BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS111A11

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO43692.1|  hypothetical protein CISIN_1g036676mg                   195   2e-56   Citrus sinensis [apfelsine]
ref|XP_010111493.1|  Cation/H(+) antiporter 20                          200   5e-56   
ref|XP_002527747.1|  monovalent cation:proton antiporter, putative      199   6e-56   
gb|KJB76713.1|  hypothetical protein B456_012G102300                    199   1e-55   Gossypium raimondii
gb|ABD32903.1|  Sodium/hydrogen exchanger                               190   1e-54   Medicago truncatula
gb|KJB16931.1|  hypothetical protein B456_002G255100                    196   1e-54   Gossypium raimondii
ref|XP_003625493.1|  K(+)/H(+) antiporter                               190   1e-54   
ref|XP_007027071.1|  Cation/H+ exchanger 20 isoform 1                   194   1e-54   
ref|XP_010260095.1|  PREDICTED: cation/H(+) antiporter 20               196   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006429040.1|  hypothetical protein CICLE_v10011060mg             195   2e-54   Citrus clementina [clementine]
ref|XP_006480781.1|  PREDICTED: cation/H(+) antiporter 20-like          195   3e-54   Citrus sinensis [apfelsine]
ref|XP_002527748.1|  conserved hypothetical protein                     194   5e-54   
ref|XP_010111492.1|  Cation/H(+) antiporter 20                          194   6e-54   Morus notabilis
ref|XP_011466585.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    193   2e-53   Fragaria vesca subsp. vesca
gb|AES81712.2|  cation/H+ exchanger 3                                   192   2e-53   Medicago truncatula
emb|CAN63422.1|  hypothetical protein VITISV_023524                     191   1e-52   Vitis vinifera
ref|XP_002269591.1|  PREDICTED: cation/H(+) antiporter 20               190   1e-52   Vitis vinifera
emb|CBI30584.3|  unnamed protein product                                190   1e-52   Vitis vinifera
gb|KDO44651.1|  hypothetical protein CISIN_1g0036292mg                  184   2e-52   Citrus sinensis [apfelsine]
ref|XP_003520628.2|  PREDICTED: cation/H(+) antiporter 20-like          190   2e-52   Glycine max [soybeans]
gb|EYU26575.1|  hypothetical protein MIMGU_mgv1a001541mg                189   3e-52   Erythranthe guttata [common monkey flower]
gb|KDO44649.1|  hypothetical protein CISIN_1g0039791mg                  183   4e-52   Citrus sinensis [apfelsine]
emb|CBI30585.3|  unnamed protein product                                188   5e-52   Vitis vinifera
ref|XP_002262680.2|  PREDICTED: cation/H(+) antiporter 20               188   6e-52   Vitis vinifera
ref|XP_010037849.1|  PREDICTED: cation/H(+) antiporter 20               188   7e-52   Eucalyptus grandis [rose gum]
ref|XP_006429043.1|  hypothetical protein CICLE_v10011096mg             187   1e-51   Citrus clementina [clementine]
ref|XP_004142208.1|  PREDICTED: cation/H(+) antiporter 20-like          187   2e-51   
gb|KGN54233.1|  hypothetical protein Csa_4G294410                       187   2e-51   Cucumis sativus [cucumbers]
ref|XP_011020326.1|  PREDICTED: cation/H(+) antiporter 20               187   2e-51   Populus euphratica
ref|XP_008447651.1|  PREDICTED: cation/H(+) antiporter 20               187   2e-51   Cucumis melo [Oriental melon]
ref|XP_010911264.1|  PREDICTED: cation/H(+) antiporter 20-like          181   2e-51   Elaeis guineensis
ref|XP_007162657.1|  hypothetical protein PHAVU_001G169300g             186   3e-51   Phaseolus vulgaris [French bean]
ref|XP_004494000.1|  PREDICTED: cation/H(+) antiporter 20-like          186   3e-51   Cicer arietinum [garbanzo]
ref|XP_010037850.1|  PREDICTED: cation/H(+) antiporter 20-like          186   3e-51   Eucalyptus grandis [rose gum]
ref|XP_004168295.1|  PREDICTED: cation/H(+) antiporter 20-like          184   4e-51   
ref|XP_002308966.2|  hypothetical protein POPTR_0006s05340g             186   5e-51   
ref|XP_009406978.1|  PREDICTED: cation/H(+) antiporter 20-like          186   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302732.2|  PREDICTED: cation/H(+) antiporter 20               183   3e-50   Fragaria vesca subsp. vesca
ref|XP_003625495.1|  K(+)/H(+) antiporter                               183   5e-50   Medicago truncatula
ref|XP_006480783.1|  PREDICTED: cation/H(+) antiporter 20-like          183   5e-50   Citrus sinensis [apfelsine]
ref|XP_006429042.1|  hypothetical protein CICLE_v10011092mg             183   6e-50   Citrus clementina [clementine]
ref|XP_002527749.1|  monovalent cation:proton antiporter, putative      182   6e-50   
ref|XP_009117167.1|  PREDICTED: cation/H(+) antiporter 20-like          179   9e-50   
emb|CDY70299.1|  BnaA07g37760D                                          177   1e-49   Brassica napus [oilseed rape]
ref|XP_002439158.1|  hypothetical protein SORBIDRAFT_09g001490          182   2e-49   Sorghum bicolor [broomcorn]
ref|XP_008345449.1|  PREDICTED: cation/H(+) antiporter 20-like          181   2e-49   
ref|XP_008369866.1|  PREDICTED: cation/H(+) antiporter 20               181   2e-49   
ref|XP_009338769.1|  PREDICTED: cation/H(+) antiporter 20-like is...    181   2e-49   Pyrus x bretschneideri [bai li]
ref|NP_190940.1|  cation/H(+) antiporter 20                             181   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAX49548.1|  cation/H+ exchanger                                     181   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35609.1|  hypothetical protein JCGZ_09047                         180   5e-49   Jatropha curcas
emb|CDX78197.1|  BnaA09g33920D                                          180   6e-49   
ref|XP_008795058.1|  PREDICTED: cation/H(+) antiporter 20               180   8e-49   Phoenix dactylifera
ref|XP_009611526.1|  PREDICTED: cation/H(+) antiporter 20               178   2e-48   Nicotiana tomentosiformis
emb|CDY07571.1|  BnaC06g14930D                                          179   2e-48   Brassica napus [oilseed rape]
ref|XP_003566598.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    179   2e-48   
ref|XP_009103880.1|  PREDICTED: cation/H(+) antiporter 20-like          179   2e-48   Brassica rapa
ref|XP_004960505.1|  PREDICTED: cation/H(+) antiporter 20-like          179   2e-48   Setaria italica
ref|XP_002877937.1|  cation/H+ exchanger                                178   3e-48   
emb|CDY69365.1|  BnaA04g27810D                                          173   3e-48   Brassica napus [oilseed rape]
ref|XP_009399874.1|  PREDICTED: cation/H(+) antiporter 20-like          178   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK34621.1|  hypothetical protein AALP_AA5G169800                    177   1e-47   Arabis alpina [alpine rockcress]
ref|XP_009787989.1|  PREDICTED: cation/H(+) antiporter 20               176   1e-47   Nicotiana sylvestris
gb|KDP35607.1|  hypothetical protein JCGZ_09045                         175   2e-47   Jatropha curcas
ref|XP_008648635.1|  PREDICTED: cation/H(+) antiporter 20               176   2e-47   Zea mays [maize]
ref|XP_010678053.1|  PREDICTED: cation/H(+) antiporter 20               176   3e-47   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY30847.1|  BnaC04g27020D                                          175   3e-47   Brassica napus [oilseed rape]
ref|XP_010528361.1|  PREDICTED: cation/H(+) antiporter 20-like          175   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_006403661.1|  hypothetical protein EUTSA_v10010121mg             174   7e-47   Eutrema salsugineum [saltwater cress]
ref|XP_009139379.1|  PREDICTED: cation/H(+) antiporter 20               174   8e-47   Brassica rapa
ref|XP_003542459.1|  PREDICTED: cation/H(+) antiporter 20-like          174   8e-47   Glycine max [soybeans]
emb|CDP05548.1|  unnamed protein product                                174   1e-46   Coffea canephora [robusta coffee]
gb|ABN05706.1|  Sodium/hydrogen exchanger                               169   1e-46   Medicago truncatula
ref|XP_010427030.1|  PREDICTED: cation/H(+) antiporter 20-like          173   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010515872.1|  PREDICTED: cation/H(+) antiporter 20-like          173   2e-46   
ref|XP_010504142.1|  PREDICTED: cation/H(+) antiporter 20               173   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006341222.1|  PREDICTED: cation/H(+) antiporter 20-like          173   2e-46   Solanum tuberosum [potatoes]
ref|XP_007208355.1|  hypothetical protein PRUPE_ppa001677mg             172   2e-46   
ref|XP_008241268.1|  PREDICTED: cation/H(+) antiporter 20-like is...    172   3e-46   Prunus mume [ume]
ref|XP_007027077.1|  Monovalent cation:proton antiporter, putative      172   5e-46   
ref|XP_006290596.1|  hypothetical protein CARUB_v10016685mg             172   8e-46   Capsella rubella
ref|XP_010529842.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    171   1e-45   Tarenaya hassleriana [spider flower]
gb|AIG92839.1|  CHX1                                                    165   2e-45   Glycine max [soybeans]
dbj|BAJ85710.1|  predicted protein                                      169   3e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87099.1|  predicted protein                                      170   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH23991.1|  cation/H+ exchanger 3                                   168   4e-45   Medicago truncatula
ref|XP_004246412.1|  PREDICTED: cation/H(+) antiporter 20               169   7e-45   Solanum lycopersicum
ref|XP_003625497.1|  K(+)/H(+) antiporter                               168   8e-45   Medicago truncatula
ref|XP_008369867.1|  PREDICTED: cation/H(+) antiporter 20-like          164   1e-44   
ref|XP_008776558.1|  PREDICTED: cation/H(+) antiporter 20-like          167   3e-44   
ref|XP_010412915.1|  PREDICTED: cation/H(+) antiporter 20-like          166   3e-44   
gb|AIG92838.1|  CHX1                                                    167   3e-44   Glycine soja [wild soybean]
ref|XP_003520629.1|  PREDICTED: cation/H(+) antiporter 20-like          167   3e-44   
ref|XP_006654915.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    165   4e-44   
ref|XP_010907062.1|  PREDICTED: cation/H(+) antiporter 20               165   2e-43   Elaeis guineensis
ref|XP_009338768.1|  PREDICTED: cation/H(+) antiporter 20-like          164   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_008366721.1|  PREDICTED: cation/H(+) antiporter 20-like          164   4e-43   
ref|XP_008241256.1|  PREDICTED: cation/H(+) antiporter 20               163   7e-43   Prunus mume [ume]
ref|XP_006410943.1|  hypothetical protein EUTSA_v10016301mg             162   1e-42   
ref|XP_007208406.1|  hypothetical protein PRUPE_ppa001365mg             162   3e-42   
ref|XP_011022576.1|  PREDICTED: cation/H(+) antiporter 18-like          161   4e-42   Populus euphratica
ref|XP_009374674.1|  PREDICTED: cation/H(+) antiporter 20-like          161   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_010512999.1|  PREDICTED: cation/H(+) antiporter 20-like          160   5e-42   
gb|KJB19059.1|  hypothetical protein B456_003G082900                    159   3e-41   Gossypium raimondii
gb|KHG13786.1|  Cation/H(+) antiporter 18 -like protein                 159   3e-41   Gossypium arboreum [tree cotton]
ref|XP_010055811.1|  PREDICTED: cation/H(+) antiporter 18               156   2e-40   Eucalyptus grandis [rose gum]
ref|XP_007028838.1|  Cation/H+ exchanger 19                             156   3e-40   
ref|XP_002304537.2|  hypothetical protein POPTR_0003s13470g             155   4e-40   
ref|XP_007040407.1|  Cation/H+ exchanger 18                             155   5e-40   
ref|XP_009802616.1|  PREDICTED: cation/H(+) antiporter 18-like          155   7e-40   Nicotiana sylvestris
ref|XP_009586862.1|  PREDICTED: cation/H(+) antiporter 18-like          154   9e-40   Nicotiana tomentosiformis
ref|XP_006355611.1|  PREDICTED: cation/H(+) antiporter 18-like          155   9e-40   Solanum tuberosum [potatoes]
emb|CDX74952.1|  BnaA05g06980D                                          153   1e-39   
ref|XP_006841535.1|  hypothetical protein AMTR_s00003p00159310          154   1e-39   
