED: calmodulin-binding transcription activator 4 [Fragaria 
vesca subsp. vesca]
Length=1013

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +3

Query  246  IMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLR  425
            + + +GY+ ++L +EAQ RWLKPAEVLFILQNH+ +++  EPPQ+P SGSLFLFNKR+LR
Sbjct  1    MQSVSGYDINELFQEAQSRWLKPAEVLFILQNHDKYKVTPEPPQQPVSGSLFLFNKRILR  60

Query  426  FFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEH  605
            FFR+DGH+WR+KRDGRTVGEAHERLKVG+ E LNCYYAHGE NPNFQRRSYWMLDPA +H
Sbjct  61   FFRRDGHNWRKKRDGRTVGEAHERLKVGNVETLNCYYAHGEDNPNFQRRSYWMLDPASDH  120

Query  606  IVLVHYR  626
            IVLVHYR
Sbjct  121  IVLVHYR  127



>ref|XP_009343149.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Pyrus x bretschneideri]
Length=982

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            +GYN +DL +EAQ RWLKPAEVLFILQNH+ ++ A  P Q+P SGSLFLFNKR+LRFFR+
Sbjct  6    SGYNINDLFQEAQARWLKPAEVLFILQNHDKYKFATVPAQQPSSGSLFLFNKRILRFFRR  65

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGH WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE NP+FQRRSYWMLDPAYEHIVLV
Sbjct  66   DGHRWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEDNPSFQRRSYWMLDPAYEHIVLV  125

Query  618  HYR  626
            HYR
Sbjct  126  HYR  128



>ref|XP_008459844.1| PREDICTED: calmodulin-binding transcription activator 4 [Cucumis 
melo]
Length=962

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M  AGY+ + L REAQ RWLKP EVLFILQNHE +Q+  E P++P SGSLFLFNKRVLRF
Sbjct  1    MMNAGYDINYLYREAQTRWLKPPEVLFILQNHEKYQLTEEAPKQPTSGSLFLFNKRVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGHSWR+KRDGRTVGEAHERLKVG+AEALNCYYAHGE NPNFQRRSYWMLD + +HI
Sbjct  61   FRRDGHSWRKKRDGRTVGEAHERLKVGNAEALNCYYAHGEHNPNFQRRSYWMLDQSCDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010552446.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Tarenaya hassleriana]
Length=983

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++ Y+ + L +EAQ RWLKPAEVLFILQNHE +Q+  + P KP SGSLFLFNKRVL+F
Sbjct  1    MQQSEYDVNALYQEAQTRWLKPAEVLFILQNHERYQLTPKAPLKPTSGSLFLFNKRVLKF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH WRRK+DGR + EAHERLKVG+AEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI
Sbjct  61   FRKDGHQWRRKKDGRAIAEAHERLKVGNAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006368871.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|ERP65440.1| calmodulin-binding family protein [Populus trichocarpa]
Length=998

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ + L  EAQ RWLKPAEV+FILQNH+ +Q   +PPQKP SGSLFLFNKRVL+F
Sbjct  1    MLQSGYDINSLFEEAQTRWLKPAEVIFILQNHDKYQFTEKPPQKPTSGSLFLFNKRVLKF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGH+WR+K+DGR+VGEAHERLKVG+ EALNCYYAHGEQN NFQRRSYWMLD A+EHI
Sbjct  61   FRRDGHNWRKKKDGRSVGEAHERLKVGNVEALNCYYAHGEQNQNFQRRSYWMLDQAFEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_011036094.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Populus euphratica]
Length=986

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ + L  EAQ RWLKPAEV+FILQNH+ +Q   +PPQKP SGSLFLFNKRVL+F
Sbjct  1    MLQSGYDINSLFEEAQTRWLKPAEVVFILQNHDKYQFTEKPPQKPTSGSLFLFNKRVLKF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR+DGH+WR+K+DGR+VGEAHERLKVG+ EALNCYYAHGEQN NFQRRSYWMLD A+EHI
Sbjct  61   FRRDGHNWRKKKDGRSVGEAHERLKVGNVEALNCYYAHGEQNQNFQRRSYWMLDRAFEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_010249049.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Nelumbo nucifera]
Length=1037

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GY+  +L +EA+ RWLKPAEVLFILQNHE+ ++  EP Q+P  GSLFLFNKRVLRFFR
Sbjct  2    QSGYDIHELFQEAKNRWLKPAEVLFILQNHESQKLTEEPLQRPPGGSLFLFNKRVLRFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH WR+K+DGRTVGEAHERLKVG+ EALNCYYAHGEQNP+FQRRSYWMLDPAYEHIVL
Sbjct  62   RDGHIWRKKKDGRTVGEAHERLKVGNVEALNCYYAHGEQNPSFQRRSYWMLDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_011086818.1| PREDICTED: calmodulin-binding transcription activator 4 [Sesamum 
indicum]
Length=940

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++GY+ + L REAQ RWLKP EV FILQN+E HQ+ H+ PQKP SGSL+LFNKRVL+FFR
Sbjct  2    QSGYDINHLAREAQTRWLKPVEVFFILQNYEEHQLTHQIPQKPASGSLYLFNKRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRR++D RT+ EAHERLKVG+ EALNCYYAHGE+NPNFQRRSYW+LDPAYEHIVL
Sbjct  62   KDGHRWRRRKDQRTIAEAHERLKVGNVEALNCYYAHGEENPNFQRRSYWILDPAYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009803069.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Nicotiana sylvestris]
Length=966

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  228  IFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLF  407
            I L    M E+GYN ++L+RE + RWL+PAEVLFILQNHE+ Q+A++PPQKP SGS+FLF
Sbjct  51   ILLLRISMAESGYNINNLVREGRFRWLRPAEVLFILQNHEDQQLANQPPQKPASGSMFLF  110

Query  408  NKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWML  587
            NKRVLR+FRKDGHSWR+K+DGRTVGEAHERLKVG+AE LNCYYAHGE+NPNFQRRSYWML
Sbjct  111  NKRVLRYFRKDGHSWRKKKDGRTVGEAHERLKVGNAETLNCYYAHGEKNPNFQRRSYWML  170

Query  588  DP  593
            DP
Sbjct  171  DP  172



>ref|XP_004504403.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Cicer arietinum]
Length=993

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE +Q   EPPQ+P SGSLFLFN+RVLRFFR+DG
Sbjct  7    YDINDLYQEAQRRWLKPAEVMYILQNHEKYQFTQEPPQQPTSGSLFLFNRRVLRFFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGR VGEAHERLKVG+ EALNCYYAHGEQ P FQRRSYWMLDPA++HIVLVHY
Sbjct  67   HAWRKKRDGRAVGEAHERLKVGNVEALNCYYAHGEQIPTFQRRSYWMLDPAFDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_004504405.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Cicer arietinum]
Length=988

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE +Q   EPPQ+P SGSLFLFN+RVLRFFR+DG
Sbjct  7    YDINDLYQEAQRRWLKPAEVMYILQNHEKYQFTQEPPQQPTSGSLFLFNRRVLRFFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGR VGEAHERLKVG+ EALNCYYAHGEQ P FQRRSYWMLDPA++HIVLVHY
Sbjct  67   HAWRKKRDGRAVGEAHERLKVGNVEALNCYYAHGEQIPTFQRRSYWMLDPAFDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_004504404.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Cicer arietinum]
Length=989

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE +Q   EPPQ+P SGSLFLFN+RVLRFFR+DG
Sbjct  7    YDINDLYQEAQRRWLKPAEVMYILQNHEKYQFTQEPPQQPTSGSLFLFNRRVLRFFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGR VGEAHERLKVG+ EALNCYYAHGEQ P FQRRSYWMLDPA++HIVLVHY
Sbjct  67   HAWRKKRDGRAVGEAHERLKVGNVEALNCYYAHGEQIPTFQRRSYWMLDPAFDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>gb|KEH20613.1| calmodulin-binding protein [Medicago truncatula]
Length=961

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+  DL +EAQ RWLKPAEV++ILQNHE +Q   EPPQ+P SGSLFLFN+RVLRFFRKDG
Sbjct  7    YDIDDLYQEAQRRWLKPAEVMYILQNHEKYQFTQEPPQQPTSGSLFLFNRRVLRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGR VGEAHERLKVG+ EA+NCYYAHGEQNP FQRRSYWML+P ++HIVLVHY
Sbjct  67   HAWRKKRDGRAVGEAHERLKVGNVEAINCYYAHGEQNPTFQRRSYWMLNPEFDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_010090639.1| Calmodulin-binding transcription activator 4 [Morus notabilis]
 gb|EXB40303.1| Calmodulin-binding transcription activator 4 [Morus notabilis]
Length=1111

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ ++L +EAQ RWLKPAEV FIL+NHE +++  EPP++P SGSLFLFNKRVLRFFR
Sbjct  5    QSEYDINELYKEAQSRWLKPAEVFFILRNHEKYKLTQEPPKRPTSGSLFLFNKRVLRFFR  64

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH+WR+K+DGRTVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYWMLDPA EHIVL
Sbjct  65   KDGHNWRKKKDGRTVGEAHERLKVGNVETLNCYYAHGEENHCFQRRSYWMLDPASEHIVL  124

Query  615  VHYR  626
            VHYR
Sbjct  125  VHYR  128



>ref|XP_009592005.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X4 [Nicotiana tomentosiformis]
Length=951

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL+RE   RWL+PAEV+FILQNHE+ Q+A++PPQKP SGS+FLFNKRVLR+FRKDG
Sbjct  44   YNINDLVREGHFRWLRPAEVVFILQNHEDQQLANQPPQKPASGSMFLFNKRVLRYFRKDG  103

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDP  593
            HSWR+K+DGRTVGEAHERLKVG+AEALNCYYAHGE+NPNFQRRSYWMLDP
Sbjct  104  HSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNPNFQRRSYWMLDP  153



>ref|NP_176899.2| calmodulin-binding transcription activator 4 [Arabidopsis thaliana]
 sp|Q9FYG2.1|CMTA4_ARATH RecName: Full=Calmodulin-binding transcription activator 4; AltName: 
Full=Ethylene-induced calmodulin-binding protein 4; 
Short=AtFIN21; Short=EICBP4; AltName: Full=Ethylene-induced 
calmodulin-binding protein d; Short=EICBP.d; AltName: Full=Signal-responsive 
protein 5 [Arabidopsis thaliana]
 gb|AAG00250.1|AC002130_15 F1N21.13 [Arabidopsis thaliana]
 gb|AAR98747.1| ethylene-induced calmodulin-binding protein 4 [Arabidopsis thaliana]
 gb|AEE34626.1| calmodulin-binding transcription activator 4 [Arabidopsis thaliana]
Length=1016

 Score =   208 bits (529),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y  S L +EA  RWLKP EVLFILQNHE+  + +  PQ+P SGSL LFNKRVL+FFRKDG
Sbjct  36   YEISTLYQEAHSRWLKPPEVLFILQNHESLTLTNTAPQRPTSGSLLLFNKRVLKFFRKDG  95

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WRRKRDGR + EAHERLKVG+AEALNCYYAHGEQ+P F+RR YWMLDP YEHIVLVHY
Sbjct  96   HQWRRKRDGRAIAEAHERLKVGNAEALNCYYAHGEQDPTFRRRIYWMLDPEYEHIVLVHY  155

Query  624  R  626
            R
Sbjct  156  R  156



>ref|XP_002888589.1| calmodulin binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64848.1| calmodulin binding protein [Arabidopsis lyrata subsp. lyrata]
Length=1031

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  189  DLAAIRYGFSA*LIFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHE  368
            D+A I          LF  I+    Y  S L +EA+ RWLKP EVLFILQNHE   + + 
Sbjct  18   DIATIFVAICRNPPVLFLEILHFVKYEISTLYQEARSRWLKPPEVLFILQNHERLTLTNT  77

Query  369  PPQKPGSGSLFLFNKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGE  548
             PQ+P SGSLFLFNKRVL+FFRKDGH WRRKRDGR + EAHERLKVG+AEALNCYYAHGE
Sbjct  78   APQRPTSGSLFLFNKRVLKFFRKDGHQWRRKRDGRAIAEAHERLKVGNAEALNCYYAHGE  137

Query  549  QNPNFQRRSYWMLDPAYEHIVLVHYR  626
            Q+P F+RR YWMLDP YEHIVLVHYR
Sbjct  138  QDPTFRRRIYWMLDPEYEHIVLVHYR  163



>gb|KHN12381.1| Calmodulin-binding transcription activator 4, partial [Glycine 
soja]
Length=962

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  3    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  62

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  63   HNWRKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  122

Query  624  R  626
            R
Sbjct  123  R  123



>ref|XP_006391294.1| hypothetical protein EUTSA_v10018053mg [Eutrema salsugineum]
 gb|ESQ28580.1| hypothetical protein EUTSA_v10018053mg [Eutrema salsugineum]
Length=1051