gb|EEE62090.1|  hypothetical protein OsJ_16874                          154   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004233089.1|  PREDICTED: cation/H(+) antiporter 18-like          154   2e-39   Solanum lycopersicum
ref|XP_010932682.1|  PREDICTED: cation/H(+) antiporter 19-like          152   2e-39   
ref|NP_001054455.1|  Os05g0113300                                       154   2e-39   
ref|XP_009334467.1|  PREDICTED: cation/H(+) antiporter 18               153   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_008385052.1|  PREDICTED: cation/H(+) antiporter 18               153   3e-39   
ref|XP_009383924.1|  PREDICTED: cation/H(+) antiporter 19-like          153   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009144111.1|  PREDICTED: cation/H(+) antiporter 20-like          152   3e-39   Brassica rapa
ref|XP_001770267.1|  predicted protein                                  152   3e-39   
gb|AAS75243.2|  putative Na+/H+ antiporter                              152   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841531.1|  hypothetical protein AMTR_s00003p00155190          153   4e-39   
ref|XP_003538685.1|  PREDICTED: cation/H(+) antiporter 18-like is...    153   4e-39   Glycine max [soybeans]
ref|XP_008451984.1|  PREDICTED: cation/H(+) antiporter 18-like          152   4e-39   Cucumis melo [Oriental melon]
ref|XP_007210366.1|  hypothetical protein PRUPE_ppa001527mg             152   5e-39   Prunus persica
gb|KHG06329.1|  hypothetical protein F383_32801                         152   5e-39   Gossypium arboreum [tree cotton]
gb|KHG06330.1|  hypothetical protein F383_32801                         152   6e-39   Gossypium arboreum [tree cotton]
ref|XP_008238994.1|  PREDICTED: cation/H(+) antiporter 18-like          152   6e-39   Prunus mume [ume]
gb|KJB19061.1|  hypothetical protein B456_003G083100                    152   7e-39   Gossypium raimondii
ref|XP_006388233.1|  hypothetical protein POPTR_0271s00200g             149   7e-39   
ref|XP_006343906.1|  PREDICTED: cation/H(+) antiporter 18-like          152   8e-39   Solanum tuberosum [potatoes]
ref|XP_010676379.1|  PREDICTED: cation/H(+) antiporter 18-like          152   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008776559.1|  PREDICTED: cation/H(+) antiporter 19-like          151   1e-38   Phoenix dactylifera
ref|XP_004245551.1|  PREDICTED: cation/H(+) antiporter 18-like          151   2e-38   Solanum lycopersicum
gb|KHN35057.1|  Cation/H(+) antiporter 18                               151   2e-38   Glycine soja [wild soybean]
ref|XP_006478542.1|  PREDICTED: cation/H(+) antiporter 19-like          150   2e-38   Citrus sinensis [apfelsine]
ref|XP_009765985.1|  PREDICTED: cation/H(+) antiporter 18-like          150   2e-38   Nicotiana sylvestris
gb|KDO46881.1|  hypothetical protein CISIN_1g003517mg                   150   2e-38   Citrus sinensis [apfelsine]
ref|XP_002276346.1|  PREDICTED: cation/H(+) antiporter 18               150   3e-38   Vitis vinifera
emb|CBI34426.3|  unnamed protein product                                149   3e-38   Vitis vinifera
ref|XP_006441942.1|  hypothetical protein CICLE_v10018885mg             150   3e-38   Citrus clementina [clementine]
gb|EPS57674.1|  hypothetical protein M569_17143                         142   3e-38   Genlisea aurea
ref|XP_011007076.1|  PREDICTED: cation/H(+) antiporter 19-like          149   3e-38   Populus euphratica
ref|XP_006343907.1|  PREDICTED: cation/H(+) antiporter 18-like          150   4e-38   
ref|XP_006846040.1|  hypothetical protein AMTR_s00012p00029570          150   4e-38   
gb|KHN25663.1|  Cation/H(+) antiporter 18                               150   4e-38   Glycine soja [wild soybean]
ref|XP_006573800.1|  PREDICTED: cation/H(+) antiporter 18-like is...    150   4e-38   Glycine max [soybeans]
ref|XP_004245552.1|  PREDICTED: cation/H(+) antiporter 18-like is...    150   4e-38   Solanum lycopersicum
ref|XP_009608562.1|  PREDICTED: cation/H(+) antiporter 18-like          150   4e-38   Nicotiana tomentosiformis
ref|XP_002509895.1|  Na(+)/H(+) antiporter, putative                    149   6e-38   
ref|XP_007131515.1|  hypothetical protein PHAVU_011G019400g             149   6e-38   Phaseolus vulgaris [French bean]
emb|CBI34425.3|  unnamed protein product                                149   6e-38   Vitis vinifera
ref|XP_002314344.2|  hypothetical protein POPTR_0010s00740g             149   6e-38   
ref|XP_010999352.1|  PREDICTED: cation/H(+) antiporter 19-like          149   6e-38   Populus euphratica
emb|CAN81239.1|  hypothetical protein VITISV_031074                     149   8e-38   Vitis vinifera
ref|XP_011012790.1|  PREDICTED: cation/H(+) antiporter 19-like          149   8e-38   Populus euphratica
ref|XP_008800286.1|  PREDICTED: cation/H(+) antiporter 19-like          149   9e-38   Phoenix dactylifera
ref|XP_009766374.1|  PREDICTED: cation/H(+) antiporter 18-like          149   9e-38   Nicotiana sylvestris
ref|XP_009782586.1|  PREDICTED: cation/H(+) antiporter 18-like          149   1e-37   Nicotiana sylvestris
ref|XP_010261447.1|  PREDICTED: cation/H(+) antiporter 18 isoform X2    149   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010261446.1|  PREDICTED: cation/H(+) antiporter 18 isoform X1    149   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002276249.1|  PREDICTED: cation/H(+) antiporter 18               148   1e-37   Vitis vinifera
gb|KDP25351.1|  hypothetical protein JCGZ_20507                         149   1e-37   Jatropha curcas
ref|XP_009586863.1|  PREDICTED: cation/H(+) antiporter 18-like          149   1e-37   Nicotiana tomentosiformis
ref|XP_010541366.1|  PREDICTED: cation/H(+) antiporter 17-like          148   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_010999354.1|  PREDICTED: cation/H(+) antiporter 19-like          147   1e-37   Populus euphratica
ref|XP_008341283.1|  PREDICTED: cation/H(+) antiporter 18-like          148   2e-37   Malus domestica [apple tree]
gb|EYU23396.1|  hypothetical protein MIMGU_mgv1a001514mg                148   2e-37   Erythranthe guttata [common monkey flower]
emb|CDY67925.1|  BnaA03g58740D                                          148   2e-37   Brassica napus [oilseed rape]
ref|XP_006664208.1|  PREDICTED: cation/H(+) antiporter 19-like          148   2e-37   
ref|XP_009402780.1|  PREDICTED: cation/H(+) antiporter 19-like          147   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004298856.1|  PREDICTED: cation/H(+) antiporter 18-like          147   3e-37   Fragaria vesca subsp. vesca
ref|XP_009402107.1|  PREDICTED: cation/H(+) antiporter 19-like          147   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004963208.1|  PREDICTED: cation/H(+) antiporter 19-like          147   4e-37   Setaria italica
ref|XP_009137382.1|  PREDICTED: cation/H(+) antiporter 17-like          147   4e-37   Brassica rapa
emb|CAN81240.1|  hypothetical protein VITISV_031075                     147   4e-37   Vitis vinifera
ref|XP_009620181.1|  PREDICTED: cation/H(+) antiporter 18-like          147   5e-37   Nicotiana tomentosiformis
emb|CDX94208.1|  BnaC07g38420D                                          147   6e-37   
gb|EYU40046.1|  hypothetical protein MIMGU_mgv1a001527mg                147   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_009135538.1|  PREDICTED: cation/H(+) antiporter 19               147   6e-37   
ref|XP_006413527.1|  hypothetical protein EUTSA_v10024412mg             145   1e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009137322.1|  PREDICTED: cation/H(+) antiporter 17               145   1e-36   Brassica rapa
emb|CDY35447.1|  BnaC03g62130D                                          145   1e-36   Brassica napus [oilseed rape]
ref|XP_011080876.1|  PREDICTED: cation/H(+) antiporter 18-like          145   1e-36   
ref|XP_007158549.1|  hypothetical protein PHAVU_002G161600g             145   2e-36   Phaseolus vulgaris [French bean]
ref|XP_011077450.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    145   2e-36   
gb|EAZ29140.1|  hypothetical protein OsJ_13203                          144   2e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CDP12106.1|  unnamed protein product                                145   2e-36   Coffea canephora [robusta coffee]
ref|XP_010909726.1|  PREDICTED: cation/H(+) antiporter 19               145   2e-36   Elaeis guineensis
ref|XP_008662071.1|  PREDICTED: cation/H(+) antiporter 19-like          145   2e-36   Zea mays [maize]
gb|EPS69500.1|  hypothetical protein M569_05263                         145   2e-36   Genlisea aurea
gb|ACC91238.1|  putative cation/hydrogen exchanger                      145   2e-36   Arabidopsis halleri
ref|NP_001067282.2|  Os12g0616500                                       145   2e-36   
ref|XP_002442551.1|  hypothetical protein SORBIDRAFT_08g021730          145   3e-36   Sorghum bicolor [broomcorn]
emb|CDX82359.1|  BnaA03g34620D                                          145   3e-36   
gb|EYU23392.1|  hypothetical protein MIMGU_mgv1a024127mg                144   3e-36   Erythranthe guttata [common monkey flower]
gb|EAY92425.1|  hypothetical protein OsI_14159                          144   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_008369567.1|  PREDICTED: cation/H(+) antiporter 19-like          145   3e-36   Malus domestica [apple tree]
ref|XP_006654211.1|  PREDICTED: cation/H(+) antiporter 19-like          144   3e-36   
ref|NP_001173696.1|  Os03g0828600                                       144   3e-36   
ref|XP_004146578.1|  PREDICTED: cation/H(+) antiporter 18-like          145   3e-36   Cucumis sativus [cucumbers]
emb|CDY03530.1|  BnaC01g15520D                                          144   4e-36   
ref|XP_008451982.1|  PREDICTED: cation/H(+) antiporter 18-like          144   4e-36   Cucumis melo [Oriental melon]
ref|XP_002442550.1|  hypothetical protein SORBIDRAFT_08g021720          144   4e-36   
ref|XP_004505591.1|  PREDICTED: cation/H(+) antiporter 19-like          144   5e-36   Cicer arietinum [garbanzo]
ref|XP_009359907.1|  PREDICTED: cation/H(+) antiporter 19-like          144   5e-36   Pyrus x bretschneideri [bai li]
gb|KDO76404.1|  hypothetical protein CISIN_1g003702mg                   144   6e-36   Citrus sinensis [apfelsine]
ref|XP_006439425.1|  hypothetical protein CICLE_v10018903mg             144   6e-36   Citrus clementina [clementine]
ref|XP_009402488.1|  PREDICTED: cation/H(+) antiporter 19-like          144   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008654236.1|  PREDICTED: uncharacterized protein LOC100191...    144   6e-36   Zea mays [maize]
ref|XP_010106576.1|  Cation/H(+) antiporter 18                          144   6e-36   Morus notabilis
ref|XP_006476453.1|  PREDICTED: cation/H(+) antiporter 18-like is...    144   6e-36   Citrus sinensis [apfelsine]
ref|XP_003550583.1|  PREDICTED: cation/H(+) antiporter 19-like          144   7e-36   Glycine max [soybeans]
emb|CDY69175.1|  BnaCnng62230D                                          144   7e-36   Brassica napus [oilseed rape]
gb|KHN17780.1|  Cation/H(+) antiporter 19                               144   7e-36   Glycine soja [wild soybean]
gb|EEC69681.1|  hypothetical protein OsI_39126                          144   7e-36   Oryza sativa Indica Group [Indian rice]
emb|CDY24802.1|  BnaA08g15080D                                          144   7e-36   Brassica napus [oilseed rape]
emb|CDY47629.1|  BnaA01g13360D                                          143   9e-36   Brassica napus [oilseed rape]
ref|XP_010101602.1|  Cation/H(+) antiporter 18                          143   9e-36   Morus notabilis
ref|XP_002297994.1|  cation/hydrogen exchanger family protein           143   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009109299.1|  PREDICTED: cation/H(+) antiporter 17-like          143   9e-36   Brassica rapa
ref|XP_010533613.1|  PREDICTED: cation/H(+) antiporter 18-like          143   9e-36   Tarenaya hassleriana [spider flower]
emb|CDP12105.1|  unnamed protein product                                143   1e-35   Coffea canephora [robusta coffee]
ref|XP_006406710.1|  hypothetical protein EUTSA_v10020094mg             143   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010541354.1|  PREDICTED: cation/H(+) antiporter 17-like          143   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_002440851.1|  hypothetical protein SORBIDRAFT_09g008200          143   1e-35   Sorghum bicolor [broomcorn]
ref|XP_004298855.1|  PREDICTED: cation/H(+) antiporter 18-like          143   1e-35   Fragaria vesca subsp. vesca
ref|NP_001159300.1|  uncharacterized protein LOC100304392               143   1e-35   Zea mays [maize]
ref|XP_009614856.1|  PREDICTED: cation/H(+) antiporter 18-like          142   2e-35   Nicotiana tomentosiformis
ref|XP_009393134.1|  PREDICTED: cation/H(+) antiporter 19-like          142   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981194.1|  PREDICTED: cation/H(+) antiporter 19-like          142   2e-35   
ref|XP_007225273.1|  hypothetical protein PRUPE_ppa001482mg             142   2e-35   Prunus persica
ref|XP_008222309.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    142   2e-35   
gb|KEH32403.1|  cation/H+ exchanger 3                                   142   2e-35   Medicago truncatula
ref|XP_011073516.1|  PREDICTED: cation/H(+) antiporter 18-like          142   2e-35   Sesamum indicum [beniseed]
ref|XP_004963207.1|  PREDICTED: cation/H(+) antiporter 19-like is...    142   2e-35   Setaria italica
ref|XP_002978431.1|  hypothetical protein SELMODRAFT_50946              142   2e-35   
ref|XP_008390248.1|  PREDICTED: cation/H(+) antiporter 19               142   3e-35   
ref|XP_004252574.1|  PREDICTED: cation/H(+) antiporter 18               142   3e-35   Solanum lycopersicum
ref|XP_009353458.1|  PREDICTED: cation/H(+) antiporter 19               142   3e-35   Pyrus x bretschneideri [bai li]
ref|NP_188390.2|  cation/H(+) antiporter 19                             142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EAY97346.1|  hypothetical protein OsI_19269                          140   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_002883073.1|  predicted protein                                  142   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_004146576.1|  PREDICTED: cation/H(+) antiporter 18-like          142   3e-35   Cucumis sativus [cucumbers]
ref|XP_004146577.1|  PREDICTED: cation/H(+) antiporter 18-like          141   6e-35   Cucumis sativus [cucumbers]
ref|XP_007154518.1|  hypothetical protein PHAVU_003G125300g             141   6e-35   Phaseolus vulgaris [French bean]
ref|XP_003542393.1|  PREDICTED: cation/H(+) antiporter 19-like          141   7e-35   Glycine max [soybeans]
ref|XP_010043343.1|  PREDICTED: cation/H(+) antiporter 19               140   8e-35   Eucalyptus grandis [rose gum]
gb|KHN45029.1|  Cation/H(+) antiporter 19                               140   8e-35   Glycine soja [wild soybean]
gb|AES89643.2|  cation/H+ exchanger 3                                   140   9e-35   Medicago truncatula
ref|XP_004164366.1|  PREDICTED: cation/H(+) antiporter 18-like          140   1e-34   
ref|XP_002463597.1|  hypothetical protein SORBIDRAFT_01g002640          140   1e-34   Sorghum bicolor [broomcorn]
ref|XP_002970274.1|  hypothetical protein SELMODRAFT_231581             140   1e-34   
ref|XP_008451983.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    140   1e-34   
ref|XP_004244724.1|  PREDICTED: cation/H(+) antiporter 18-like          140   1e-34   Solanum lycopersicum
ref|XP_006297013.1|  hypothetical protein CARUB_v10013004mg             140   1e-34   
ref|XP_010465813.1|  PREDICTED: cation/H(+) antiporter 19 isoform X1    140   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006360740.1|  PREDICTED: cation/H(+) antiporter 18-like          140   1e-34   Solanum tuberosum [potatoes]
ref|XP_009796404.1|  PREDICTED: cation/H(+) antiporter 18-like          140   1e-34   Nicotiana sylvestris
ref|NP_001055076.1|  Os05g0276100                                       140   1e-34   
ref|XP_010505628.1|  PREDICTED: cation/H(+) antiporter 19-like          140   2e-34   Camelina sativa [gold-of-pleasure]
emb|CBI26043.3|  unnamed protein product                                139   2e-34   Vitis vinifera
ref|XP_004508061.1|  PREDICTED: cation/H(+) antiporter 19-like          140   2e-34   Cicer arietinum [garbanzo]
ref|XP_006664748.1|  PREDICTED: cation/H(+) antiporter 19-like          139   2e-34   
ref|XP_003543796.1|  PREDICTED: cation/H(+) antiporter 19-like          139   2e-34   Glycine max [soybeans]
ref|XP_002270854.1|  PREDICTED: cation/H(+) antiporter 19               139   2e-34   Vitis vinifera
ref|XP_002963280.1|  hypothetical protein SELMODRAFT_80221              139   2e-34   
emb|CBI34422.3|  unnamed protein product                                138   3e-34   Vitis vinifera
ref|XP_007210361.1|  hypothetical protein PRUPE_ppa001551mg             139   3e-34   Prunus persica
ref|XP_008238996.1|  PREDICTED: cation/H(+) antiporter 18-like          139   3e-34   Prunus mume [ume]
ref|XP_006439427.1|  hypothetical protein CICLE_v10018864mg             139   4e-34   Citrus clementina [clementine]
ref|XP_006439426.1|  hypothetical protein CICLE_v10018864mg             139   4e-34   
ref|XP_010910508.1|  PREDICTED: cation/H(+) antiporter 18-like          139   4e-34   
ref|XP_008798688.1|  PREDICTED: cation/H(+) antiporter 18-like          138   5e-34   
ref|XP_002272080.1|  PREDICTED: cation/H(+) antiporter 18               138   6e-34   Vitis vinifera
ref|XP_007040405.1|  Cation/H+ exchanger 18 isoform 1                   138   6e-34   
emb|CDY52818.1|  BnaC04g53650D                                          137   7e-34   
ref|XP_006476457.1|  PREDICTED: cation/H(+) antiporter 18-like is...    138   7e-34   
ref|XP_006476456.1|  PREDICTED: cation/H(+) antiporter 18-like is...    138   8e-34   
ref|XP_011026948.1|  PREDICTED: cation/H(+) antiporter 18-like          137   1e-33   
emb|CDY44462.1|  BnaCnng11150D                                          137   1e-33   
ref|XP_004511538.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    137   1e-33   
ref|XP_003611041.1|  Na+/H+ antiporter-like protein                     137   1e-33   
gb|EMT05571.1|  K(+)/H(+) antiporter 1                                  137   2e-33   
ref|XP_002974580.1|  hypothetical protein SELMODRAFT_102077             137   2e-33   
gb|EEE53617.1|  hypothetical protein OsJ_36882                          137   2e-33   
ref|XP_006405324.1|  hypothetical protein EUTSA_v10027645mg             136   2e-33   
emb|CDY39729.1|  BnaA04g11240D                                          136   2e-33   
ref|XP_003611042.1|  Cation proton exchanger                            136   3e-33   
ref|XP_006285823.1|  hypothetical protein CARUB_v10007299mg             136   3e-33   
tpg|DAA47524.1|  TPA: hypothetical protein ZEAMMB73_165935              135   4e-33   
ref|XP_009140104.1|  PREDICTED: cation/H(+) antiporter 18               135   5e-33   
ref|XP_010527098.1|  PREDICTED: cation/H(+) antiporter 15               135   5e-33   
dbj|BAJ98631.1|  predicted protein                                      135   8e-33   
ref|XP_001773370.1|  predicted protein                                  135   9e-33   
gb|EPS69438.1|  hypothetical protein M569_05328                         134   1e-32   
ref|XP_010441325.1|  PREDICTED: cation/H(+) antiporter 18               134   1e-32   
gb|EMS54712.1|  Cation/H(+) antiporter 19                               134   1e-32   
ref|XP_010246811.1|  PREDICTED: cation/H(+) antiporter 19               134   2e-32   
ref|XP_010447730.1|  PREDICTED: cation/H(+) antiporter 18-like          134   2e-32   
gb|AAX49546.1|  cation/H+ exchanger                                     134   3e-32   
ref|NP_198976.3|  cation/H(+) antiporter 18                             134   3e-32   
gb|KDP25352.1|  hypothetical protein JCGZ_20508                         133   3e-32   
ref|XP_002868583.1|  ATCHX18                                            133   4e-32   
ref|XP_006366744.1|  PREDICTED: cation/H(+) antiporter 15-like          133   5e-32   
ref|XP_010433872.1|  PREDICTED: cation/H(+) antiporter 17-like          132   6e-32   
ref|XP_007048418.1|  Cation/hydrogen exchanger 15                       132   6e-32   
ref|XP_010448669.1|  PREDICTED: cation/H(+) antiporter 17-like          132   7e-32   
ref|XP_006409680.1|  hypothetical protein EUTSA_v10023201mg             132   8e-32   
ref|XP_010436112.1|  PREDICTED: cation/H(+) antiporter 18-like          132   8e-32   
ref|XP_008241276.1|  PREDICTED: cation/H(+) antiporter 20-like is...    132   9e-32   
gb|KJB75294.1|  hypothetical protein B456_012G035800                    132   1e-31   
gb|EMS51196.1|  Cation/H(+) antiporter 17                               129   1e-31   
emb|CDX73531.1|  BnaC08g24720D                                          125   1e-31   
ref|XP_011462856.1|  PREDICTED: cation/H(+) antiporter 19               132   1e-31   
gb|KHG26273.1|  Cation/H(+) antiporter 18 -like protein                 132   1e-31   
ref|XP_009595814.1|  PREDICTED: cation/H(+) antiporter 15-like is...    131   1e-31   
ref|XP_010090834.1|  Cation/H(+) antiporter 15                          131   2e-31   
ref|XP_010439142.1|  PREDICTED: cation/H(+) antiporter 17-like          131   2e-31   
ref|XP_010433871.1|  PREDICTED: cation/H(+) antiporter 17               131   2e-31   
ref|XP_010096456.1|  Cation/H(+) antiporter 18                          131   2e-31   
ref|XP_009112897.1|  PREDICTED: cation/H(+) antiporter 16               131   2e-31   
ref|XP_011081225.1|  PREDICTED: cation/H(+) antiporter 15-like          131   2e-31   
gb|KJB19063.1|  hypothetical protein B456_003G083300                    131   2e-31   
gb|KDO50743.1|  hypothetical protein CISIN_1g043446mg                   130   2e-31   
ref|XP_008461025.1|  PREDICTED: cation/H(+) antiporter 15               130   3e-31   
ref|XP_009616485.1|  PREDICTED: cation/H(+) antiporter 15-like          130   4e-31   
ref|XP_006432183.1|  hypothetical protein CICLE_v10000276mg             130   4e-31   
ref|XP_004147368.1|  PREDICTED: cation/H(+) antiporter 15-like          130   4e-31   
ref|XP_009801607.1|  PREDICTED: cation/H(+) antiporter 15-like          130   4e-31   
ref|NP_176599.2|  cation/H(+) antiporter 16                             130   5e-31   
gb|EYU30300.1|  hypothetical protein MIMGU_mgv1a026576mg                130   5e-31   
ref|XP_006283122.1|  hypothetical protein CARUB_v10004144mg             130   5e-31   
ref|XP_004246149.1|  PREDICTED: cation/H(+) antiporter 15               130   5e-31   
ref|XP_002509894.1|  Na(+)/H(+) antiporter, putative                    130   6e-31   
ref|XP_009338770.1|  PREDICTED: cation/H(+) antiporter 20-like is...    129   8e-31   
ref|XP_009776809.1|  PREDICTED: cation/H(+) antiporter 15-like          129   9e-31   
ref|XP_002867692.1|  ATCHX17                                            129   1e-30   
emb|CDY37213.1|  BnaA09g08340D                                          129   1e-30   
ref|XP_002516306.1|  Na(+)/H(+) antiporter, putative                    129   1e-30   
ref|XP_009112379.1|  PREDICTED: cation/H(+) antiporter 15               129   1e-30   
ref|NP_194101.1|  cation/H(+) antiporter 17                             129   1e-30   
emb|CDX81450.1|  BnaC09g08610D                                          129   1e-30   
gb|EPS59894.1|  hypothetical protein M569_14908                         128   2e-30   
gb|KFK39941.1|  hypothetical protein AALP_AA3G309700                    128   2e-30   
ref|XP_006837063.1|  hypothetical protein AMTR_s00110p00080970          127   3e-30   
ref|XP_004486258.1|  PREDICTED: cation/H(+) antiporter 15-like          127   6e-30   
ref|XP_008649801.1|  PREDICTED: cation/H(+) antiporter 15-like          127   7e-30   
ref|NP_001044623.2|  Os01g0817400                                       125   7e-30   
gb|KDP39397.1|  hypothetical protein JCGZ_03679                         126   9e-30   
ref|XP_006355520.1|  PREDICTED: cation/H(+) antiporter 15-like          125   2e-29   
ref|XP_006299510.1|  hypothetical protein CARUB_v10015680mg             125   2e-29   
ref|XP_008451981.1|  PREDICTED: cation/H(+) antiporter 18-like          125   3e-29   
ref|XP_004162369.1|  PREDICTED: cation/H(+) antiporter 18-like          125   3e-29   
gb|EMS54713.1|  Cation/H(+) antiporter 19                               125   3e-29   
ref|XP_003564480.1|  PREDICTED: cation/H(+) antiporter 15-like          125   3e-29   