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN   L +EAQ RWLKP EV FILQNHE +Q+ H+ PQKP SG+LFLFNKRVL+FFRKDG
Sbjct  31   YNIKTLYQEAQARWLKPPEVHFILQNHERYQLTHKAPQKPTSGNLFLFNKRVLKFFRKDG  90

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H W+RK+DGR + EAHERLKVG+AEALNCYYAH EQ+P FQRR YWMLDP YEHIVLVHY
Sbjct  91   HQWKRKKDGRAIAEAHERLKVGNAEALNCYYAHAEQDPTFQRRIYWMLDPEYEHIVLVHY  150

Query  624  R  626
            R
Sbjct  151  R  151



>ref|XP_006301894.1| hypothetical protein CARUB_v10022369mg [Capsella rubella]
 gb|EOA34792.1| hypothetical protein CARUB_v10022369mg [Capsella rubella]
Length=1021

 Score =   206 bits (525),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 93/134 (69%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  225  LIFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFL  404
            L FLFS +     Y+   L +EA+ RWLKP EV FILQN+E  ++    PQ+P SGSLFL
Sbjct  28   LRFLFSSVHK---YDIGTLYQEARTRWLKPPEVQFILQNYERLKLTDTAPQRPASGSLFL  84

Query  405  FNKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWM  584
            FNKRVL+FFRKDGH WRRKRDGR + EAHERLKVG+AEALNCYYAHGE +P F+RR YWM
Sbjct  85   FNKRVLKFFRKDGHQWRRKRDGRAIAEAHERLKVGNAEALNCYYAHGEHDPTFRRRIYWM  144

Query  585  LDPAYEHIVLVHYR  626
            LDP YEHIVLVHYR
Sbjct  145  LDPEYEHIVLVHYR  158



>ref|XP_010905494.1| PREDICTED: calmodulin-binding transcription activator 4 [Elaeis 
guineensis]
Length=1073

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ + L +EA  RWLKP+EVLFILQN+E   +  EPPQ+P SGSLFLFN+R+LRFFRKDG
Sbjct  5    YDINVLQQEAHTRWLKPSEVLFILQNYERFPLTQEPPQRPPSGSLFLFNRRILRFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WRRK+DGRTVGEAHERLKVG+ + LNCYYAHGE+NP FQRRS+WMLDPAYEHIVLVHY
Sbjct  65   HLWRRKKDGRTVGEAHERLKVGNVDVLNCYYAHGEKNPYFQRRSFWMLDPAYEHIVLVHY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_008807442.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Phoenix dactylifera]
Length=1081

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ + L ++A  RWLKP+EVLFILQN+E   ++ EP Q+P SGSLFLFN+R+LRFFRKDG
Sbjct  5    YDINVLQQDAHTRWLKPSEVLFILQNYERFPLSQEPAQRPPSGSLFLFNRRILRFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WRRKRDGRTVGEAHERLKVG+ + LNCYYAHGEQNP FQRRSYWMLDPAY+HIVLVHY
Sbjct  65   HMWRRKRDGRTVGEAHERLKVGNVDVLNCYYAHGEQNPYFQRRSYWMLDPAYDHIVLVHY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_003552779.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Glycine max]
 gb|KHN24054.1| Calmodulin-binding transcription activator 4 [Glycine soja]
Length=962

 Score =   204 bits (519),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN  DL +EA+ RWLKP EVL+IL+NH+  +  H+PP +P  GSL LFN+R++RFFRKDG
Sbjct  7    YNIDDLFQEAKRRWLKPVEVLYILRNHDQCEFTHQPPHQPAGGSLLLFNRRIMRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DG+TVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYWML+P Y+HIVLVHY
Sbjct  67   HNWRKKKDGKTVGEAHERLKVGNVEILNCYYAHGEENRTFQRRSYWMLEPEYDHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006585128.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X5 [Glycine max]
Length=946

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+W +K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  67   HNWHKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_009411793.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411794.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411795.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Musa acuminata subsp. malaccensis]
Length=881

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  246  IMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLR  425
            I    G++ + L +EAQ RWLKP EVL+ILQN++  +I  +PPQKP SGSLFLFN+RVLR
Sbjct  4    IQPVTGFDINKLSQEAQTRWLKPVEVLYILQNYKCFEITQKPPQKPPSGSLFLFNRRVLR  63

Query  426  FFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEH  605
            +FR DGHSWR+K +G+TV E HERLKVG++EALNCYYAHGEQN NFQRRSYW+LDPAYEH
Sbjct  64   YFRNDGHSWRKKTNGKTVREGHERLKVGNSEALNCYYAHGEQNSNFQRRSYWILDPAYEH  123

Query  606  IVLVHYR  626
            IVLVHYR
Sbjct  124  IVLVHYR  130



>ref|XP_006585127.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X4 [Glycine max]
Length=959

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+W +K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  67   HNWHKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006585126.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Glycine max]
Length=960

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+W +K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  67   HNWHKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_006585125.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Glycine max]
Length=966

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+W +K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  67   HNWHKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_003532724.2| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Glycine max]
Length=965

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ +DL +EAQ RWLKPAEV++ILQNHE  Q   E PQ+P SGSLFLFNKR+LR+FR+DG
Sbjct  7    YDINDLHQEAQARWLKPAEVMYILQNHEKFQFTQEVPQQPTSGSLFLFNKRILRYFRRDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+W +K  GRTVGEAHERLKV + EALNCYYA GEQNP FQRRSYWMLDPAYEHIVLVHY
Sbjct  67   HNWHKKSGGRTVGEAHERLKVLNVEALNCYYARGEQNPAFQRRSYWMLDPAYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>gb|EPS61898.1| hypothetical protein M569_12892, partial [Genlisea aurea]
Length=145

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  225  LIFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFL  404
            ++F+ S    E+GY+ + L REAQ RWLKP EV FILQN  + Q++   P KP  GSLFL
Sbjct  3    VVFVTSFRFMESGYDLAQLAREAQIRWLKPPEVFFILQNCNDQQLSSNVPHKPPGGSLFL  62

Query  405  FNKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWM  584
            +NKRVL+ FRKDGHSWR++ D RT  EAHERLKVG+ EAL+CYYAHGE+NPN  RR +WM
Sbjct  63   YNKRVLKSFRKDGHSWRKRTDQRTAREAHERLKVGNVEALSCYYAHGEENPNLCRRCFWM  122

Query  585  LDPAYEHIVLVHYR  626
            LDPAYEHIVLV YR
Sbjct  123  LDPAYEHIVLVQYR  136



>emb|CDY12637.1| BnaA02g13050D [Brassica napus]
Length=1034

 Score =   204 bits (519),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = +3

Query  189  DLAAIRYGFSA*LIFLFSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHE  368
            D+ ++  G  + LI + S       Y  S+L  EAQ RWLKP EV FILQNHE +Q+AH 
Sbjct  8    DICSVSTGQVSYLIIMQSE------YEISNLYHEAQTRWLKPPEVHFILQNHERYQLAHT  61

Query  369  PPQKPGSGSLFLFNKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGE  548
            PPQ P SGSL+LFN+RVL+FFRKDGH WRRK+DGR + EAHERLKVG+ EAL+CYY HGE
Sbjct  62   PPQNPPSGSLYLFNRRVLKFFRKDGHQWRRKKDGRAIAEAHERLKVGNVEALSCYYVHGE  121

Query  549  QNPNFQRRSYWMLDPAYEHIVLVHYR  626
             +P FQRR YWMLDP Y+HIVLVHYR
Sbjct  122  HDPTFQRRIYWMLDPEYDHIVLVHYR  147



>emb|CDY51184.1| BnaC02g45620D [Brassica napus]
Length=1025

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  237  FSRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKR  416
            F  I+ ++ Y  S L +EA  RWLKP EV FILQNHE +Q+AH PPQ P SGSL+LFN+R
Sbjct  8    FISIIMQSEYEISTLYQEAHTRWLKPPEVHFILQNHERYQLAHTPPQNPTSGSLYLFNRR  67

Query  417  VLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPA  596
            VL+FFRKDGH WRRK+DGR + EAHERLKVG+ EAL+CYY HGE +P FQRR YWMLDP 
Sbjct  68   VLKFFRKDGHQWRRKKDGRAIAEAHERLKVGNVEALSCYYVHGEHDPTFQRRIYWMLDPE  127

Query  597  YEHIVLVHYR  626
            Y+HIVLVHYR
Sbjct  128  YDHIVLVHYR  137



>ref|XP_010449343.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010449344.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010449345.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
Length=1595

 Score =   204 bits (520),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  + L +EAQ RWLKP EVLFILQNHE   + H  PQ+P SGSLFLFN++VL+FFR
Sbjct  4    QSEYEITTLYQEAQIRWLKPPEVLFILQNHERLTLTHTAPQRPTSGSLFLFNRKVLKFFR  63

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRRK+DGR + EAHERLKVG+ +ALNCYYAHGE +P FQRR YWMLDP YEHIVL
Sbjct  64   KDGHQWRRKKDGRAIAEAHERLKVGNVDALNCYYAHGEHSPTFQRRIYWMLDPEYEHIVL  123

Query  615  VHYR  626
            VHYR
Sbjct  124  VHYR  127



>ref|XP_007163775.1| hypothetical protein PHAVU_001G263000g [Phaseolus vulgaris]
 gb|ESW35769.1| hypothetical protein PHAVU_001G263000g [Phaseolus vulgaris]
Length=966

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN  DL +EA+ RWLKP EVL IL+N++  ++ H+PP +P  GSL+LFNKRV RFFRKDG
Sbjct  7    YNIDDLFQEARKRWLKPVEVLCILRNYDMCELTHQPPHQPAGGSLYLFNKRVTRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+KRDGRTVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYW+L+P YEHIVLVHY
Sbjct  67   HNWRKKRDGRTVGEAHERLKVGNEEILNCYYAHGEENRTFQRRSYWILEPEYEHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_010439700.1| PREDICTED: probable WRKY transcription factor 52 isoform X2 [Camelina 
sativa]
Length=1594

 Score =   203 bits (517),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  S L +EAQ RWLKP EVLFILQNHE   +    PQ+P SGSLFLFN++VL+ FR
Sbjct  4    QSEYGISTLHKEAQIRWLKPPEVLFILQNHERLTLTLTAPQRPTSGSLFLFNRKVLKLFR  63

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRRK+DGRTV EAHERLKVG+ +ALNCYYAHGE NP FQRR YWMLDP YEHIVL
Sbjct  64   KDGHHWRRKKDGRTVAEAHERLKVGNTDALNCYYAHGEHNPTFQRRIYWMLDPEYEHIVL  123

Query  615  VHYR  626
            VHYR
Sbjct  124  VHYR  127



>ref|XP_010470634.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Camelina sativa]
Length=971

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQTRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010470633.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Camelina sativa]
Length=972

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQTRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009385485.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=921

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M +  ++ + L +E Q RWLKP EVLFILQNHE  +I  +PPQKP SGSLFLFN+RVLR+
Sbjct  1    MMQRDFDINKLSKETQFRWLKPVEVLFILQNHETFEITQKPPQKPPSGSLFLFNRRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DGHSWR+KR+G+T+ E HERLK+G+ EA+NCYYAHGE N  FQRRSYWMLDPA++HI
Sbjct  61   FRNDGHSWRKKRNGKTIREGHERLKIGNYEAINCYYAHGEPNSCFQRRSYWMLDPAFDHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>ref|XP_006591445.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Glycine max]
Length=910

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+  DL +EA+ RWLKP E L+IL+NH+  +  H+PP +P  GSLFLFN+R++R FRKDG
Sbjct  6    YSIDDLFQEAKRRWLKPVEALYILRNHDQCKFTHQPPHQPAGGSLFLFNRRIMRSFRKDG  65

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DG+TVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYWML+P Y+HIVLVHY
Sbjct  66   HNWRKKKDGKTVGEAHERLKVGNVEILNCYYAHGEENRTFQRRSYWMLEPEYDHIVLVHY  125

Query  624  R  626
            R
Sbjct  126  R  126



>gb|KHN44450.1| Calmodulin-binding transcription activator 4 [Glycine soja]
Length=944

 Score =   199 bits (506),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+  DL +EA+ RWLKP E L+IL+NH+  +  H+PP +P  GSLFLFN+R++R FRKDG
Sbjct  6    YSIDDLFQEAKRRWLKPVEALYILRNHDQCKFTHQPPHQPAGGSLFLFNRRIMRSFRKDG  65

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DG+TVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYWML+P Y+HIVLVHY
Sbjct  66   HNWRKKKDGKTVGEAHERLKVGNVEILNCYYAHGEENRTFQRRSYWMLEPEYDHIVLVHY  125

Query  624  R  626
            R
Sbjct  126  R  126



>gb|EMS56809.1| Calmodulin-binding transcription activator 1 [Triticum urartu]
Length=1159