emb|CBI34424.3|  unnamed protein product                                118   4e-29   
gb|KEH36491.1|  cation/H+ exchanger 3                                   124   4e-29   
ref|XP_002310518.2|  hypothetical protein POPTR_0007s04230g             124   5e-29   
gb|EAY98474.1|  hypothetical protein OsI_20388                          124   6e-29   
ref|NP_001055872.1|  Os05g0485000                                       124   6e-29   
ref|XP_003566297.1|  PREDICTED: cation/H(+) antiporter 20-like          121   7e-29   
ref|XP_011023089.1|  PREDICTED: cation/H(+) antiporter 15               124   7e-29   
gb|KFK36591.1|  hypothetical protein AALP_AA4G143600                    123   9e-29   
gb|KJB40478.1|  hypothetical protein B456_007G065900                    124   9e-29   
ref|XP_003547128.2|  PREDICTED: cation/H(+) antiporter 15-like          124   9e-29   
emb|CDP11006.1|  unnamed protein product                                116   1e-28   
gb|EAY76275.1|  hypothetical protein OsI_04210                          123   1e-28   
dbj|BAB62576.1|  Na+/H+ antiporter-like protein                         123   1e-28   
gb|KGN53374.1|  hypothetical protein Csa_4G050780                       123   1e-28   
ref|XP_004149769.1|  PREDICTED: cation/H(+) antiporter 18-like          123   1e-28   
gb|KHN31156.1|  Cation/H(+) antiporter 15                               123   1e-28   
gb|EMT30539.1|  K(+)/H(+) antiporter 13                                 121   1e-28   
ref|XP_004962221.1|  PREDICTED: cation/H(+) antiporter 20-like          120   1e-28   
ref|XP_003522484.1|  PREDICTED: cation/H(+) antiporter 15-like          123   2e-28   
ref|XP_007213030.1|  hypothetical protein PRUPE_ppa023146mg             122   2e-28   
ref|XP_010468568.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    122   2e-28   
ref|XP_010518406.1|  PREDICTED: cation/H(+) antiporter 15-like          122   2e-28   
ref|XP_008342861.1|  PREDICTED: cation/H(+) antiporter 15               122   2e-28   
ref|XP_002441016.1|  hypothetical protein SORBIDRAFT_09g018910          120   2e-28   
ref|XP_004502946.1|  PREDICTED: cation/H(+) antiporter 15-like          123   2e-28   
ref|XP_010273345.1|  PREDICTED: cation/H(+) antiporter 15-like          122   2e-28   
gb|AFW82335.1|  hypothetical protein ZEAMMB73_343625                    122   2e-28   
ref|XP_002441279.1|  hypothetical protein SORBIDRAFT_09g023730          122   3e-28   
ref|XP_003566124.1|  PREDICTED: cation/H(+) antiporter 15-like          122   3e-28   
ref|XP_011070107.1|  PREDICTED: cation/H(+) antiporter 15-like          122   4e-28   
ref|NP_178985.1|  cation/H(+) antiporter 15                             121   5e-28   
emb|CDP09934.1|  unnamed protein product                                121   5e-28   
ref|XP_009338771.1|  PREDICTED: cation/H(+) antiporter 20-like is...    120   6e-28   
gb|EYU18565.1|  hypothetical protein MIMGU_mgv1a022165mg                120   9e-28   
emb|CDY47435.1|  BnaA08g29740D                                          120   9e-28   
ref|XP_009124800.1|  PREDICTED: cation/H(+) antiporter 15               120   1e-27   
ref|XP_002883804.1|  hypothetical protein ARALYDRAFT_480314             120   1e-27   
ref|XP_007137799.1|  hypothetical protein PHAVU_009G156500g             120   1e-27   
emb|CDX71162.1|  BnaC07g04410D                                          120   2e-27   
ref|XP_008657132.1|  PREDICTED: cation/H(+) antiporter 15-like          120   2e-27   
gb|EMS63173.1|  Cation/H(+) antiporter 15                               119   2e-27   
ref|XP_010436413.1|  PREDICTED: cation/H(+) antiporter 17-like          119   3e-27   
ref|XP_003602627.1|  Cation proton exchanger                            119   3e-27   
dbj|BAK06977.1|  predicted protein                                      119   4e-27   
ref|XP_010680215.1|  PREDICTED: cation/H(+) antiporter 15               119   5e-27   
ref|XP_002456534.1|  hypothetical protein SORBIDRAFT_03g038000          119   5e-27   
ref|XP_003630280.1|  Cation proton exchanger                            117   1e-26   
gb|EMS62572.1|  Cation/H(+) antiporter 15                               118   1e-26   
gb|EMS52978.1|  Cation/H(+) antiporter 15                               117   1e-26   
ref|XP_010034375.1|  PREDICTED: cation/H(+) antiporter 15               117   2e-26   
ref|XP_002886359.1|  hypothetical protein ARALYDRAFT_315017             117   2e-26   
ref|XP_010277628.1|  PREDICTED: cation/H(+) antiporter 15-like          117   2e-26   
ref|XP_006646431.1|  PREDICTED: cation/H(+) antiporter 15-like          117   2e-26   
gb|EEE63552.1|  hypothetical protein OsJ_18368                          113   4e-26   
ref|XP_011464951.1|  PREDICTED: cation/H(+) antiporter 15               116   4e-26   
ref|NP_001055404.1|  Os05g0382200                                       113   6e-26   
emb|CDM84725.1|  unnamed protein product                                115   6e-26   
dbj|BAK03649.1|  predicted protein                                      115   7e-26   
emb|CBI37527.3|  unnamed protein product                                115   9e-26   
ref|XP_002262677.2|  PREDICTED: cation/H(+) antiporter 15               114   1e-25   
emb|CAN66285.1|  hypothetical protein VITISV_011183                     114   1e-25   
ref|XP_010533612.1|  PREDICTED: cation/H(+) antiporter 16               114   1e-25   
ref|XP_007148262.1|  hypothetical protein PHAVU_006G193500g             114   2e-25   
ref|XP_010277629.1|  PREDICTED: cation/H(+) antiporter 15-like          112   1e-24   
gb|AES94002.2|  cation/H+ exchanger 3                                   111   1e-24   
ref|XP_003611044.1|  Cation proton exchanger                            111   2e-24   
gb|EMT05703.1|  hypothetical protein F775_42386                         104   1e-23   
ref|XP_004972230.1|  PREDICTED: cation/H(+) antiporter 15-like          109   1e-23   
ref|XP_004503932.1|  PREDICTED: cation/H(+) antiporter 15-like          105   2e-22   
ref|XP_007159847.1|  hypothetical protein PHAVU_002G272700g             105   3e-22   
gb|EYU24742.1|  hypothetical protein MIMGU_mgv1a026419mg                104   4e-22   
ref|XP_010237010.1|  PREDICTED: cation/H(+) antiporter 19-like          103   1e-21   
ref|XP_003524307.1|  PREDICTED: cation/H(+) antiporter 15-like          102   3e-21   
gb|EMT05569.1|  K(+)/H(+) antiporter 13                                 101   4e-21   
ref|XP_010436414.1|  PREDICTED: cation/H(+) antiporter 17-like          101   6e-21   
ref|XP_008804682.1|  PREDICTED: cation/H(+) antiporter 15               100   2e-20   
ref|XP_009334473.1|  PREDICTED: cation/H(+) antiporter 18             92.8    3e-20   
gb|ESA07345.1|  hypothetical protein GLOINDRAFT_349510                98.6    4e-20   
ref|XP_009391148.1|  PREDICTED: cation/H(+) antiporter 15             97.4    1e-19   
ref|XP_007330305.1|  hypothetical protein AGABI1DRAFT_121014          97.4    1e-19   
ref|XP_006462999.1|  hypothetical protein AGABI2DRAFT_186795          97.4    1e-19   
ref|XP_009546042.1|  K+/H+ antiporter                                 97.1    2e-19   
gb|KDO76396.1|  hypothetical protein CISIN_1g0036452mg                96.3    2e-19   
gb|KDO76397.1|  hypothetical protein CISIN_1g0036452mg                96.3    2e-19   
dbj|GAN09340.1|  conserved hypothetical protein                       96.7    2e-19   
gb|KDO76398.1|  hypothetical protein CISIN_1g0036452mg                96.3    2e-19   
ref|XP_010923024.1|  PREDICTED: cation/H(+) antiporter 15             96.3    3e-19   
ref|XP_007768594.1|  hypothetical protein CONPUDRAFT_144073           96.3    4e-19   
ref|XP_010227421.1|  PREDICTED: cation/H(+) antiporter 19-like        95.1    7e-19   
ref|XP_006682130.1|  hypothetical protein BATDEDRAFT_14293            93.2    8e-19   
gb|ESA08685.1|  hypothetical protein GLOINDRAFT_349009                94.4    1e-18   
emb|CEP09315.1|  hypothetical protein                                 94.4    1e-18   
gb|EST08640.1|  sensory transduction histidine kinase                 94.0    2e-18   
gb|ELU45551.1|  potassium:hydrogen antiporter                         94.0    2e-18   
ref|XP_007341417.1|  hypothetical protein AURDEDRAFT_160422           93.6    3e-18   
gb|EWM21712.1|  k+ homeostasis protein kha1                           90.1    3e-18   
ref|XP_006846157.1|  hypothetical protein AMTR_s00012p00187890        92.8    4e-18   
ref|XP_007930353.1|  hypothetical protein MYCFIDRAFT_143206           91.7    5e-18   
ref|XP_001838151.2|  hypothetical protein CC1G_05632                  92.8    5e-18   
emb|CCO31871.1|  K(+)/H(+) antiporter 1                               92.4    6e-18   
dbj|GAC98359.1|  hypothetical protein PHSY_005952                     92.8    6e-18   
emb|CEL63655.1|  K(+)/H(+) antiporter 1 OS=Saccharomyces cerevisi...  92.4    6e-18   
gb|KHN33866.1|  Cation/H(+) antiporter 19                             92.4    6e-18   
ref|XP_007270794.1|  hypothetical protein FOMMEDRAFT_113492           92.4    6e-18   
gb|KII95451.1|  hypothetical protein PLICRDRAFT_48410                 92.4    7e-18   
emb|CDH50442.1|  k homeostasis protein                                92.0    8e-18   
emb|CBQ69726.1|  related to KHA1-Putative K+/H+ antiporter            92.0    9e-18   
gb|EWM23549.1|  potassium:hydrogen antiporter                         91.7    9e-18   
ref|XP_009266929.1|  K(+)/H(+) antiporter 1                           91.7    1e-17   
ref|XP_008227634.1|  PREDICTED: cation/H(+) antiporter 15             91.7    1e-17   
gb|KIL66879.1|  hypothetical protein M378DRAFT_9902                   92.0    1e-17   
ref|XP_010275195.1|  PREDICTED: cation/H(+) antiporter 15-like        91.3    1e-17   
ref|XP_007880050.1|  hypothetical protein PFL1_04333                  91.7    1e-17   
emb|CCO34642.1|  K(+)/H(+) antiporter 1                               87.0    1e-17   
ref|XP_007270704.1|  hypothetical protein FOMMEDRAFT_94794            91.3    2e-17   
gb|EUC54019.1|  K(+)/H(+) antiporter 1                                90.9    2e-17   
ref|XP_008037368.1|  hypothetical protein TRAVEDRAFT_46606            90.9    2e-17   
gb|EPT05342.1|  hypothetical protein FOMPIDRAFT_1021595               90.9    2e-17   
gb|KIJ97078.1|  hypothetical protein K443DRAFT_106166                 90.9    2e-17   
ref|XP_007769541.1|  hypothetical protein CONPUDRAFT_90770            90.9    3e-17   
emb|CCO35665.1|  K(+)/H(+) antiporter 1                               87.4    3e-17   
ref|XP_002839525.1|  hypothetical protein                             90.5    3e-17   
emb|CCG84845.1|  protein of unknown function                          90.5    3e-17   
gb|KDE02700.1|  hypothetical protein MVLG_06762                       90.5    3e-17   
gb|EPB85649.1|  hypothetical protein HMPREF1544_07556                 90.1    4e-17   
ref|XP_007866913.1|  hypothetical protein GLOTRDRAFT_77272            90.1    4e-17   
ref|XP_009402776.1|  PREDICTED: cation/H(+) antiporter 15-like        89.7    4e-17   
ref|XP_001885682.1|  predicted protein                                90.1    4e-17   
ref|XP_011096534.1|  PREDICTED: cation/H(+) antiporter 15-like        89.7    5e-17   
gb|KIJ57015.1|  hypothetical protein M422DRAFT_198385                 89.7    5e-17   
ref|XP_002844899.1|  K(+)/H(+) antiporter 1                           89.7    5e-17   
gb|KIY45592.1|  hypothetical protein FISHEDRAFT_66875                 89.7    5e-17   
dbj|GAK66674.1|  cation/H+ exchanger                                  89.7    5e-17   
gb|EDK36341.2|  hypothetical protein PGUG_00439                       89.4    5e-17   
ref|XP_006957829.1|  hypothetical protein WALSEDRAFT_60132            89.7    6e-17   
gb|EPB83954.1|  hypothetical protein HMPREF1544_09288                 89.4    6e-17   
gb|EGE03927.1|  K(+)/H(+) antiporter 1                                89.7    6e-17   
emb|CCF49233.1|  related to KHA1-Putative K+/H+ antiporter            89.7    6e-17   
dbj|GAC77461.1|  sensory transduction histidine kinase                89.7    6e-17   
ref|XP_011391640.1|  hypothetical protein UMAG_04771                  89.7    6e-17   
ref|XP_006341305.1|  PREDICTED: cation/H(+) antiporter 24-like        89.7    7e-17   