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
            G++ + L+REA+ RWLKP+EV +IL NHE  QI HEPP KP SG+LFL+N+RV RFFRKD
Sbjct  141  GFDINVLLREAKSRWLKPSEVYYILLNHEQLQITHEPPNKPPSGALFLYNRRVNRFFRKD  200

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            G++WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAY+HIVLV 
Sbjct  201  GYAWRRKKDGRTVGEAHERLKVGNIDALSCYYAHGEQNPYFQRRCFWMLEPAYDHIVLVQ  260

Query  621  YR  626
            YR
Sbjct  261  YR  262



>ref|XP_003537532.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Glycine max]
Length=950

 Score =   199 bits (505),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+  DL +EA+ RWLKP E L+IL+NH+  +  H+PP +P  GSLFLFN+R++R FRKDG
Sbjct  6    YSIDDLFQEAKRRWLKPVEALYILRNHDQCKFTHQPPHQPAGGSLFLFNRRIMRSFRKDG  65

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DG+TVGEAHERLKVG+ E LNCYYAHGE+N  FQRRSYWML+P Y+HIVLVHY
Sbjct  66   HNWRKKKDGKTVGEAHERLKVGNVEILNCYYAHGEENRTFQRRSYWMLEPEYDHIVLVHY  125

Query  624  R  626
            R
Sbjct  126  R  126



>ref|XP_011071238.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Sesamum indicum]
Length=962

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M ++GY+ + L+REAQ RWLKP EV  ILQN+E HQ+ H+ PQKP SGSL+LFNK+VLRF
Sbjct  1    MMQSGYDINHLVREAQTRWLKPVEVFLILQNYEEHQLTHQIPQKPPSGSLYLFNKQVLRF  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH WRR+RD RT+ EAHERLKVG+ EALNCYYAHGE+N NFQRRSYWMLDP YEHI
Sbjct  61   FRKDGHRWRRRRDQRTIAEAHERLKVGNVEALNCYYAHGEENSNFQRRSYWMLDPKYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|EMT24284.1| Calmodulin-binding transcription activator 4 [Aegilops tauschii]
Length=1152

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  243  RIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVL  422
            ++     ++ + L+REA+ RWLKP+EV +IL NHE  QI HEPP KP SG+LFL+N+RV 
Sbjct  128  QVTMSQSFDINVLLREAKSRWLKPSEVYYILLNHEQLQITHEPPNKPPSGALFLYNRRVN  187

Query  423  RFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYE  602
            RFFRKDG++WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAY+
Sbjct  188  RFFRKDGYAWRRKKDGRTVGEAHERLKVGNIDALSCYYAHGEQNPYFQRRCFWMLEPAYD  247

Query  603  HIVLVHYR  626
            HIVLV YR
Sbjct  248  HIVLVQYR  255



>ref|XP_009385487.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +E Q RWLKP EVLFILQNHE  +I  +PPQKP SGSLFLFN+RVLR+FR DG
Sbjct  8    FDINKLSKETQFRWLKPVEVLFILQNHETFEITQKPPQKPPSGSLFLFNRRVLRYFRNDG  67

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+KR+G+T+ E HERLK+G+ EA+NCYYAHGE N  FQRRSYWMLDPA++HIVLVHY
Sbjct  68   HSWRKKRNGKTIREGHERLKIGNYEAINCYYAHGEPNSCFQRRSYWMLDPAFDHIVLVHY  127

Query  624  R  626
            R
Sbjct  128  R  128



>ref|XP_009385484.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=923

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +E Q RWLKP EVLFILQNHE  +I  +PPQKP SGSLFLFN+RVLR+FR DG
Sbjct  8    FDINKLSKETQFRWLKPVEVLFILQNHETFEITQKPPQKPPSGSLFLFNRRVLRYFRNDG  67

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+KR+G+T+ E HERLK+G+ EA+NCYYAHGE N  FQRRSYWMLDPA++HIVLVHY
Sbjct  68   HSWRKKRNGKTIREGHERLKIGNYEAINCYYAHGEPNSCFQRRSYWMLDPAFDHIVLVHY  127

Query  624  R  626
            R
Sbjct  128  R  128



>ref|XP_010439695.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010439696.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010439697.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010439698.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
 ref|XP_010439699.1| PREDICTED: probable WRKY transcription factor 52 isoform X1 [Camelina 
sativa]
Length=1618

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  240  SRIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRV  419
            S +  ++ Y  S L +EAQ RWLKP EVLFILQNHE   +    PQ+P SGSLFLFN++V
Sbjct  23   SPMAMQSEYGISTLHKEAQIRWLKPPEVLFILQNHERLTLTLTAPQRPTSGSLFLFNRKV  82

Query  420  LRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAY  599
            L+ FRKDGH WRRK+DGRTV EAHERLKVG+ +ALNCYYAHGE NP FQRR YWMLDP Y
Sbjct  83   LKLFRKDGHHWRRKKDGRTVAEAHERLKVGNTDALNCYYAHGEHNPTFQRRIYWMLDPEY  142

Query  600  EHIVLVHYR  626
            EHIVLVHYR
Sbjct  143  EHIVLVHYR  151



>gb|EYU42083.1| hypothetical protein MIMGU_mgv1a000863mg [Erythranthe guttata]
Length=956

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            L+ +   RWLKP EV FIL+N+E HQ+ H+ PQKP SGSL+LFNKRVL+FFRKDGHSWRR
Sbjct  25   LVYKLNYRWLKPVEVFFILKNYEEHQLTHQIPQKPASGSLYLFNKRVLKFFRKDGHSWRR  84

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            ++D +T  EAHERLKVG+ EALNCYYAHGE+NP+FQRRSYW+LD  YEHIVLVHYR
Sbjct  85   RKDQKTFAEAHERLKVGNVEALNCYYAHGEENPSFQRRSYWILDREYEHIVLVHYR  140



>gb|AES72007.2| calmodulin-binding protein [Medicago truncatula]
Length=958

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL +EA+ RWLKP EVL+ILQNH+  +    P  +P  GS++LFNKRV+RFFRKDG
Sbjct  7    YNINDLFQEAKKRWLKPIEVLYILQNHDTCKFTDFPLNQPRGGSVYLFNKRVMRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DGRTV EAHERLKVG+ EALNCYYAHGE+N +FQRRSYWML+P YEH+VLVHY
Sbjct  67   HNWRKKKDGRTVSEAHERLKVGNVEALNCYYAHGEENRSFQRRSYWMLNPEYEHVVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_010415302.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Camelina sativa]
Length=969

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQSRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010415300.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Camelina sativa]
Length=970

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQSRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>gb|KFK41134.1| hypothetical protein AALP_AA2G090200 [Arabis alpina]
Length=1045

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  S L +EAQ RWLKP EV FILQNHE +Q+ H+ PQKP SGSLFLFNK  L+FFR
Sbjct  2    QSEYEISVLYQEAQTRWLKPPEVHFILQNHERYQLTHKAPQKPTSGSLFLFNKNELKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRRK+DGR + EAHERLKVG+AEALNCYYAHGE +P+FQRR YWMLD  Y+HIVL
Sbjct  62   KDGHQWRRKKDGRAIAEAHERLKVGNAEALNCYYAHGEHDPHFQRRIYWMLDEEYKHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>gb|KFK41133.1| hypothetical protein AALP_AA2G090200 [Arabis alpina]
Length=1046

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  S L +EAQ RWLKP EV FILQNHE +Q+ H+ PQKP SGSLFLFNK  L+FFR
Sbjct  2    QSEYEISVLYQEAQTRWLKPPEVHFILQNHERYQLTHKAPQKPTSGSLFLFNKNELKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRRK+DGR + EAHERLKVG+AEALNCYYAHGE +P+FQRR YWMLD  Y+HIVL
Sbjct  62   KDGHQWRRKKDGRAIAEAHERLKVGNAEALNCYYAHGEHDPHFQRRIYWMLDEEYKHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010511652.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Camelina sativa]
Length=976

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQTRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010511653.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Camelina sativa]
Length=975

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y+ S L +EAQ RWLKP EV FILQNHE   +    PQ+P SGSLFLFN+RVL+FFR
Sbjct  2    QSEYDISTLYQEAQTRWLKPPEVQFILQNHERLTLTDVAPQRPTSGSLFLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+AEAL CYYAHGE +P F+RR YWMLDP YEHIVL
Sbjct  62   KDGHQWRKKRDGRAIAEAHERLKVGNAEALTCYYAHGEHDPTFRRRIYWMLDPEYEHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009127544.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Brassica rapa]
Length=1012

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  S+L  EAQ RWLKP EV FILQNHE +Q+ H+ PQ P SGSL LFN+RVL+FFR
Sbjct  2    QSEYEISNLYHEAQTRWLKPPEVHFILQNHERYQLTHKAPQNPPSGSLLLFNRRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WRRK+DGR + EAHERLKVG+ EAL+CYY HGE +P FQRR YWMLDP Y+HIVL
Sbjct  62   KDGHQWRRKKDGRAIAEAHERLKVGNVEALSCYYVHGEHDPTFQRRIYWMLDPEYDHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009412761.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=876

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M +AG++ + L  EAQ RWLKP EVL+ILQ HE+ +I  +PPQKP SGSLFLFN+RVLR+
Sbjct  3    MIQAGFDINKLSEEAQSRWLKPVEVLYILQKHESFKITQKPPQKPPSGSLFLFNRRVLRY  62

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG+SW++K++G+T  E HERLKVG++EA+NCYYA GE+N   QRRSYWMLDPAYEHI
Sbjct  63   FRNDGYSWQKKKNGKTAREGHERLKVGNSEAINCYYARGEKNSCIQRRSYWMLDPAYEHI  122

Query  609  VLVHYR  626
             LVHYR
Sbjct  123  ALVHYR  128



>ref|XP_008664138.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Zea mays]
Length=801

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
             ++ + L  EA+ RWLKP+EV +ILQNHE   I HE P+KP SGSLFL+N+RV R+FR+D
Sbjct  4    SFDINVLREEARSRWLKPSEVYYILQNHERFPITHEAPKKPPSGSLFLYNRRVNRYFRRD  63

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            GH+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP+FQRR +WML+PAYEHIVLV 
Sbjct  64   GHTWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPSFQRRCFWMLEPAYEHIVLVQ  123

Query  621  YR  626
            YR
Sbjct  124  YR  125



>ref|XP_009412760.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=895

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M +AG++ + L  EAQ RWLKP EVL+ILQ HE+ +I  +PPQKP SGSLFLFN+RVLR+
Sbjct  3    MIQAGFDINKLSEEAQSRWLKPVEVLYILQKHESFKITQKPPQKPPSGSLFLFNRRVLRY  62

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG+SW++K++G+T  E HERLKVG++EA+NCYYA GE+N   QRRSYWMLDPAYEHI
Sbjct  63   FRNDGYSWQKKKNGKTAREGHERLKVGNSEAINCYYARGEKNSCIQRRSYWMLDPAYEHI  122

Query  609  VLVHYR  626
             LVHYR
Sbjct  123  ALVHYR  128



>ref|XP_009412758.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M +AG++ + L  EAQ RWLKP EVL+ILQ HE+ +I  +PPQKP SGSLFLFN+RVLR+
Sbjct  3    MIQAGFDINKLSEEAQSRWLKPVEVLYILQKHESFKITQKPPQKPPSGSLFLFNRRVLRY  62

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG+SW++K++G+T  E HERLKVG++EA+NCYYA GE+N   QRRSYWMLDPAYEHI
Sbjct  63   FRNDGYSWQKKKNGKTAREGHERLKVGNSEAINCYYARGEKNSCIQRRSYWMLDPAYEHI  122

Query  609  VLVHYR  626
             LVHYR
Sbjct  123  ALVHYR  128



>ref|XP_010239809.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X1 [Brachypodium distachyon]
Length=1028

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = +3

Query  237  FSRIMT-EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNK  413
             S+I++   G++ + L++EA+ RWLKP+EV +IL NHE   I HEPP KP SGSLFL+N+
Sbjct  1    MSQILSLVVGFDINVLLKEARSRWLKPSEVYYILLNHERLPITHEPPNKPPSGSLFLYNR  60

Query  414  RVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDP  593
            RV RFFRKDG++WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHG++NP FQRR +WML+P
Sbjct  61   RVNRFFRKDGYAWRRKKDGRTVGEAHERLKVGNLDALSCYYAHGDENPCFQRRCFWMLEP  120

Query  594  AYEHIVLVHYR  626
            AY+HIVLV YR
Sbjct  121  AYDHIVLVQYR  131



>gb|EEC77173.1| hypothetical protein OsI_15659 [Oryza sativa Indica Group]
Length=915

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLFL+N+RV R+FR+DG
Sbjct  24   FDINVLHKEARSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRRDG  83

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  84   HAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  143

Query  624  R  626
            R
Sbjct  144  R  144



>emb|CAE05533.2| OSJNBa0053B21.7 [Oryza sativa Japonica Group]
Length=952

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
             ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLFL+N+RV R+FR+D
Sbjct  4    SFDINVLHKEARSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRRD  63

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            GH+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV 
Sbjct  64   GHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQ  123

Query  621  YR  626
            YR
Sbjct  124  YR  125



>emb|CAH66427.1| OSIGBa0096P03.1 [Oryza sativa Indica Group]
Length=952

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
             ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLFL+N+RV R+FR+D
Sbjct  4    SFDINVLHKEARSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRRD  63

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            GH+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV 
Sbjct  64   GHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQ  123

Query  621  YR  626
            YR
Sbjct  124  YR  125



>gb|EEE60893.1| hypothetical protein OsJ_14576 [Oryza sativa Japonica Group]
Length=971

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLFL+N+RV R+FR+DG
Sbjct  24   FDINVLHKEARSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRRDG  83

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  84   HAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  143

Query  624  R  626
            R
Sbjct  144  R  144



>ref|NP_001052630.1| Os04g0388500 [Oryza sativa Japonica Group]
 dbj|BAF14544.1| Os04g0388500 [Oryza sativa Japonica Group]
Length=1003

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLFL+N+RV R+FR+DG
Sbjct  5    FDINVLHKEARSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFLYNRRVNRYFRRDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  65   HAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  124

Query  624  R  626
            R
Sbjct  125  R  125



>gb|KEH35249.1| calmodulin-binding protein [Medicago truncatula]
Length=917

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL +EA+ RWLKP EVL+ILQNH+  +    P  +P  GS++LFNKRV+RFFRKDG
Sbjct  7    YNINDLFQEAKKRWLKPIEVLYILQNHDTCKFTDFPLNQPRGGSVYLFNKRVMRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DGRTV EAHERLKVG+ EALNCYYAHGE+N +FQRRSYWML+P YEH+VLVHY
Sbjct  67   HNWRKKKDGRTVSEAHERLKVGNVEALNCYYAHGEENRSFQRRSYWMLNPEYEHVVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_009415886.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Musa acuminata subsp. malaccensis]
Length=1060

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
            G++ + L +EAQ RWLKP+EV FILQN++   +  EPP  P SGSLFLFN++VLRFFRKD
Sbjct  4    GFDINVLCQEAQKRWLKPSEVFFILQNYKQFPLTPEPPHLPPSGSLFLFNRKVLRFFRKD  63

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            G+ WR+K+DGRT+GEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WMLDPAY HIVLVH
Sbjct  64   GYMWRKKKDGRTIGEAHERLKVGNVDALSCYYAHGEQNPYFQRRIFWMLDPAYGHIVLVH  123

Query  621  YR  626
            YR
Sbjct  124  YR  125



>ref|XP_004502279.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Cicer arietinum]
Length=962

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQN-HENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
            YN +DL +EA+ RWLKP EVL+ILQN H   +  + PP +P  GS++LFNKRV+RFFRKD
Sbjct  7    YNINDLFQEAKRRWLKPIEVLYILQNQHNTCEFTNVPPHQPSGGSVYLFNKRVMRFFRKD  66

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            GH+WR+K+DGRTV EAHERLKVG+ EALNCYYAHGE+N +FQRRSYWML+P YEHIVLVH
Sbjct  67   GHNWRKKKDGRTVSEAHERLKVGNFEALNCYYAHGEENRSFQRRSYWMLNPEYEHIVLVH  126

Query  621  YR  626
            YR
Sbjct  127  YR  128



>ref|XP_004975407.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Setaria italica]
Length=1011

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L  EA+ RWLKP+EV +ILQNHE   I HE P+KP SGSLFL+N+RV R+FR+DG
Sbjct  5    FDINVLREEARSRWLKPSEVYYILQNHERFPITHEAPKKPLSGSLFLYNRRVNRYFRRDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  65   HTWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_006652212.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Oryza brachyantha]
Length=1011

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L +EA+ RWLKP+EV +ILQNHE   I  EPP+KP SGSLF++N+RV R+FR+DG
Sbjct  5    FDINVLHKEAKSRWLKPSEVYYILQNHERFPITPEPPKKPPSGSLFIYNRRVNRYFRRDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  65   HAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_008667152.1| PREDICTED: uncharacterized protein LOC100193150 isoform X1 [Zea 
mays]
 ref|XP_008667153.1| PREDICTED: uncharacterized protein LOC100193150 isoform X1 [Zea 
mays]
 tpg|DAA38155.1| TPA: hypothetical protein ZEAMMB73_559848 [Zea mays]
Length=996

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L  EA+ RWLKP+EV +ILQNHE   I HE P+KP SGSLFL+N+RV R+FR+DG
Sbjct  5    FDINVLREEARSRWLKPSEVYYILQNHERFPITHEAPKKPPSGSLFLYNRRVNRYFRRDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WRRK+DGRTVGEAHERLKVG+ ++L+CYYAHGEQNP FQRR +WML+PAYEHIVLV Y
Sbjct  65   HTWRRKKDGRTVGEAHERLKVGNVDSLSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_003601756.1| Calmodulin-binding transcription activator [Medicago truncatula]
Length=1081

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            YN +DL +EA+ RWLKP EVL+ILQNH+  +    P  +P  GS++LFNKRV+RFFRKDG
Sbjct  7    YNINDLFQEAKKRWLKPIEVLYILQNHDTCKFTDFPLNQPRGGSVYLFNKRVMRFFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H+WR+K+DGRTV EAHERLKVG+ EALNCYYAHGE+N +FQRRSYWML+P YEH+VLVHY
Sbjct  67   HNWRKKKDGRTVSEAHERLKVGNVEALNCYYAHGEENRSFQRRSYWMLNPEYEHVVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_010239810.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Brachypodium distachyon]
Length=1022

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L++EA+ RWLKP+EV +IL NHE   I HEPP KP SGSLFL+N+RV RFFRKDG
Sbjct  5    FDINVLLKEARSRWLKPSEVYYILLNHERLPITHEPPNKPPSGSLFLYNRRVNRFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            ++WRRK+DGRTVGEAHERLKVG+ +AL+CYYAHG++NP FQRR +WML+PAY+HIVLV Y
Sbjct  65   YAWRRKKDGRTVGEAHERLKVGNLDALSCYYAHGDENPCFQRRCFWMLEPAYDHIVLVQY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_009385632.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385633.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385634.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385635.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385636.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Musa acuminata subsp. malaccensis]
Length=226

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  ILQNH    IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILVEAQDRWLRPAEICEILQNHRKFHIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N  FQRRSYWMLD    HIVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHERLKVGSVDMLHCYYAHGEENEKFQRRSYWMLDEELMHIVLVHYR  133



>ref|XP_008806417.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Phoenix dactylifera]
Length=1077

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L +EAQ RWLKP EVLFIL N+E+ Q++++PP KP SGSLFLFN+RVLR FR
Sbjct  2    QPGFDMNKLCKEAQTRWLKPVEVLFILHNYESFQLSNKPPDKPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DGH WR+K +GRT+ EAHERLKVG+AE L+CYYA GEQNP FQRR YWMLDPAY HIV 
Sbjct  62   NDGHLWRKKNNGRTLAEAHERLKVGNAEVLSCYYARGEQNPCFQRRIYWMLDPAYGHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009412759.1| PREDICTED: calmodulin-binding transcription activator 4 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=921

 Score =   189 bits (480),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
            G++ + L  EAQ RWLKP EVL+ILQ HE+ +I  +PPQKP SGSLFLFN+RVLR+FR D
Sbjct  2    GFDINKLSEEAQSRWLKPVEVLYILQKHESFKITQKPPQKPPSGSLFLFNRRVLRYFRND  61

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            G+SW++K++G+T  E HERLKVG++EA+NCYYA GE+N   QRRSYWMLDPAYEHI LVH
Sbjct  62   GYSWQKKKNGKTAREGHERLKVGNSEAINCYYARGEKNSCIQRRSYWMLDPAYEHIALVH  121

Query  621  YR  626
            YR
Sbjct  122  YR  123



>ref|XP_010909839.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X4 [Elaeis guineensis]
Length=888

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L REAQ RWLKP EVLFILQN+E+ Q+ H+PP KP SGSLFLFN+RVLR FR
Sbjct  2    QPGFDINKLRREAQTRWLKPIEVLFILQNYESFQLTHKPPLKPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DGH WR+K +GRT+ EAHERLKV + E L CYYA GEQN  FQRR YWMLDP YEHIV 
Sbjct  62   NDGHLWRKKSNGRTLAEAHERLKVANIEVLACYYARGEQNQCFQRRVYWMLDPTYEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010909837.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Elaeis guineensis]
Length=908

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L REAQ RWLKP EVLFILQN+E+ Q+ H+PP KP SGSLFLFN+RVLR FR
Sbjct  2    QPGFDINKLRREAQTRWLKPIEVLFILQNYESFQLTHKPPLKPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DGH WR+K +GRT+ EAHERLKV + E L CYYA GEQN  FQRR YWMLDP YEHIV 
Sbjct  62   NDGHLWRKKSNGRTLAEAHERLKVANIEVLACYYARGEQNQCFQRRVYWMLDPTYEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_010909834.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010909835.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Elaeis guineensis]
Length=942

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L REAQ RWLKP EVLFILQN+E+ Q+ H+PP KP SGSLFLFN+RVLR FR
Sbjct  2    QPGFDINKLRREAQTRWLKPIEVLFILQNYESFQLTHKPPLKPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DGH WR+K +GRT+ EAHERLKV + E L CYYA GEQN  FQRR YWMLDP YEHIV 
Sbjct  62   NDGHLWRKKSNGRTLAEAHERLKVANIEVLACYYARGEQNQCFQRRVYWMLDPTYEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_009105274.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Brassica rapa]
Length=992

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ S L REA  RWLKP EV FIL NHE +++  +PP KP SGS+ L+NKRVL+FFRKDG
Sbjct  5    YDVSTLYREAHTRWLKPPEVHFILLNHERYRLTDKPPHKPSSGSVLLYNKRVLKFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H W+RK+DGR + EAHERLKVG+ EAL CYYAHGE  P+FQRR YW+LDP YEHI LVHY
Sbjct  65   HQWKRKKDGRAIAEAHERLKVGNVEALQCYYAHGEHEPSFQRRIYWILDPEYEHIALVHY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_009105273.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Brassica rapa]
Length=993

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ S L REA  RWLKP EV FIL NHE +++  +PP KP SGS+ L+NKRVL+FFRKDG
Sbjct  5    YDVSTLYREAHTRWLKPPEVHFILLNHERYRLTDKPPHKPSSGSVLLYNKRVLKFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H W+RK+DGR + EAHERLKVG+ EAL CYYAHGE  P+FQRR YW+LDP YEHI LVHY
Sbjct  65   HQWKRKKDGRAIAEAHERLKVGNVEALQCYYAHGEHEPSFQRRIYWILDPEYEHIALVHY  124

Query  624  R  626
            R
Sbjct  125  R  125



>ref|XP_009105129.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Brassica rapa]
Length=988

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y    L +EAQ RWLKP EV FIL+NHE +++ H+ P KP SGSL L+NKRVL+FFR
Sbjct  2    QSEYEIRTLNQEAQTRWLKPPEVYFILKNHERYELTHKAPHKPTSGSLCLYNKRVLKFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            KDGH WR+KRDGR + EAHERLKVG+ EALNCYYAHGE +P+FQRR +WMLD  Y+HIVL
Sbjct  62   KDGHHWRKKRDGRAIAEAHERLKVGNVEALNCYYAHGEHDPSFQRRIFWMLDLEYDHIVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>emb|CDY28897.1| BnaC06g26850D [Brassica napus]
Length=976

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y    L +EAQ RWLKP EV FIL+NH+ +++ H+ P KP SGSL LFNKRVL+FFRKDG
Sbjct  5    YEIRTLNQEAQTRWLKPPEVYFILKNHDRYELTHKAPHKPTSGSLCLFNKRVLKFFRKDG  64

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WR+KRDGR + EAHERLKVG+ EALNCYYAHGE +P+FQRR +WMLD  Y+HIVLVHY
Sbjct  65   HHWRKKRDGRAIAEAHERLKVGNVEALNCYYAHGEHDPSFQRRIFWMLDLEYDHIVLVHY  124

Query  624  R  626
            R
Sbjct  125  R  125



>emb|CDY01799.1| BnaC06g28390D [Brassica napus]
Length=1025

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +3

Query  240  SRIM--TEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNK  413
            SRI+   ++ Y+ S L +EA  RWLKP EV FIL NHE +++  +PP KP SGS+ L+NK
Sbjct  28   SRILLAMQSEYDVSTLYQEAHTRWLKPPEVHFILLNHERYRLTDKPPHKPTSGSVLLYNK  87

Query  414  RVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDP  593
            RVL+FFRKDGH W+RK+DGR + EAHERLKVG+ EAL CYYAHGE  P+FQRR YW+LDP
Sbjct  88   RVLKFFRKDGHQWKRKKDGRAIAEAHERLKVGNVEALQCYYAHGEHEPSFQRRIYWILDP  147