>gb|KDO43692.1| hypothetical protein CISIN_1g036676mg [Citrus sinensis]
Length=413

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++VVSRF AFL +PLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILVVSRFLAFLFRPLRQPKVIAEIVGGIVLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+M  IFP+WS P LESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  71   GRNKEFMHHIFPKWSTPTLESVASIGLLFFLFLVGLELDLSSIRRSGKRAFVIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R  + G D+VG+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFVCGIGVAFVLRNTIDGLDQVGYGPFLVFMGVALSITAFPVLA  174



>ref|XP_010111493.1| Cation/H(+) antiporter 20 [Morus notabilis]
 gb|EXC31016.1| Cation/H(+) antiporter 20 [Morus notabilis]
Length=867

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NP +FA PLLI+QT LV+ +SRF AFLLKPLRQPKVIAEILGG++LGPSA 
Sbjct  10   SSDGAWQGDNPFHFAFPLLILQTILVLFISRFLAFLLKPLRQPKVIAEILGGILLGPSAL  69

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP WS PILESV+SIGLLF+LFLVG+ELDLSS+RR G+SAF IA AGIS+
Sbjct  70   GRNEDFLRLVFPSWSTPILESVASIGLLFFLFLVGIELDLSSIRRTGRSAFAIALAGISI  129

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+GITF+ RR V+G + VG+A Y VFMGV+LS+T FPVLA
Sbjct  130  PFIFGVGITFILRRAVKGEEHVGYAQYLVFMGVSLSVTAFPVLA  173



>ref|XP_002527747.1| monovalent cation:proton antiporter, putative [Ricinus communis]
 gb|EEF34660.1| monovalent cation:proton antiporter, putative [Ricinus communis]
Length=847

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++VVSRFFAFL KPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGVWQGDNPLHFAFPLLIVQTTLILVVSRFFAFLFKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++YMQ IFP+WS  ILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  71   GRNKQYMQWIFPKWSILILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG+ F+ RR V+G DEVG+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFICGIGVAFVLRRTVKGEDEVGYGPFLVFMGVALSITAFPVLA  174



>gb|KJB76713.1| hypothetical protein B456_012G102300 [Gossypium raimondii]
Length=839

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL+FA PLLIVQTTL++V+SRF AFLLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGAWQGDNPLDFAFPLLIVQTTLILVLSRFLAFLLKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP WS PILE+V+SIGLLF+LFLVGLELDLSS+RR GK AF IA +GISL
Sbjct  71   GRNKDYLHRIFPSWSMPILETVASIGLLFFLFLVGLELDLSSIRRTGKRAFGIALSGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG+ F+ R+ V+GAD+VGF  + VFMGVALSIT FPVLA
Sbjct  131  PFICGIGVAFVIRKTVEGADKVGFGQFLVFMGVALSITAFPVLA  174



>gb|ABD32903.1| Sodium/hydrogen exchanger [Medicago truncatula]
Length=397

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLNFA PLLI+QTTLV+VVSR  AFL KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGIWQGDNPLNFAFPLLIIQTTLVLVVSRSLAFLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+Q IFP WS P LESV+SIGLLF+LFLVGLELDL+S+RR+GK AF IAA GISL
Sbjct  71   GRNKDYLQRIFPRWSMPTLESVASIGLLFFLFLVGLELDLNSIRRSGKRAFSIAACGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVL  598
            PFV GIG+  +FR+ + GAD+ GF+ + VFMGVALSIT FPVL
Sbjct  131  PFVSGIGVAIVFRKTIDGADKAGFSTFLVFMGVALSITAFPVL  173



>gb|KJB16931.1| hypothetical protein B456_002G255100 [Gossypium raimondii]
Length=827

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQTTL++V+SRF AFLLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTTLILVLSRFLAFLLKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++YM  IFP WS P+LE+V+SIGLLF+LFLVGLELDL+S+RR+G+ AF IA  GISL
Sbjct  71   GRNEDYMHRIFPSWSMPVLETVASIGLLFFLFLVGLELDLTSIRRSGRKAFGIAFCGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G G+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  131  PFICGFGVAFILRKTVDGADKVGYGQFIVFMGVALSITAFPVLA  174



>ref|XP_003625493.1| K(+)/H(+) antiporter [Medicago truncatula]
Length=406

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLNFA PLLI+QTTLV+VVSR  AFL KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGIWQGDNPLNFAFPLLIIQTTLVLVVSRSLAFLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+Q IFP WS P LESV+SIGLLF+LFLVGLELDL+S+RR+GK AF IAA GISL
Sbjct  71   GRNKDYLQRIFPRWSMPTLESVASIGLLFFLFLVGLELDLNSIRRSGKRAFSIAACGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVL  598
            PFV GIG+  +FR+ + GAD+ GF+ + VFMGVALSIT FPVL
Sbjct  131  PFVSGIGVAIVFRKTIDGADKAGFSTFLVFMGVALSITAFPVL  173



>ref|XP_007027071.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 ref|XP_007027072.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 ref|XP_007027073.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 ref|XP_007027074.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 gb|EOY07573.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 gb|EOY07574.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 gb|EOY07575.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
 gb|EOY07576.1| Cation/H+ exchanger 20 isoform 1 [Theobroma cacao]
Length=645

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL+FA PLLIVQTTL++V+SRF AFLLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGAWQGDNPLDFAFPLLIVQTTLILVLSRFLAFLLKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP WS P+LE+V+SIGL+F+LFLVGLELDLSS+RR+G+ AF IA AGISL
Sbjct  71   GRNEDYLHRIFPSWSMPVLETVASIGLIFFLFLVGLELDLSSIRRSGRRAFGIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  131  PFVCGIGVAFVLRKTVDGADKVGYGQFLVFMGVALSITAFPVLA  174



>ref|XP_010260095.1| PREDICTED: cation/H(+) antiporter 20 [Nelumbo nucifera]
Length=842

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG+NPLN+A PLLIVQTTLVIV+SR  AFLLKPLRQPKVIAEI+GG+ILGPS  
Sbjct  11   SSDGAWQGENPLNYAFPLLIVQTTLVIVISRCLAFLLKPLRQPKVIAEIVGGIILGPSVL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDL+S+RR+G+ A  IAAAGISL
Sbjct  71   GRNKTYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLNSIRRSGRRALGIAAAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R+ + GADEVG++ + VFMGVALSIT FPVLA
Sbjct  131  PFVSGIGVAFVLRKTIDGADEVGYSQFFVFMGVALSITAFPVLA  174



>ref|XP_006429040.1| hypothetical protein CICLE_v10011060mg [Citrus clementina]
 gb|ESR42280.1| hypothetical protein CICLE_v10011060mg [Citrus clementina]
Length=842

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++VVSRF AFL +PLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILVVSRFLAFLFRPLRQPKVIAEIVGGIVLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+M  IFP+WS P LESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  71   GRNKEFMHHIFPKWSTPTLESVASIGLLFFLFLVGLELDLSSIRRSGKRAFVIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R  + G D+VG+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFVCGIGVAFVLRNTIDGLDQVGYGPFLVFMGVALSITAFPVLA  174



>ref|XP_006480781.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis]
Length=842

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++VVSRF AFL +PLRQPKVIAEI+GG++LGPSAF
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILVVSRFLAFLFRPLRQPKVIAEIVGGIVLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+M  IFP+WS P LESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  71   GRNKEFMHHIFPKWSTPTLESVASIGLLFFLFLVGLELDLSSIRRSGKRAFVIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R  + G D+VG+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFVCGIGVAFVLRNTIDGLDQVGYGPFLVFMGVALSITAFPVLA  174



>ref|XP_002527748.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34661.1| conserved hypothetical protein [Ricinus communis]
Length=799

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLN+A PLLI+QT +V+ ++RF AFL KPLRQP+V+AEI+GG++LGPSA 
Sbjct  13   SSDGVWQGDNPLNYAFPLLILQTIIVLSITRFLAFLFKPLRQPRVLAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +   +FP WS PILESV+S+GLLF+LFLVGLELD+SS+RR G++AFCIA AGISL
Sbjct  73   GRNESFSHLVFPSWSTPILESVASLGLLFFLFLVGLELDVSSIRRTGRTAFCIALAGISL  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+G++FL R+ V G D+VG+  Y +FMG+ALSIT FPVLA
Sbjct  133  PFLFGVGVSFLLRKAVHGMDKVGYGQYLMFMGIALSITAFPVLA  176



>ref|XP_010111492.1| Cation/H(+) antiporter 20 [Morus notabilis]
 gb|EXC31015.1| Cation/H(+) antiporter 20 [Morus notabilis]
Length=858

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL++A PLLIVQTTL+I++SRF AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLDYAFPLLIVQTTLIIILSRFLAFLLKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN EY+  IFP WS PILESV+SIGLLF+LFLVGLELD+SS+RR+G+ AF IA AGISL
Sbjct  71   GRNHEYLNRIFPSWSTPILESVASIGLLFFLFLVGLELDVSSIRRSGRRAFFIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+ F+ R+ V GAD+VG+  + VFMG ALSIT FPVLA
Sbjct  131  PFVSGIGVAFVLRKTVDGADQVGYGQFLVFMGCALSITAFPVLA  174



>ref|XP_011466585.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 20-like 
[Fragaria vesca subsp. vesca]
Length=840

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPLNFA PLLIVQTTL+IVVSRF AFLLKPLRQPKVIAEI+GGV+LGPSAF
Sbjct  10   ASNGLWQGDNPLNFAFPLLIVQTTLIIVVSRFLAFLLKPLRQPKVIAEIVGGVLLGPSAF  69

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN EY+ TIFP WS PILESV+SIGLLFYLFLVGLELDLSS RR+G  AF IA AGI+L
Sbjct  70   GRNTEYLHTIFPSWSTPILESVASIGLLFYLFLVGLELDLSSTRRSGTKAFGIAIAGITL  129

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG+  +FR+ + GAD+ GF  + VFMGVALSIT FPVLA
Sbjct  130  PFLCGIGVALVFRKTIYGADKAGFTQFLVFMGVALSITAFPVLA  173



>gb|AES81712.2| cation/H+ exchanger 3 [Medicago truncatula]
Length=844

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLNFA PLLI+QTTLV+VVSR  AFL KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGIWQGDNPLNFAFPLLIIQTTLVLVVSRSLAFLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+Q IFP WS P LESV+SIGLLF+LFLVGLELDL+S+RR+GK AF IAA GISL
Sbjct  71   GRNKDYLQRIFPRWSMPTLESVASIGLLFFLFLVGLELDLNSIRRSGKRAFSIAACGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVL  598
            PFV GIG+  +FR+ + GAD+ GF+ + VFMGVALSIT FPVL
Sbjct  131  PFVSGIGVAIVFRKTIDGADKAGFSTFLVFMGVALSITAFPVL  173



>emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera]
Length=859

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++ +SRF AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+G+ A  IA  GI+L
Sbjct  71   GRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G+ F+ R+ V GAD+ G+  + VFMGVALSIT FPVLA
Sbjct  131  PFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLA  174



>ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20 [Vitis vinifera]
Length=839

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++ +SRF AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+G+ A  IA  GI+L
Sbjct  71   GRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G+ F+ R+ V GAD+ G+  + VFMGVALSIT FPVLA
Sbjct  131  PFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLA  174



>emb|CBI30584.3| unnamed protein product [Vitis vinifera]
Length=858

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTL++ +SRF AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLDFAFPLLIVQTTLILALSRFLAFLLKPLRQPKVIAEIIGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+G+ A  IA  GI+L
Sbjct  71   GRNQNYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGRKALSIATVGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G+ F+ R+ V GAD+ G+  + VFMGVALSIT FPVLA
Sbjct  131  PFVCGVGVAFVLRKSVDGADKAGYGTFLVFMGVALSITAFPVLA  174



>gb|KDO44651.1| hypothetical protein CISIN_1g0036292mg, partial [Citrus sinensis]
Length=405

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLNFA PLLI+QT LV++ S   AFL+KPLRQPKVIAEILGG++LGPSA 
Sbjct  12   SSDGAWQGDNPLNFAFPLLIIQTALVLLTSHCLAFLIKPLRQPKVIAEILGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  +FP WS PILESV+SIGLLF+LFLVGLELDLSS+R+NGKSAF IA AGI+L
Sbjct  72   GRNKEYLHLMFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRQNGKSAFKIALAGITL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G G++   ++ V G  +VG+  + +F+GV+LSIT FPVLA
Sbjct  132  PFLLGAGVSLFLQKAVDGESKVGYGQFIIFIGVSLSITAFPVLA  175



>ref|XP_003520628.2| PREDICTED: cation/H(+) antiporter 20-like [Glycine max]
Length=839

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL++A PLLIVQT LV+ VSR  AFLLKPLRQPKVIAEI+GGV+LGPSA 
Sbjct  13   SSNGVWQGDNPLDYAFPLLIVQTILVLAVSRSLAFLLKPLRQPKVIAEIVGGVLLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS P LESV+SIGLLF+LFLVGLELDL S+RR+G+ AFCIAA GISL
Sbjct  73   GRNKSYLHRIFPSWSMPTLESVASIGLLFFLFLVGLELDLHSIRRSGRKAFCIAAVGISL  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG+  + R+ V GAD+ GF  + VFMGVALSIT FPVLA
Sbjct  133  PFICGIGVAVILRKTVDGADKAGFPQFLVFMGVALSITAFPVLA  176



>gb|EYU26575.1| hypothetical protein MIMGU_mgv1a001541mg [Erythranthe guttata]
Length=799

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL++A PLLIVQT L++ V R  AFL KPL QPKVIAE++GGV+LGPSAF
Sbjct  9    SSNGVWQGDNPLDYAFPLLIVQTILILFVCRSLAFLFKPLHQPKVIAELMGGVLLGPSAF  68

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQEYM  IFP WSAPILESV+SIGL+F+LFLVGLELDL+S+RR+G+ AF IA AGISL
Sbjct  69   GRNQEYMHRIFPGWSAPILESVASIGLVFFLFLVGLELDLNSIRRSGRRAFIIAVAGISL  128