Query  594  AYEHIVLVHYR  626
             YEHI LVHYR
Sbjct  148  EYEHIALVHYR  158



>dbj|BAK00552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1096

 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +3

Query  261   GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
             G++ + L+REA+ RWLKP+EV +IL NHE  QI HEPP +P SGSLFL+N RV RFFRKD
Sbjct  946   GFDINVLLREARSRWLKPSEVYYILLNHEQLQITHEPPNRPPSGSLFLYNSRVNRFFRKD  1005

Query  441   GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
             GH+WRRKRDGRTV EAHERLKVG+   L+CYYAHGEQN  FQRR + ML+PAY+HIVLV 
Sbjct  1006  GHAWRRKRDGRTVREAHERLKVGNVHTLSCYYAHGEQNLCFQRRCFRMLEPAYDHIVLVQ  1065

Query  621   YR  626
             YR
Sbjct  1066  YR  1067



>emb|CDY07431.1| BnaA07g25100D [Brassica napus]
Length=965

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y    L +EAQ RWLKP EV FIL+NHE +++ H+ P KP SGSL L+NKRVL+FFRKDG
Sbjct  27   YEIRTLNQEAQTRWLKPPEVYFILKNHERYELTHKAPHKPTSGSLCLYNKRVLKFFRKDG  86

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            H WR+KRDGR + EAHERLKVG+ EALNCYYAHGE +P+FQRR +WMLD  Y+HIVLVHY
Sbjct  87   HHWRKKRDGRAIAEAHERLKVGNVEALNCYYAHGEHDPSFQRRIFWMLDLEYDHIVLVHY  146

Query  624  R  626
            R
Sbjct  147  R  147



>ref|XP_008790758.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Phoenix dactylifera]
Length=965

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L +EA  RWLKP EVLFILQNHE+ Q+ H+PP +P SGSLFLFN+RVLR FR
Sbjct  2    QPGFDINKLRKEAHTRWLKPIEVLFILQNHESFQLTHKPPVEPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DG  WR+K +GRT+ E+HERLKVG+ E L CYYA GEQNP FQRR YWMLDPA+EHIV 
Sbjct  62   NDGLLWRKKNNGRTLAESHERLKVGNTEVLACYYARGEQNPCFQRRVYWMLDPAHEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_008790759.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Phoenix dactylifera]
Length=952

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L +EA  RWLKP EVLFILQNHE+ Q+ H+PP +P SGSLFLFN+RVLR FR
Sbjct  2    QPGFDINKLRKEAHTRWLKPIEVLFILQNHESFQLTHKPPVEPPSGSLFLFNRRVLRNFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DG  WR+K +GRT+ E+HERLKVG+ E L CYYA GEQNP FQRR YWMLDPA+EHIV 
Sbjct  62   NDGLLWRKKNNGRTLAESHERLKVGNTEVLACYYARGEQNPCFQRRVYWMLDPAHEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_004971097.1| PREDICTED: calmodulin-binding transcription activator 4-like 
[Setaria italica]
Length=857

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M + G +   L +E + RWLKP EVL ILQNHE   ++H+PPQKP SGS FLFN+RVLR+
Sbjct  1    MQQQGLDIHKLQQEVKTRWLKPQEVLQILQNHELFMVSHKPPQKPPSGSWFLFNRRVLRY  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG  W++K++G+T+ EAHERLKV + EALNCYYA G++NP FQRR YWMLDPAYEHI
Sbjct  61   FRNDGFEWQKKKNGKTINEAHERLKVDNVEALNCYYARGDKNPTFQRRIYWMLDPAYEHI  120

Query  609  VLVHYR  626
            V VHYR
Sbjct  121  VFVHYR  126



>dbj|BAJ96413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   182 bits (463),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ N +IA EPP  P SGSLFLF+++VLRFFRKDGH
Sbjct  14   DMEQILKEAQTRWLRPTEICEILKNYRNFRIAPEPPNMPASGSLFLFDRKVLRFFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_009386381.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009386382.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=225

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  +LQN+   +IA EPP++P SGS+FLF+++VLR+FRKDGH
Sbjct  14   DIEQILVEAQHRWLRPAEICEVLQNYRKFRIAPEPPRRPQSGSIFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N NFQRRSYWML+    +IVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHERLKVGSVDMLHCYYAHGEENENFQRRSYWMLEGGLMNIVLVHYR  133



>ref|XP_009386379.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009386380.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=232

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  +LQN+   +IA EPP++P SGS+FLF+++VLR+FRKDGH
Sbjct  14   DIEQILVEAQHRWLRPAEICEVLQNYRKFRIAPEPPRRPQSGSIFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N NFQRRSYWML+    +IVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHERLKVGSVDMLHCYYAHGEENENFQRRSYWMLEGGLMNIVLVHYR  133



>ref|XP_008673284.1| PREDICTED: uncharacterized protein LOC100384320 isoform X1 [Zea 
mays]
 tpg|DAA56074.1| TPA: hypothetical protein ZEAMMB73_061949 [Zea mays]
Length=842

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G +   L    + RWLKP EVL ILQNHE   I+H+PPQKP SGS FLFN+RVLR+FR
Sbjct  5    QQGLDIGKLQEVVKTRWLKPQEVLKILQNHELFTISHKPPQKPQSGSWFLFNRRVLRYFR  64

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DG  W++KR+G+T+ EAHERLKV + +ALNCYYA G++NP FQRR YWMLDPAYEHIVL
Sbjct  65   NDGFEWQKKRNGKTINEAHERLKVDNVDALNCYYARGDKNPTFQRRIYWMLDPAYEHIVL  124

Query  615  VHYR  626
            VHYR
Sbjct  125  VHYR  128



>ref|XP_010926833.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Elaeis guineensis]
Length=940

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++ + L ++AQ RWLKP EVLFIL NHE+ Q++++PP KP SGSL LFN+RVLR +R
Sbjct  2    QEGFDINKLCKDAQTRWLKPVEVLFILHNHESFQLSNKPPDKPPSGSLLLFNRRVLRNYR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DG+ WR+K +GRT+ E+HE LKVG+AE L+CYYA GEQNP FQRR YWMLDPA EHIV 
Sbjct  62   NDGYLWRKKNNGRTLAESHEHLKVGAAEVLSCYYARGEQNPCFQRRIYWMLDPANEHIVF  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_002972386.1| hypothetical protein SELMODRAFT_413101 [Selaginella moellendorffii]
 gb|EFJ26472.1| hypothetical protein SELMODRAFT_413101 [Selaginella moellendorffii]
Length=982

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +IREAQ RWL+P EV+ IL+N++  ++   PP KP SGSLFLF+++ LRFFRKDGH+WR+
Sbjct  21   IIREAQNRWLRPLEVIEILRNYQKFRLNPVPPNKPPSGSLFLFDRKTLRFFRKDGHNWRK  80

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            K+DG+TV EAHERLK GS + L+CYYAHGE NPNFQRRSYWML+ AYEHIVLVHYR
Sbjct  81   KKDGKTVREAHERLKAGSVDVLHCYYAHGEDNPNFQRRSYWMLEGAYEHIVLVHYR  136



>ref|XP_002971863.1| hypothetical protein SELMODRAFT_441667 [Selaginella moellendorffii]
 gb|EFJ26780.1| hypothetical protein SELMODRAFT_441667 [Selaginella moellendorffii]
Length=982

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +IREAQ RWL+P EV+ IL+N++  ++   PP KP SGSLFLF+++ LRFFRKDGH+WR+
Sbjct  21   IIREAQNRWLRPLEVIEILRNYQKFRLNPVPPNKPPSGSLFLFDRKTLRFFRKDGHNWRK  80

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            K+DG+TV EAHERLK GS + L+CYYAHGE NPNFQRRSYWML+ AYEHIVLVHYR
Sbjct  81   KKDGKTVREAHERLKAGSVDVLHCYYAHGEDNPNFQRRSYWMLEGAYEHIVLVHYR  136



>ref|XP_010449346.1| PREDICTED: probable WRKY transcription factor 52 isoform X2 [Camelina 
sativa]
Length=1584

 Score =   183 bits (465),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            ++ Y  + L +EAQ RWLKP EVLFILQNHE   + H  PQ+P SGSLFLFN++VL+FFR
Sbjct  4    QSEYEITTLYQEAQIRWLKPPEVLFILQNHERLTLTHTAPQRPTSGSLFLFNRKVLKFFR  63

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDP  593
            KDGH WRRK+DGR + EAHERLKVG+ +ALNCYYAHGE +P FQRR YWMLDP
Sbjct  64   KDGHQWRRKKDGRAIAEAHERLKVGNVDALNCYYAHGEHSPTFQRRIYWMLDP  116



>ref|XP_010926832.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Elaeis guineensis]
Length=943

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++ + L ++AQ RWLKP EVLFIL NHE+ Q++++PP KP SGSL LFN+RVLR +R DG
Sbjct  8    FDINKLCKDAQTRWLKPVEVLFILHNHESFQLSNKPPDKPPSGSLLLFNRRVLRNYRNDG  67

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            + WR+K +GRT+ E+HE LKVG+AE L+CYYA GEQNP FQRR YWMLDPA EHIV VHY
Sbjct  68   YLWRKKNNGRTLAESHEHLKVGAAEVLSCYYARGEQNPCFQRRIYWMLDPANEHIVFVHY  127

Query  624  R  626
            R
Sbjct  128  R  128



>ref|XP_004155502.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Cucumis sativus]
Length=247

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLVEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   KWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHLMHIVFVHY  132



>ref|XP_004985394.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X3 [Setaria italica]
Length=1024

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N +I  EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  3    DIEQILKEAQNRWLRPAEICEILKNYRNFRITPEPPNRPPSGSLFLFDRKVLRYFRKDGH  62

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  63   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHY  121



>ref|XP_002456865.1| hypothetical protein SORBIDRAFT_03g044220 [Sorghum bicolor]
 gb|EES01985.1| hypothetical protein SORBIDRAFT_03g044220 [Sorghum bicolor]
Length=845

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
            G +   L +  + RWLKP EVL ILQNHE   I+H+ PQKP SGS FLFN+RVLR+FR D
Sbjct  9    GLDIDKLQQVVKTRWLKPQEVLKILQNHELFTISHKTPQKPQSGSWFLFNRRVLRYFRSD  68

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVH  620
            G  W++K++G+T+ EAHERLKV + +ALNCYYA G++NP FQRR YWMLDPAYEHIVLVH
Sbjct  69   GFEWQKKKNGKTINEAHERLKVDNVDALNCYYARGDKNPTFQRRIYWMLDPAYEHIVLVH  128

Query  621  YR  626
            YR
Sbjct  129  YR  130



>ref|XP_010547650.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Tarenaya hassleriana]
Length=1037

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EAQ RWL+PAE+  IL+N++   IA EPP +P SGSLFLF+++VLR+FRKD H
Sbjct  14   DIEQLLSEAQNRWLRPAEICEILRNYQKFHIASEPPNRPPSGSLFLFDRKVLRYFRKDCH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            SWR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+P + HIV VHY
Sbjct  74   SWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENDNFQRRSYWMLEPEFMHIVFVHY  132



>ref|XP_009409289.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=242

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  252  TEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFF  431
            + +  +   ++ EA+ RWL+PAE+  ILQN+   +IA  PP +P SGSLFLF+++VLR+F
Sbjct  9    STSQLDIEQILVEARRRWLRPAEICEILQNYRKFRIAPGPPNRPPSGSLFLFDRKVLRYF  68

Query  432  RKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIV  611
            RKDGH+WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N  FQRRSYWML+    +IV
Sbjct  69   RKDGHNWRKKKDGKTVKEAHERLKVGSVDMLHCYYAHGEENEKFQRRSYWMLEADLMNIV  128

Query  612  LVHYR  626
            LVHYR
Sbjct  129  LVHYR  133



>emb|CDX96099.1| BnaA07g26320D [Brassica napus]
Length=1258

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            Y+ S L REA  RWLKP EV FIL NHE +++  +PP KP SGS+ L+NKRVL+FFRKDG
Sbjct  303  YDVSTLYREAHTRWLKPPEVHFILLNHERYRLTDKPPHKPSSGSVLLYNKRVLKFFRKDG  362

Query  444  HSWRRKRDGRTVGEAHERLK-----VGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            H W+RK+DGR + EAHERLK     VG+ EAL CYYAHGE  P+FQRR YW+LDP YEHI
Sbjct  363  HQWKRKKDGRAIAEAHERLKASYILVGNVEALQCYYAHGEHEPSFQRRIYWILDPEYEHI  422

Query  609  VLVHYR  626
             LVHYR
Sbjct  423  ALVHYR  428



>ref|XP_009409306.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  252  TEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFF  431
            + +  +   ++ EA+ RWL+PAE+  ILQN+   +IA  PP +P SGSLFLF+++VLR+F
Sbjct  9    STSQLDIEQILVEARRRWLRPAEICEILQNYRKFRIAPGPPNRPPSGSLFLFDRKVLRYF  68

Query  432  RKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIV  611
            RKDGH+WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N  FQRRSYWML+    +IV
Sbjct  69   RKDGHNWRKKKDGKTVKEAHERLKVGSVDMLHCYYAHGEENEKFQRRSYWMLEADLMNIV  128

Query  612  LVHYR  626
            LVHYR
Sbjct  129  LVHYR  133



>ref|XP_008782146.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Phoenix dactylifera]
Length=1043

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  ILQN+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKVGSVDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_008782144.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008782145.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Phoenix dactylifera]
Length=1044

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  ILQN+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLKVGS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKVGSVDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_010680539.1| PREDICTED: calmodulin-binding transcription activator 3 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=1025

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDG  443
            ++   L+ EAQ RWL+  E+  IL+N+EN  +A EPP+KP SGSLFLF+++VLR+FRKDG
Sbjct  7    FDIEQLLLEAQHRWLRTPEICEILRNYENFNVAPEPPKKPSSGSLFLFDRKVLRYFRKDG  66

Query  444  HSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            HSWR+K+DG+++ EAHERLK+GS + L+CYYAHGE+N NFQRRSYWML+    HIVLVHY
Sbjct  67   HSWRKKKDGKSIKEAHERLKIGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHY  126

Query  624  R  626
            R
Sbjct  127  R  127



>ref|XP_011097567.1| PREDICTED: calmodulin-binding transcription activator 1 [Sesamum 
indicum]
 ref|XP_011097568.1| PREDICTED: calmodulin-binding transcription activator 1 [Sesamum 
indicum]
Length=1111

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  243  RIMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVL  422
            R    A  +   ++ EAQ RWL+PAE+  ILQN++  +IA EPP +P SGSLFLF+++VL
Sbjct  6    RYALNAQLDIEQILLEAQHRWLRPAEICEILQNYKKFRIAPEPPNRPPSGSLFLFDRKVL  65

Query  423  RFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYE  602
            R+FRKDGH+WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    
Sbjct  66   RYFRKDGHNWRKKRDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELS  125

Query  603  HIVLVHYR  626
            HIVLVHYR
Sbjct  126  HIVLVHYR  133



>ref|XP_004983220.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X4 [Setaria italica]
Length=685

 Score =   176 bits (446),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  16   DIEQILKEAQHRWLRPAEICEILKNYRNFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  75

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K D +TV EAHERLK GS + L+CYYAHGE N NFQRR+YWML+  + HIVLVHY
Sbjct  76   NWRKKNDQKTVKEAHERLKSGSIDVLHCYYAHGEDNINFQRRTYWMLEEDFMHIVLVHY  134



>ref|XP_010319684.1| PREDICTED: ER66 protein isoform X1 [Solanum lycopersicum]
Length=1090

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIEQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKRDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|NP_001266168.1| ER66 protein [Solanum lycopersicum]
 gb|ADK47999.1| calmodulin-binding protein [Solanum lycopersicum]
Length=1097

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIEQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKRDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>gb|EPS74412.1| calmodulin-binding protein, partial [Genlisea aurea]
Length=126

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+PAE+  IL+N +N QIA EPP +P SGS+FLF+++  R+FR+DGH+WR+
Sbjct  4    ILLEAQNRWLRPAEISRILENFQNFQIAREPPNRPPSGSVFLFDRKQHRYFRRDGHNWRK  63

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            KRDG+TV EAHERLKVGS + L+CYYAHGE N  FQRRSYW+LD    +IV VHYR
Sbjct  64   KRDGKTVKEAHERLKVGSVDVLHCYYAHGEDNECFQRRSYWLLDEERSNIVFVHYR  119



>gb|EMT32010.1| Calmodulin-binding transcription activator 3 [Aegilops tauschii]
Length=1095

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ N +IA EPP  P SGSLFLF+++VLRFFRKDGH
Sbjct  104  DMEQILKEAQTRWLRPTEICEILKNYRNFRIAPEPPNMPASGSLFLFDRKVLRFFRKDGH  163

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  164  NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  222



>ref|XP_004504801.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X2 [Cicer arietinum]
Length=1072

 Score =   177 bits (449),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  288  EAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRRKRD  467
            EAQ RWL+PAE+  IL+N++  QI  EPP +P SGSLFLF+++VLR+FRKDGH+WR+K+D
Sbjct  23   EAQHRWLRPAEICEILKNYQMFQITPEPPSRPPSGSLFLFDRKVLRYFRKDGHNWRKKKD  82

Query  468  GRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            G+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+P   HIV VHY
Sbjct  83   GKTVREAHEKLKVGSVDVLHCYYAHGEENENFQRRSYWMLEPDMMHIVFVHY  134



>ref|XP_009763882.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Nicotiana sylvestris]
Length=1103

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIDQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_009763883.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Nicotiana sylvestris]
Length=1102

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIDQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_009613617.1| PREDICTED: calmodulin-binding transcription activator 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=1086

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIDQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_009613616.1| PREDICTED: calmodulin-binding transcription activator 3 isoform 
X2 [Nicotiana tomentosiformis]
Length=1106

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIDQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_009613615.1| PREDICTED: calmodulin-binding transcription activator 3 isoform 
X1 [Nicotiana tomentosiformis]
Length=1107

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIDQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_006649535.1| PREDICTED: calmodulin-binding transcription activator 1-like 
[Oryza brachyantha]
Length=1047

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ N +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQHRWLRPTEICEILKNYRNFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_006355338.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Solanum tuberosum]
Length=1101

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  AGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRK  437
            A  +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP +P SGSLFLF+++VLR+FRK
Sbjct  11   AQLDIEQILLEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRK  70

Query  438  DGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLV  617
            DGHSWR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLV
Sbjct  71   DGHSWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEEMSHIVLV  130

Query  618  HYR  626
            HYR
Sbjct  131  HYR  133



>ref|XP_010926296.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X3 [Elaeis guineensis]
Length=915

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+P E+  ILQN+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQRRWLRPTEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_010520931.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Tarenaya hassleriana]
Length=1074

 Score =   176 bits (447),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EAQ RWL+P+E+  IL+N++   IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLSEAQHRWLRPSEICEILRNYQKFHIASEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+T+ EAHE+LKVGS + L+CYYAHGE N NFQRRSYWML+  + HIV VHY
Sbjct  74   NWRKKKDGKTIKEAHEKLKVGSVDMLHCYYAHGEDNSNFQRRSYWMLEQDFMHIVFVHY  132



>ref|XP_004137052.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Cucumis sativus]
Length=1067

 Score =   176 bits (447),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 3/128 (2%)
 Frame = +3

Query  249  MTEAGYNFSD---LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRV  419
            M +  Y  +D   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++V
Sbjct  1    MADTAYIHADIEQLLVEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKV  60

Query  420  LRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAY  599
            LR+FRKDGH WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+   
Sbjct  61   LRYFRKDGHKWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHL  120

Query  600  EHIVLVHY  623
             HIV VHY
Sbjct  121  MHIVFVHY  128



>ref|XP_004985392.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Setaria italica]
Length=1035

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N +I  EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQNRWLRPAEICEILKNYRNFRITPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHY  132



>gb|KJB32054.1| hypothetical protein B456_005G220600 [Gossypium raimondii]
Length=815

 Score =   175 bits (443),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+PAE+  IL+N++   I+ EPP  P SGSLFLF+++VLR+FRKDGH+WR+
Sbjct  18   ILLEAQHRWLRPAEICEILRNYQKFHISSEPPTGPPSGSLFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  78   KKDGKTVKEAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEQDLTHIVFVHY  132



>ref|XP_004985393.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Setaria italica]
Length=1034

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N +I  EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQNRWLRPAEICEILKNYRNFRITPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHY  132



>ref|XP_006853146.1| hypothetical protein AMTR_s00038p00173360 [Amborella trichopoda]
 gb|ERN14613.1| hypothetical protein AMTR_s00038p00173360 [Amborella trichopoda]
Length=1136

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + S ++ EAQ RWL+PAEV  IL+N+ N  IA +PP +P SGSLFLF+++VLR+FRKDGH
Sbjct  39   DISQIVLEAQNRWLRPAEVCEILRNYHNFHIASDPPNRPPSGSLFLFDRKVLRYFRKDGH  98

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLK G  + L+CYYAHGE+N NFQRRSYW+L+   EHIVLVHYR
Sbjct  99   NWRKKKDGKTVREAHERLKAGRIDVLHCYYAHGEENENFQRRSYWLLEEELEHIVLVHYR  158



>ref|XP_010926291.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926292.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926293.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Elaeis guineensis]
Length=1044

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+P E+  ILQN+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQRRWLRPTEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_010926295.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Elaeis guineensis]
Length=1043

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+P E+  ILQN+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQRRWLRPTEICEILQNYRKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_006492475.1| PREDICTED: uncharacterized protein LOC102620244 isoform X1 [Citrus 
sinensis]
 gb|KDO43815.1| hypothetical protein CISIN_1g024223mg [Citrus sinensis]
Length=270

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            +AGY    L +EA+ RWLKP EVLF+LQNHE   +   PPQKP SGSLFLFN R+L FFR
Sbjct  2    QAGYEIDVLFKEAKSRWLKPEEVLFVLQNHEKFGLTEAPPQKPPSGSLFLFNTRILDFFR  61

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
            +DGH WR+ ++ R V EAHERL+     AL+CYYA G+QNPNFQRR Y M    Y H+VL
Sbjct  62   EDGHIWRKMKNTRIVSEAHERLETADGLALDCYYAFGKQNPNFQRRVYSMAAYLYGHLVL  121

Query  615  VHYR  626
            VHYR
Sbjct  122  VHYR  125



>ref|XP_008651919.1| PREDICTED: calmodulin-binding transcription activator 1-like 
isoform X2 [Zea mays]
 tpg|DAA43820.1| TPA: hypothetical protein ZEAMMB73_256626 [Zea mays]
Length=1025

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N  IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQHRWLRPAEICEILKNYRNFHIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            SWR+K+DG+TV EAHERLK GS + L+CYYAHGE N NFQRRSYWML+  + HIVLVHY
Sbjct  74   SWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEGNENFQRRSYWMLEEDFMHIVLVHY  132



>ref|XP_008651911.1| PREDICTED: calmodulin-binding transcription activator 1-like 
isoform X1 [Zea mays]
Length=1026

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N  IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQHRWLRPAEICEILKNYRNFHIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            SWR+K+DG+TV EAHERLK GS + L+CYYAHGE N NFQRRSYWML+  + HIVLVHY
Sbjct  74   SWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEGNENFQRRSYWMLEEDFMHIVLVHY  132



>ref|XP_010030018.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Eucalyptus grandis]
 gb|KCW56957.1| hypothetical protein EUGRSUZ_I02632 [Eucalyptus grandis]
Length=993

 Score =   175 bits (444),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EA  RWL+P E+  IL+N++   +  EPP +P +GSLFLF+++ LR+FRKDGH
Sbjct  14   DLQQILQEAGHRWLRPTEICEILRNYQKFNLTPEPPSRPPAGSLFLFDRKALRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
             WR+KRDG+TV EAHE+LK GS + L+CYYAHGE+N NFQRRSYWMLD   EHIVLVHYR
Sbjct  74   RWRKKRDGKTVKEAHEKLKAGSVDVLHCYYAHGEENENFQRRSYWMLDSQLEHIVLVHYR  133



>ref|XP_008455206.1| PREDICTED: calmodulin-binding transcription activator 2 isoform 
X3 [Cucumis melo]
Length=1091

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLIEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   KWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHLMHIVFVHY  132



>ref|XP_010269272.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Nelumbo nucifera]
Length=1061

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N+    IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQNRWLRPAEICEILRNYRKFHIASEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHE+LK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHYR  133



>ref|XP_010269269.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010269270.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010269271.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Nelumbo nucifera]
Length=1087

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N+    IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQNRWLRPAEICEILRNYRKFHIASEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHE+LK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHYR  133



>ref|XP_008455205.1| PREDICTED: calmodulin-binding transcription activator 2 isoform 
X2 [Cucumis melo]
Length=1092

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLIEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   KWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHLMHIVFVHY  132



>ref|XP_008455204.1| PREDICTED: calmodulin-binding transcription activator 2 isoform 
X1 [Cucumis melo]
Length=1102

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLIEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   KWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHLMHIVFVHY  132



>ref|XP_010099702.1| Calmodulin-binding transcription activator 3 [Morus notabilis]
 gb|EXB80279.1| Calmodulin-binding transcription activator 3 [Morus notabilis]
Length=1010