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
             F  G+G++++FR+ V GAD+VG+  Y VFMGVALSIT FPVLA
Sbjct  129  TFTLGVGVSYIFRKTVDGADKVGYPQYIVFMGVALSITAFPVLA  172



>gb|KDO44649.1| hypothetical protein CISIN_1g0039791mg, partial [Citrus sinensis]
Length=396

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLNFA PLLI+QTTLV++ S   A L+KPLRQPKVIAEILGG++LGPSA 
Sbjct  12   SSDGVWQGDNPLNFAFPLLIIQTTLVLLTSHCLAVLIKPLRQPKVIAEILGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  +FP WS PILES++S+GLLF+LFLVGLELDLSS+R+NGKSAF IA AGI+L
Sbjct  72   GRNKEYLHLVFPSWSTPILESLASVGLLFFLFLVGLELDLSSIRQNGKSAFKIALAGITL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG G++   ++ V G ++VG+  + +FMGV+LSIT FPVLA
Sbjct  132  PFLFGAGVSLFLQKAVHGENKVGYGQFIIFMGVSLSITAFPVLA  175



>emb|CBI30585.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL FA PLLIVQTTLV+ +SRF AFLLKP  QP+VIAEI+GG++LGPSA 
Sbjct  11   SSDGAWQGDNPLRFAFPLLIVQTTLVLSISRFLAFLLKPFHQPRVIAEIIGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++  +FP WS PILESV+S+GLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  71   GRNKDFLHLVFPPWSTPILESVASVGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+GITFL R+ V G D+VGF+   +F+GV+LSIT FPVLA
Sbjct  131  PFIFGVGITFLLRKAVDGEDKVGFSQCILFIGVSLSITAFPVLA  174



>ref|XP_002262680.2| PREDICTED: cation/H(+) antiporter 20 [Vitis vinifera]
Length=850

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL FA PLLIVQTTLV+ +SRF AFLLKP  QP+VIAEI+GG++LGPSA 
Sbjct  35   SSDGAWQGDNPLRFAFPLLIVQTTLVLSISRFLAFLLKPFHQPRVIAEIIGGILLGPSAL  94

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++  +FP WS PILESV+S+GLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  95   GRNKDFLHLVFPPWSTPILESVASVGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISL  154

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+GITFL R+ V G D+VGF+   +F+GV+LSIT FPVLA
Sbjct  155  PFIFGVGITFLLRKAVDGEDKVGFSQCILFIGVSLSITAFPVLA  198



>ref|XP_010037849.1| PREDICTED: cation/H(+) antiporter 20 [Eucalyptus grandis]
 gb|KCW49630.1| hypothetical protein EUGRSUZ_K03152 [Eucalyptus grandis]
Length=833

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL+FA PLLI+QTTL++ VSRF AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLDFAFPLLIIQTTLILAVSRFLAFLLKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+  IFP WS PILESV+SIGLLF+LFLVGLELDL S+RR+G+ A  IA AGISL
Sbjct  71   GRNAAYLHRIFPSWSTPILESVASIGLLFFLFLVGLELDLGSVRRSGRRALGIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  131  PFLCGIGVAFVLRKTVDGADKVGYGQFLVFMGVALSITAFPVLA  174



>ref|XP_006429043.1| hypothetical protein CICLE_v10011096mg [Citrus clementina]
 gb|ESR42283.1| hypothetical protein CICLE_v10011096mg [Citrus clementina]
Length=806

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLNFA+PLLI+QT LV++ S   AFL+KPLRQPKVIAEILGG++LGPSA 
Sbjct  12   SSDGAWQGDNPLNFAVPLLIIQTALVLLTSHCLAFLIKPLRQPKVIAEILGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  +FP WS PILESV+SIGLLF+LFLVGLELDLSS+RRNGKSAF IA AGI+L
Sbjct  72   GRNKEYLHLMFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRNGKSAFKIALAGITL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G G++   ++ V G  +VG+  + +F+GV+LSIT FPVLA
Sbjct  132  PFLLGAGVSLFLQKAVDGESKVGYGQFIIFIGVSLSITAFPVLA  175



>ref|XP_004142208.1| PREDICTED: cation/H(+) antiporter 20-like [Cucumis sativus]
Length=853

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPL+FA PLLI+Q+ L++V++RF A LLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   ASNGIWQGDNPLHFAFPLLILQSVLILVLTRFLALLLKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGIS+
Sbjct  71   GRNKTYLNHIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISV  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  131  PFFSGIGVAFVLRKTVDGADKVGYGQFIVFMGVALSITAFPVLA  174



>gb|KGN54233.1| hypothetical protein Csa_4G294410 [Cucumis sativus]
Length=855

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPL+FA PLLI+Q+ L++V++RF A LLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  13   ASNGIWQGDNPLHFAFPLLILQSVLILVLTRFLALLLKPLRQPKVIAEIVGGILLGPSAF  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGIS+
Sbjct  73   GRNKTYLNHIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISV  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  133  PFFSGIGVAFVLRKTVDGADKVGYGQFIVFMGVALSITAFPVLA  176



>ref|XP_011020326.1| PREDICTED: cation/H(+) antiporter 20 [Populus euphratica]
Length=850

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL  ALPLLIVQTTL++VVSR  AFLLKPLRQPKVIAEI GG++LGPSA 
Sbjct  18   SSNGAWQGDNPLEHALPLLIVQTTLILVVSRLLAFLLKPLRQPKVIAEIAGGILLGPSAI  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY   IFP+WS PILESV+S+GLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  78   GRNKEYFNWIFPKWSTPILESVASVGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+ + F+ R+ ++G D+VG+ P+ VF+GVALSIT FPVL+
Sbjct  138  PFVCGVAVAFVLRKTIEGEDQVGYTPFLVFIGVALSITAFPVLS  181



>ref|XP_008447651.1| PREDICTED: cation/H(+) antiporter 20 [Cucumis melo]
Length=857

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPL+FA PLLI+Q+ L++V++RF A LLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  13   ASNGIWQGDNPLHFAFPLLILQSVLILVLTRFLALLLKPLRQPKVIAEIVGGILLGPSAF  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGIS+
Sbjct  73   GRNKTYLNHIFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISV  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  133  PFFSGIGVAFVLRKTVDGADKVGYGQFIVFMGVALSITAFPVLA  176



>ref|XP_010911264.1| PREDICTED: cation/H(+) antiporter 20-like, partial [Elaeis guineensis]
Length=400

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTLV+++SR  AF+LKPLRQPKVIAEI+GG+ILGPSA 
Sbjct  11   SSNGIWQGDNPLHFAFPLLIVQTTLVLILSRSLAFILKPLRQPKVIAEIVGGIILGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ Y+  IFP WS PILE+V+SIGLLF+LFLVGLELDL S++R+G+  F IAAAGISL
Sbjct  71   GRNQSYLHRIFPSWSTPILETVASIGLLFFLFLVGLELDLRSIQRSGRRVFFIAAAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G+ F+ R  + GAD  G+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFVSGVGVAFVLRSSLPGADSAGYGPFLVFMGVALSITAFPVLA  174



>ref|XP_007162657.1| hypothetical protein PHAVU_001G169300g [Phaseolus vulgaris]
 gb|ESW34651.1| hypothetical protein PHAVU_001G169300g [Phaseolus vulgaris]
Length=845

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL++A PLLI+Q  LV++V+R  A LLKPLRQPKVIAEILGGV+LGPSA 
Sbjct  11   SSNGAWQGDNPLDYAFPLLILQIILVLIVTRSLALLLKPLRQPKVIAEILGGVLLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP WS P LESV+SIGLLF+LFLVGLELDL+S+RR+G+ AF IAA GISL
Sbjct  71   GRNKTYLHRMFPSWSTPTLESVASIGLLFFLFLVGLELDLNSIRRSGRRAFSIAAVGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIGI  + R+ V GADE GFA + VFMGVALSIT FPVLA
Sbjct  131  PFVSGIGIAVVLRKTVDGADEPGFAQFIVFMGVALSITAFPVLA  174



>ref|XP_004494000.1| PREDICTED: cation/H(+) antiporter 20-like [Cicer arietinum]
Length=789

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL++A PLLIVQ T+V+ VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLDYAFPLLIVQITVVLFVSRSLALLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS P LESV+SIGLLF+LFLVGLELDL+S+RR+GK AF IAA GISL
Sbjct  71   GRNKSYLHRIFPSWSTPTLESVASIGLLFFLFLVGLELDLNSIRRSGKRAFSIAACGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+  + R+ V GAD+VGFA + VFMGVALSIT FPVLA
Sbjct  131  PFVSGIGVAIVLRKTVDGADKVGFAQFLVFMGVALSITAFPVLA  174



>ref|XP_010037850.1| PREDICTED: cation/H(+) antiporter 20-like [Eucalyptus grandis]
 gb|KCW49631.1| hypothetical protein EUGRSUZ_K03153 [Eucalyptus grandis]
Length=832

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLN A PLL+VQT LV+ +SRF AFLLKPLRQPKVIAEILGG++LGPSA 
Sbjct  14   SSDGAWQGDNPLNHAFPLLVVQTILVLFLSRFLAFLLKPLRQPKVIAEILGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR   ++  IFP WS P+LESV+SIGLLFYLFLVGLELDL S+RR+GK AF IA AGISL
Sbjct  74   GRVDSFLNLIFPSWSIPVLESVASIGLLFYLFLVGLELDLGSIRRSGKKAFGIAFAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+G TF+ R++V G ++VG++ + +FMGVALSIT FPVLA
Sbjct  134  PFIFGMGATFILRKLVHGEEKVGYSQFLMFMGVALSITAFPVLA  177



>ref|XP_004168295.1| PREDICTED: cation/H(+) antiporter 20-like, partial [Cucumis sativus]
Length=557

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPL+FA PLLI+Q+ L++V++RF A LLKPLRQPKVIAEI+GG++LGPSAF
Sbjct  11   ASNGIWQGDNPLHFAFPLLILQSVLILVLTRFLALLLKPLRQPKVIAEIVGGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS  ILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGIS+
Sbjct  71   GRNKTYLNHIFPSWSTLILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIALAGISV  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG+ F+ R+ V GAD+VG+  + VFMGVALSIT FPVLA
Sbjct  131  PFFSGIGVAFVLRKTVDGADKVGYGQFIVFMGVALSITAFPVLA  174



>ref|XP_002308966.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa]
 gb|EEE92489.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa]
Length=841

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL+ A PLLIVQTTL++VVSR  AFLLKPLRQPKVIAEI GG++LGPSA 
Sbjct  12   SSNGAWQGDNPLDHAFPLLIVQTTLIVVVSRLLAFLLKPLRQPKVIAEIAGGILLGPSAI  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  IFP+WS PILESV+S+GLLF+LFLVGLELDLSS+RR+GK AF IA AGISL
Sbjct  72   GRNKEYLNWIFPKWSTPILESVASVGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGISL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+ + F+ R+ ++G D+VG+  + VF+GVALSIT FPVL+
Sbjct  132  PFVCGVAVAFVLRKAIEGEDQVGYTQFLVFIGVALSITAFPVLS  175