 Score =   175 bits (444),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 73/116 (63%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +++EAQ RWL+P E+  IL+N++  Q+  +PP  P +GSLFLF+++ LR+FRKDGH WR+
Sbjct  21   ILQEAQNRWLRPTEICEILRNYQKFQLTPDPPVTPPAGSLFLFDRKALRYFRKDGHRWRK  80

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            K+DG+TV EAHE+LK GS + L+CYYAHGE+N NFQRRSYWMLD   EHIVLVHYR
Sbjct  81   KKDGKTVKEAHEKLKAGSVDVLHCYYAHGEENENFQRRSYWMLDGQLEHIVLVHYR  136



>gb|EPS65935.1| calmodulin-binding transcription activator 2, partial [Genlisea 
aurea]
Length=199

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 98/129 (76%), Gaps = 4/129 (3%)
 Frame = +3

Query  249  MTEAG----YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKR  416
            M E G    ++   ++ E Q RWL+PAE+  IL+N+    I+ E P KP SGS+FLF+++
Sbjct  1    MDETGSGFRFDIEQILSEVQHRWLRPAEICEILRNYHKLHISSEAPAKPVSGSVFLFDRK  60

Query  417  VLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPA  596
            VLR+FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYW+L+  
Sbjct  61   VLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDMLHCYYAHGEENENFQRRSYWLLEQD  120

Query  597  YEHIVLVHY  623
              HIV VHY
Sbjct  121  LMHIVFVHY  129



>gb|KGN43718.1| hypothetical protein Csa_7G062840 [Cucumis sativus]
Length=1092

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L+ EA+ RWL+PAE+  IL+N+   +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLLVEAKHRWLRPAEICEILRNYTKFRIASEPPDRPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   KWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEEHLMHIVFVHY  132



>ref|XP_006662301.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Oryza brachyantha]
Length=1064

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            N + +++EAQ RWL+PAE+  IL+N+ + +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  61   NIAQILKEAQQRWLRPAEICEILKNYRSFRIAPEPPNRPQSGSLFLFDRKVLRYFRKDGH  120

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRR+YWML+  + HIVLVHY
Sbjct  121  NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWMLEEDFMHIVLVHY  179



>ref|XP_008338581.1| PREDICTED: calmodulin-binding transcription activator 3 [Malus 
domestica]
Length=1108

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + ++ EA+ RWL+PAE+  ILQN++  QIA  P  KP  GSLFLF+++VLR+FRKDGH
Sbjct  14   DIAQILLEAKHRWLRPAEICEILQNYQKFQIASVPANKPPGGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+ A +HIVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEALQHIVLVHYR  133



>emb|CDY18719.1| BnaA09g06760D [Brassica napus]
Length=1019

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  246  IMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLR  425
            ++  AG +   L+ EAQ RWL+PAE+  IL+N++   IA EPP +P SGSLFLF+++VLR
Sbjct  36   VVVFAGTDIQQLLSEAQHRWLRPAEICEILRNYQKFHIASEPPNRPPSGSLFLFDRKVLR  95

Query  426  FFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEH  605
            +FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE N NFQRR YWML+    H
Sbjct  96   YFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWMLEQELMH  155

Query  606  IVLVHY  623
            IV VHY
Sbjct  156  IVFVHY  161



>ref|XP_009338097.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Pyrus x bretschneideri]
Length=1108

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + ++ EA+ RWL+PAE+  ILQN++  QIA  P  KP  GSLFLF+++VLR+FRKDGH
Sbjct  14   DIAQILLEAKHRWLRPAEICEILQNYQKFQIASVPANKPPGGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+ A +HIVLVHYR
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEALQHIVLVHYR  133



>ref|XP_003558617.1| PREDICTED: calmodulin-binding transcription activator 1-like 
isoform X1 [Brachypodium distachyon]
Length=1034

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N+ N +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQHRWLRPAEICEILKNYGNFRIAPEPPNRPASGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDFMHIVLVHY  132



>gb|EEE58472.1| hypothetical protein OsJ_09725 [Oryza sativa Japonica Group]
Length=868

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ + +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQRRWLRPTEICEILKNYRSFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>gb|AAM08530.1|AC079935_2 Putative calmodulin-binding protein similar to ER66 [Oryza sativa 
Japonica Group]
 gb|AAM08663.1|AC113338_19 Putative calmodulin binding protein similar to ER66 [Oryza sativa 
Japonica Group]
Length=1038

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + +++EAQ RWL+PAE+  IL+N+++ +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  17   DIAQILKEAQQRWLRPAEICEILKNYKSFRIAPEPPNRPQSGSLFLFDRKVLRYFRKDGH  76

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRR+YWML+  + HIVLVHY
Sbjct  77   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWMLEEDFMHIVLVHY  135



>ref|XP_010232758.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X2 [Brachypodium distachyon]
Length=809

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M + G++   L +E + RWLKP EVL ILQN E   + H+PPQKP SGS FLFN+RVLR 
Sbjct  1    MQQQGFDIQKLQQEVKTRWLKPPEVLKILQNFELFPVQHKPPQKPPSGSWFLFNRRVLRN  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG+ WRRK++G+T  EAHE LKV + +ALNCYYA  ++N  FQ+R YWMLDPAYEHI
Sbjct  61   FRNDGYDWRRKKNGKTFAEAHEYLKVDTVKALNCYYAQADKNSTFQKRIYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|EEC74662.1| hypothetical protein OsI_10332 [Oryza sativa Indica Group]
Length=989

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ + +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQRRWLRPTEICEILKNYRSFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_003564956.1| PREDICTED: calmodulin-binding transcription activator 4-like 
isoform X1 [Brachypodium distachyon]
Length=836

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M + G++   L +E + RWLKP EVL ILQN E   + H+PPQKP SGS FLFN+RVLR 
Sbjct  1    MQQQGFDIQKLQQEVKTRWLKPPEVLKILQNFELFPVQHKPPQKPPSGSWFLFNRRVLRN  60

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FR DG+ WRRK++G+T  EAHE LKV + +ALNCYYA  ++N  FQ+R YWMLDPAYEHI
Sbjct  61   FRNDGYDWRRKKNGKTFAEAHEYLKVDTVKALNCYYAQADKNSTFQKRIYWMLDPAYEHI  120

Query  609  VLVHYR  626
            VLVHYR
Sbjct  121  VLVHYR  126



>gb|EEE50856.1| hypothetical protein OsJ_31300 [Oryza sativa Japonica Group]
Length=1037

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + +++EAQ RWL+PAE+  IL+N+++ +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  17   DIAQILKEAQQRWLRPAEICEILKNYKSFRIAPEPPNRPQSGSLFLFDRKVLRYFRKDGH  76

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRR+YWML+  + HIVLVHY
Sbjct  77   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWMLEEDFMHIVLVHY  135



>gb|EMS52514.1| Calmodulin-binding transcription activator 2 [Triticum urartu]
Length=1475

 Score =   176 bits (446),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 71/115 (62%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +++EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+FRKDGH WR+
Sbjct  19   ILQEAQNRWLRPTEICQILSNYKKFSIAPEPPNRPPSGSLFLFDRKILRYFRKDGHIWRK  78

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +IVLVHY
Sbjct  79   KKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNIVLVHY  133



>ref|NP_001049230.1| Os03g0191000 [Oryza sativa Japonica Group]
 dbj|BAF11144.1| Os03g0191000 [Oryza sativa Japonica Group]
Length=1029

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ + +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQRRWLRPTEICEILKNYRSFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_010030039.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Eucalyptus grandis]
 gb|KCW56988.1| hypothetical protein EUGRSUZ_I02662 [Eucalyptus grandis]
Length=1056

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L  EAQ RWL+PAE+  IL+NH+  QIA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQLQVEAQHRWLRPAEICEILRNHQKFQIAAEPPTRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   NWRKKRDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRSYWMLEQDLMHIVFVHY  132



>gb|ABF94398.1| anther ethylene-upregulated protein ER1, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+P E+  IL+N+ + +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILKEAQRRWLRPTEICEILKNYRSFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+KRDG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKRDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHY  132



>ref|NP_001064470.1| Os10g0375600 [Oryza sativa Japonica Group]
 gb|ABB47374.1| anther ethylene-upregulated protein ER1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26384.1| Os10g0375600 [Oryza sativa Japonica Group]
Length=1023

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + +++EAQ RWL+PAE+  IL+N+++ +IA EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  17   DIAQILKEAQQRWLRPAEICEILKNYKSFRIAPEPPNRPQSGSLFLFDRKVLRYFRKDGH  76

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRR+YWML+  + HIVLVHY
Sbjct  77   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWMLEEDFMHIVLVHY  135



>ref|XP_010267832.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Nelumbo nucifera]
 ref|XP_010267840.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Nelumbo nucifera]
Length=1084

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N+   +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQNRWLRPAEICEILRNYPKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            +WR+K+DG+T+ EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+    HIVLVHYR
Sbjct  74   NWRKKKDGKTIKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEDLMHIVLVHYR  133



>ref|XP_009404047.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1047

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILRNYQKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHY  132



>ref|XP_009404048.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1046

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N++  +IA EPP KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILRNYQKFRIAPEPPNKPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  + HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEDFMHIVLVHY  132



>dbj|BAC79907.1| putative anther ethylene-upregulated protein ER1 [Oryza sativa 
Japonica Group]
Length=1026

 Score =   174 bits (442),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 71/115 (62%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+FRKDGH+WR+
Sbjct  19   ILLEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRK  78

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +IVLVHY
Sbjct  79   KKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNIVLVHY  133



>gb|EEE67615.1| hypothetical protein OsJ_25176 [Oryza sativa Japonica Group]
Length=1001

 Score =   174 bits (442),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 71/115 (62%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+FRKDGH+WR+
Sbjct  19   ILLEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRK  78

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +IVLVHY
Sbjct  79   KKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNIVLVHY  133



>ref|XP_002465719.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor]
 gb|EER92717.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor]
Length=994

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +++EAQ RWL+PAE+  IL+N+ N +I+ EPP +P SGSLFLF+++VLR+FRKDGH+WR+
Sbjct  18   ILKEAQHRWLRPAEICEILKNYRNFRISPEPPNRPPSGSLFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            KRDG+TV EAHERLK GS + L+CYYAHGE N NFQRRSYWML+  + HIVLVHY
Sbjct  78   KRDGKTVKEAHERLKSGSVDVLHCYYAHGEGNENFQRRSYWMLEEDFMHIVLVHY  132



>ref|XP_008373189.1| PREDICTED: calmodulin-binding transcription activator 2-like 
[Malus domestica]
Length=1070

 Score =   174 bits (442),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 79/132 (60%), Positives = 100/132 (76%), Gaps = 7/132 (5%)
 Frame = +3

Query  249  MTEAG-------YNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLF  407
            M+E+G        +F  L+ EAQ RWL+PAE+  IL N E  QI+ EPP KP SGSL+LF
Sbjct  1    MSESGSYPQGPRLDFQQLLVEAQHRWLRPAEICEILSNFEKFQISSEPPNKPPSGSLYLF  60

Query  408  NKRVLRFFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWML  587
            +++VLR+FRKDGH+WR+KRDG+TV EAHE+LKVGS + L+CYYAHGE + +FQRR YWML
Sbjct  61   DRKVLRYFRKDGHNWRKKRDGKTVKEAHEKLKVGSVDVLHCYYAHGEDDESFQRRCYWML  120

Query  588  DPAYEHIVLVHY  623
            +    HIV VHY
Sbjct  121  EQDLMHIVFVHY  132



>gb|KJB79656.1| hypothetical protein B456_013G061100 [Gossypium raimondii]
Length=756

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL N++   I  EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILCNYQKFHITSEPPTRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+P   HIV VHY
Sbjct  74   NWRKKKDGKTVKEAHEKLKVGSVDKLHCYYAHGEENENFQRRSYWMLEPDLMHIVFVHY  132



>ref|XP_008795548.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Phoenix dactylifera]
Length=1047

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N++  +IA E P KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILRNYKKFRIAPESPNKPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|XP_008795547.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Phoenix dactylifera]
Length=1048

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N++  +IA E P KP SGSLFLF+++VLR+FRKDGH
Sbjct  14   DIEQILLEAQHRWLRPAEICEILRNYKKFRIAPESPNKPSSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRRSYWML+  Y HIVLVHY
Sbjct  74   NWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEEDYMHIVLVHY  132



>ref|NP_001045240.1| Os01g0923600 [Oryza sativa Japonica Group]
 dbj|BAD88303.1| putative ethylene-induced calmodulin-binding protein 4 [Oryza 
sativa Japonica Group]
 dbj|BAD88325.1| putative ethylene-induced calmodulin-binding protein 4 [Oryza 
sativa Japonica Group]
 dbj|BAF07154.1| Os01g0923600 [Oryza sativa Japonica Group]
 dbj|BAG91168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55914.1| hypothetical protein OsJ_04592 [Oryza sativa Japonica Group]
Length=878

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  EAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFR  434
            + G++   L +E + RWLKP EVL ILQNH+   I H+ P KP SG+ FLFN+RVLR+FR
Sbjct  4    QQGFDTHRLHQEVKSRWLKPKEVLQILQNHDRFIITHKTPHKPPSGAWFLFNRRVLRYFR  63

Query  435  KDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVL  614
             DG+ WR+K++G+T+ EAHERLKV + +ALNCYYAH ++N  FQRR YWMLDPAY+HIV 
Sbjct  64   NDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWMLDPAYDHIVF  123

Query  615  VHYR  626
            VHYR
Sbjct  124  VHYR  127



>gb|EEC72061.1| hypothetical protein OsI_04984 [Oryza sativa Indica Group]
Length=878

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  246  IMTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLR  425
            +  + G++   L +E + RWLKP EVL ILQNH+   I H+ P KP SG+ FLFN+RVLR
Sbjct  1    MQQQQGFDTHRLHQEVKSRWLKPKEVLQILQNHDRFIITHKTPHKPPSGAWFLFNRRVLR  60

Query  426  FFRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEH  605
            +FR DG+ WR+K++G+T+ EAHERLKV + +ALNCYYAH ++N  FQRR YWMLDPAY+H
Sbjct  61   YFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWMLDPAYDH  120

Query  606  IVLVHYR  626
            IV VHYR
Sbjct  121  IVFVHYR  127



>ref|XP_009140343.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Brassica rapa]
Length=1031

 Score =   173 bits (439),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EA+ RWL+P E+  ILQN++  QI+ EPP  P SGS+FLF+++VLR+FRKDGH+WR+
Sbjct  18   ILSEARNRWLRPPEICEILQNYQKFQISTEPPTTPASGSVFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            KRDG+TV EAHERLK GS + L+CYYAHG+ N NFQRRSYWML     HIV VHY
Sbjct  78   KRDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWMLQEELSHIVFVHY  132



>ref|XP_008653354.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Zea mays]
Length=1028

 Score =   173 bits (439),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+    +   ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+
Sbjct  9    MSNQPPDIPQILLEAQSRWLRPTEICQILSNYKKFSIAPEPPNRPQSGSLFLFDRKILRY  68

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +I
Sbjct  69   FRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNI  128

Query  609  VLVHY  623
            VLVHY
Sbjct  129  VLVHY  133



>ref|XP_008653355.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X2 [Zea mays]
Length=1026

 Score =   173 bits (439),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+    +   ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+
Sbjct  9    MSNQPPDIPQILLEAQSRWLRPTEICQILSNYKKFSIAPEPPNRPQSGSLFLFDRKILRY  68

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +I
Sbjct  69   FRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNI  128

Query  609  VLVHY  623
            VLVHY
Sbjct  129  VLVHY  133



>ref|XP_008653356.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X3 [Zea mays]
Length=1012

 Score =   173 bits (439),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+    +   ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+
Sbjct  9    MSNQPPDIPQILLEAQSRWLRPTEICQILSNYKKFSIAPEPPNRPQSGSLFLFDRKILRY  68

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRR+YW+L+  + +I
Sbjct  69   FRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQRRTYWLLEEGFMNI  128

Query  609  VLVHY  623
            VLVHY
Sbjct  129  VLVHY  133



>ref|XP_008448831.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X3 [Cucumis melo]
Length=952

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N++  Q+A +PP +P +GSLFLF+++ LR+FRKDGH
Sbjct  14   DLVQILQEAQKRWLRPAEICEILRNYKKFQLAPDPPVQPPAGSLFLFDRKALRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
             WR+K+DG+TV EAHE+LK GS + L+CYYAHGE N NFQRRSYWMLD   EHIVLVHYR
Sbjct  74   RWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYR  133



>gb|KGN54335.1| hypothetical protein Csa_4G304810 [Cucumis sativus]
Length=943

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = +3

Query  276  DLIR---EAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            DL+R   EAQ RWL+PAE+  IL+N++  Q+A +PP +P +GSLFLF+++ LR+FRKDGH
Sbjct  14   DLVRILQEAQSRWLRPAEICEILRNYKKFQLAPDPPVQPPAGSLFLFDRKALRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
             WR+K+DG+TV EAHE+LK GS + L+CYYAHGE N NFQRRSYWMLD   EHIVLVHYR
Sbjct  74   RWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYR  133



>ref|XP_004147929.1| PREDICTED: calmodulin-binding transcription activator 3-like 
[Cucumis sativus]
Length=890

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            +++EAQ RWL+PAE+  IL+N++  Q+A +PP +P +GSLFLF+++ LR+FRKDGH WR+
Sbjct  18   ILQEAQSRWLRPAEICEILRNYKKFQLAPDPPVQPPAGSLFLFDRKALRYFRKDGHRWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
            K+DG+TV EAHE+LK GS + L+CYYAHGE N NFQRRSYWMLD   EHIVLVHYR
Sbjct  78   KKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYR  133



>ref|XP_007159108.1| hypothetical protein PHAVU_002G209300g [Phaseolus vulgaris]
 gb|ESW31102.1| hypothetical protein PHAVU_002G209300g [Phaseolus vulgaris]
Length=1086

 Score =   173 bits (439),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   L  EAQ RWL+PAE+  IL N+   QI  EPP +P SGSLFLF+++VLR+FRKDGH
Sbjct  14   DLQQLQLEAQNRWLRPAEICEILCNYRMFQITPEPPNRPPSGSLFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
             WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N +FQRRSYWML+P   HIV VHY
Sbjct  74   IWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENESFQRRSYWMLEPDMMHIVFVHY  132



>emb|CDY25585.1| BnaA04g12770D [Brassica napus]
Length=990

 Score =   173 bits (438),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EA+ RWL+P E+  ILQN++  QI+ EPP  P SGS+FLF+++VLR+FRKDGH+WR+
Sbjct  18   ILSEARNRWLRPPEICEILQNYQKFQISTEPPTTPASGSVFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            KRDG+TV EAHERLK GS + L+CYYAHG+ N NFQRRSYWML     HIV VHY
Sbjct  78   KRDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWMLQEELSHIVFVHY  132



>ref|XP_008448822.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Cucumis melo]
Length=976

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N++  Q+A +PP +P +GSLFLF+++ LR+FRKDGH
Sbjct  14   DLVQILQEAQKRWLRPAEICEILRNYKKFQLAPDPPVQPPAGSLFLFDRKALRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
             WR+K+DG+TV EAHE+LK GS + L+CYYAHGE N NFQRRSYWMLD   EHIVLVHYR
Sbjct  74   RWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYR  133



>emb|CDO97448.1| unnamed protein product [Coffea canephora]
Length=1062

 Score =   173 bits (438),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   ++ EAQ RWL+PAE+  IL+N++   I  EPP KP SGS+FLF+++VLR+FRKDGH
Sbjct  14   DIKQILSEAQHRWLRPAEICEILRNYQKFYITPEPPVKPASGSVFLFDRKVLRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  74   NWRKKKDGKTVKEAHEKLKVGSVDMLHCYYAHGEENENFQRRSYWMLEQDLMHIVFVHY  132



>ref|XP_008448813.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Cucumis melo]
Length=979

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            +   +++EAQ RWL+PAE+  IL+N++  Q+A +PP +P +GSLFLF+++ LR+FRKDGH
Sbjct  14   DLVQILQEAQKRWLRPAEICEILRNYKKFQLAPDPPVQPPAGSLFLFDRKALRYFRKDGH  73

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHYR  626
             WR+K+DG+TV EAHE+LK GS + L+CYYAHGE N NFQRRSYWMLD   EHIVLVHYR
Sbjct  74   RWRKKKDGKTVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDGQLEHIVLVHYR  133



>ref|XP_004958361.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X1 [Setaria italica]
Length=1053

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+    + + ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+
Sbjct  9    MSNQPPDIAQILLEAQNRWLRPTEICQILSNYKKFSIAPEPPNRPPSGSLFLFDRKILRY  68

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE N NFQRR+YW+L+  + +I
Sbjct  69   FRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEDNENFQRRTYWLLEEGFMNI  128

Query  609  VLVHY  623
            VLVHY
Sbjct  129  VLVHY  133



>gb|KJB32052.1| hypothetical protein B456_005G220600 [Gossypium raimondii]
 gb|KJB32056.1| hypothetical protein B456_005G220600 [Gossypium raimondii]
Length=1048

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+PAE+  IL+N++   I+ EPP  P SGSLFLF+++VLR+FRKDGH+WR+
Sbjct  18   ILLEAQHRWLRPAEICEILRNYQKFHISSEPPTGPPSGSLFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  78   KKDGKTVKEAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEQDLTHIVFVHY  132



>tpg|DAA38156.1| TPA: hypothetical protein ZEAMMB73_559848 [Zea mays]
Length=424

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  261  GYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKD  440
             ++ + L  EA+ RWLKP+EV +ILQNHE   I HE P+KP SGSLFL+N+RV R+FR+D
Sbjct  4    SFDINVLREEARSRWLKPSEVYYILQNHERFPITHEAPKKPPSGSLFLYNRRVNRYFRRD  63

Query  441  GHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWM  584
            GH+WRRK+DGRTVGEAHERLKVG+ ++L+CYYAHGEQNP FQRR +WM
Sbjct  64   GHTWRRKKDGRTVGEAHERLKVGNVDSLSCYYAHGEQNPCFQRRCFWM  111



>gb|KJB32053.1| hypothetical protein B456_005G220600 [Gossypium raimondii]
Length=1049

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+PAE+  IL+N++   I+ EPP  P SGSLFLF+++VLR+FRKDGH+WR+
Sbjct  18   ILLEAQHRWLRPAEICEILRNYQKFHISSEPPTGPPSGSLFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  78   KKDGKTVKEAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEQDLTHIVFVHY  132



>gb|EEC66837.1| hypothetical protein OsI_33300 [Oryza sativa Indica Group]
Length=995

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  267  NFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGH  446
            + + +++EAQ RWL+PAE+  IL+N+++ +IA EPP +P SGSLFLF+++VLR+FRKD H
Sbjct  15   DIAQILKEAQQRWLRPAEICEILKNYKSFRIAPEPPNRPQSGSLFLFDRKVLRYFRKDSH  74

Query  447  SWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            +WR+K+DG+TV EAHERLK GS + L+CYYAHGE+N NFQRR+YWML+  + HIVLVHY
Sbjct  75   NWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRRTYWMLEEDFMHIVLVHY  133



>ref|XP_004504800.1| PREDICTED: calmodulin-binding transcription activator 2-like 
isoform X1 [Cicer arietinum]
Length=1081

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  288  EAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRRKRD  467
            EAQ RWL+PAE+  IL+N++  QI  EPP +P SGSLFLF+++VLR+FRKDGH+WR+K+D
Sbjct  23   EAQHRWLRPAEICEILKNYQMFQITPEPPSRPPSGSLFLFDRKVLRYFRKDGHNWRKKKD  82

Query  468  GRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            G+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+P   HIV VHY
Sbjct  83   GKTVREAHEKLKVGSVDVLHCYYAHGEENENFQRRSYWMLEPDMMHIVFVHY  134



>gb|KJB32055.1| hypothetical protein B456_005G220600 [Gossypium raimondii]
Length=1052

 Score =   172 bits (437),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  279  LIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRFFRKDGHSWRR  458
            ++ EAQ RWL+PAE+  IL+N++   I+ EPP  P SGSLFLF+++VLR+FRKDGH+WR+
Sbjct  18   ILLEAQHRWLRPAEICEILRNYQKFHISSEPPTGPPSGSLFLFDRKVLRYFRKDGHNWRK  77

Query  459  KRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHIVLVHY  623
            K+DG+TV EAHE+LKVGS + L+CYYAHGE+N NFQRRSYWML+    HIV VHY
Sbjct  78   KKDGKTVKEAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWMLEQDLTHIVFVHY  132



>ref|XP_004958362.1| PREDICTED: calmodulin-binding transcription activator 3-like 
isoform X2 [Setaria italica]
Length=1029

 Score =   172 bits (437),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  249  MTEAGYNFSDLIREAQGRWLKPAEVLFILQNHENHQIAHEPPQKPGSGSLFLFNKRVLRF  428
            M+    + + ++ EAQ RWL+P E+  IL N++   IA EPP +P SGSLFLF++++LR+
Sbjct  9    MSNQPPDIAQILLEAQNRWLRPTEICQILSNYKKFSIAPEPPNRPPSGSLFLFDRKILRY  68

Query  429  FRKDGHSWRRKRDGRTVGEAHERLKVGSAEALNCYYAHGEQNPNFQRRSYWMLDPAYEHI  608
            FRKDGH+WR+K+DG+TV EAHE+LKVGS + L+CYYAHGE N NFQRR+YW+L+  + +I
Sbjct  69   FRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEDNENFQRRTYWLLEEGFMNI  128

Query  609  VLVHY  623
            VLVHY
Sbjct  129  VLVHY  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380