>ref|XP_009406978.1| PREDICTED: cation/H(+) antiporter 20-like [Musa acuminata subsp. 
malaccensis]
Length=829

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTT+V++VSR  +FLLKPLRQPKVIAEI+GGV+LGPSA 
Sbjct  11   SSNGVWQGDNPLHFAFPLLIVQTTIVLLVSRSLSFLLKPLRQPKVIAEIIGGVLLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP WS PILE+V+SIGLLF+LFLVGLELDL S+R +G+ AF IAAAGISL
Sbjct  71   GRNKTYLHNVFPAWSEPILETVASIGLLFFLFLVGLELDLHSIRSSGRRAFSIAAAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R VV GADE G+  + VFMGVALSIT FPVLA
Sbjct  131  PFACGVGVAFVIRHVVSGADEAGYGAFLVFMGVALSITAFPVLA  174



>ref|XP_004302732.2| PREDICTED: cation/H(+) antiporter 20 [Fragaria vesca subsp. vesca]
Length=783

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLN A PLLIVQTTLV+ +SRFFAFLLKP  QPKVIAEILGG++LGPSA 
Sbjct  14   SSDGAWQGDNPLNHAFPLLIVQTTLVLFISRFFAFLLKPFCQPKVIAEILGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR +++   IFP WS PILESV+SIGLLFYLFLVGLELDLSS+RR+GKSA  IA AGISL
Sbjct  74   GRIKDFSHIIFPSWSTPILESVASIGLLFYLFLVGLELDLSSIRRSGKSAITIALAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+  +G+TFL R+ + G ++VG+  + +FMGVALSIT FPVLA
Sbjct  134  PFLIAVGVTFLMRKAINGENKVGYPQFLMFMGVALSITAFPVLA  177



>ref|XP_003625495.1| K(+)/H(+) antiporter [Medicago truncatula]
 gb|ABD32190.1| Sodium/hydrogen exchanger [Medicago truncatula]
 gb|AES81713.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=851

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPL++A PLLI+QT LV+VVSR  AF  KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGIWQGDNPLDYAFPLLIIQTVLVLVVSRSLAFGFKPLRQPKVIAEIIGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+  +FPEWS P LESV+SIGLLF+LFLVGLELDL+S+RR+GK AF IAA GI+L
Sbjct  71   GRNTSYLHRLFPEWSMPTLESVASIGLLFFLFLVGLELDLNSIRRSGKRAFSIAACGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+  + R+ V GAD+ GF  + VFMGVALSIT FPVLA
Sbjct  131  PFVCGIGVAIVLRKTVDGADKAGFGQFIVFMGVALSITAFPVLA  174



>ref|XP_006480783.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis]
Length=806

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLNFA PLLI+QT LV++ S   AFL+KPLRQPKVIAEILGG++LGPSA 
Sbjct  12   SSDGAWQGDNPLNFAFPLLIIQTALVLLTSHCLAFLIKPLRQPKVIAEILGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  +FP WS PILESV+SIGLLF+LFLVGLELDLSS+R+NGK AF IA AGI+L
Sbjct  72   GRNKEYLHLMFPSWSTPILESVASIGLLFFLFLVGLELDLSSIRQNGKRAFKIALAGITL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G G++   ++ V G  +VG+  + +F+GV+LSIT FPVLA
Sbjct  132  PFLLGAGVSLFLQKAVDGESKVGYGQFIIFIGVSLSITAFPVLA  175



>ref|XP_006429042.1| hypothetical protein CICLE_v10011092mg [Citrus clementina]
 ref|XP_006480782.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis]
 gb|ESR42282.1| hypothetical protein CICLE_v10011092mg [Citrus clementina]
Length=811

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLNFA PLLI+QTTLV++ S   A L+KPLRQPKVIAEILGG++LGPSA 
Sbjct  12   SSDGVWQGDNPLNFAFPLLIIQTTLVLLTSHCLAVLIKPLRQPKVIAEILGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+EY+  +FP WS PILES++S+GLLF+LFLVGLELDLSS+R+NGKSAF IA AGI+L
Sbjct  72   GRNKEYLHLVFPSWSTPILESLASVGLLFFLFLVGLELDLSSIRQNGKSAFKIALAGITL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG G++   ++ V G ++VG+  + +FMGV+LSIT FPVLA
Sbjct  132  PFLFGAGVSLFLQKAVHGENKVGYGQFIIFMGVSLSITAFPVLA  175



>ref|XP_002527749.1| monovalent cation:proton antiporter, putative [Ricinus communis]
 gb|EEF34662.1| monovalent cation:proton antiporter, putative [Ricinus communis]
Length=798

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG NPLN+A PLLI+QT +V+ ++RF AFLLKPLRQP+V+AEI+GG++LGPSA 
Sbjct  13   SSDGVWQGDNPLNYAFPLLILQTIIVLFITRFLAFLLKPLRQPRVVAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ +   +FP WS PILESV+S GLLF+LFLVGLELDLSS+R+ G++AF IA AGISL
Sbjct  73   GRSEVFFHLVFPSWSTPILESVASFGLLFFLFLVGLELDLSSIRQTGRTAFGIALAGISL  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+F +G++FL R+ V G D+VG+  Y +FMG++LSIT FPVLA
Sbjct  133  PFLFAVGVSFLLRKAVHGMDKVGYGQYLMFMGISLSITAFPVLA  176



>ref|XP_009117167.1| PREDICTED: cation/H(+) antiporter 20-like [Brassica rapa]
Length=499

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLNFA PLLIVQT L++ VSR    L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGAWQGDNPLNFAFPLLIVQTALIVAVSRSLGLLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR GK AF IAAAGI+L
Sbjct  71   GRNTAYMHRIFPTWSMPILESVASIGLLFFLFLVGLELDLSSIRRTGKRAFGIAAAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VF+GVALSIT FPVLA
Sbjct  131  PFLAGVGVAFVIRNTLYTAADRTGYAEFLVFIGVALSITAFPVLA  175



>emb|CDY70299.1| BnaA07g37760D [Brassica napus]
Length=415

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQT L++ VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTALIVAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  YM  IFPEWS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IAAAGI+L
Sbjct  71   GRDPAYMDRIFPEWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAAAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G++F+ R  +   AD  GF  + VFMGVALSIT FPVLA
Sbjct  131  PFLAGVGVSFVIRNTLYTAADRPGFVEFIVFMGVALSITAFPVLA  175



>ref|XP_002439158.1| hypothetical protein SORBIDRAFT_09g001490 [Sorghum bicolor]
 gb|EES17588.1| hypothetical protein SORBIDRAFT_09g001490 [Sorghum bicolor]
Length=859

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++V+SRF AFLL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  16   SSNGVWQGDDPLHFAFPLLILQALLILVLSRFLAFLLRPLRQPKVIAEIVAGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+  +FP WS P+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  76   GRNAAYLHALFPPWSTPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  V GAD+ G+AP+ VFMGVALSIT FPV+A
Sbjct  136  PFACGVGVAFVLRSAVPGADQAGYAPFLVFMGVALSITAFPVMA  179



>ref|XP_008345449.1| PREDICTED: cation/H(+) antiporter 20-like [Malus domestica]
Length=771

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL+ A PLLIVQT L++ VSRF AFLLKPLRQPKVIAEILGG++LGPSA 
Sbjct  11   SSDGAWQGDNPLHHAFPLLIVQTLLILFVSRFLAFLLKPLRQPKVIAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP WS PILESV+SIGLLFYLFLVGLELDL S+RR+G+ A  IA AGISL
Sbjct  71   GRNKDFLEILFPSWSTPILESVASIGLLFYLFLVGLELDLISIRRSGRRAISIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF FG+G+ F  R+V+ G ++VG+    VF GVALSIT FPVLA
Sbjct  131  PFFFGVGLAFFTRKVIHGENKVGYPQLLVFTGVALSITAFPVLA  174



>ref|XP_008369866.1| PREDICTED: cation/H(+) antiporter 20 [Malus domestica]
Length=771

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL+ A PLLIVQT L++ VSRF AFLLKPLRQPKVIAEILGG++LGPSA 
Sbjct  11   SSDGAWQGDNPLHHAFPLLIVQTLLILFVSRFLAFLLKPLRQPKVIAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP WS PILESV+SIGLLFYLFLVGLELDL S+RR+G+ A  IA AGISL
Sbjct  71   GRNKDFLEILFPSWSTPILESVASIGLLFYLFLVGLELDLISIRRSGRRAISIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF FG+G+ F  R+V+ G ++VG+    VF GVALSIT FPVLA
Sbjct  131  PFFFGVGLAFFTRKVIHGENKVGYPQLLVFTGVALSITAFPVLA  174



>ref|XP_009338769.1| PREDICTED: cation/H(+) antiporter 20-like isoform X1 [Pyrus x 
bretschneideri]
Length=771

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL+ A PLLIVQT L++ VSRF AFLLKPLRQPKVIAEILGG++LGPSA 
Sbjct  11   SSDGAWQGDNPLHHAFPLLIVQTLLILFVSRFLAFLLKPLRQPKVIAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP WS PILESV+SIGLLFYLFLVGLELDL S+RR+G+ A  IA AGISL
Sbjct  71   GRNKDFLEILFPSWSTPILESVASIGLLFYLFLVGLELDLISIRRSGRRAISIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF FG+G+ F  R+V+ G ++VG+    VF GVALSIT FPVLA
Sbjct  131  PFFFGVGLAFFTRKVIHGENKVGYPQLLVFTGVALSITAFPVLA  174



>ref|NP_190940.1| cation/H(+) antiporter 20 [Arabidopsis thaliana]
 sp|Q9M353.1|CHX20_ARATH RecName: Full=Cation/H(+) antiporter 20; AltName: Full=Protein 
CATION/H+ EXCHANGER 20; Short=AtCHX20 [Arabidopsis thaliana]
 emb|CAB88334.1| putative protein [Arabidopsis thaliana]
 gb|AAO00889.1| putative protein [Arabidopsis thaliana]
 gb|AAR24648.1| At3g53720 [Arabidopsis thaliana]
 dbj|BAE99266.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79132.1| cation/H(+) antiporter 20 [Arabidopsis thaliana]
Length=842

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSRF A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRFLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNMAYMDRIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD+ G+A + VFMGVALSIT FPVLA
Sbjct  131  PFIAGVGVAFVIRNTLYTAADKPGYAEFLVFMGVALSITAFPVLA  175



>gb|AAX49548.1| cation/H+ exchanger [Arabidopsis thaliana]
Length=838

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSRF A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRFLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNMAYMDRIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD+ G+A + VFMGVALSIT FPVLA
Sbjct  131  PFIAGVGVAFVIRNTLYTAADKPGYAEFLVFMGVALSITAFPVLA  175



>gb|KDP35609.1| hypothetical protein JCGZ_09047 [Jatropha curcas]
Length=810

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPL+FA PLLIVQTTL++VVSRF AFLLKPLRQPKVIAE++GG+ILGPSA 
Sbjct  11   SSNGAWQGDNPLHFAFPLLIVQTTLILVVSRFCAFLLKPLRQPKVIAEMIGGIILGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR   Y   IFP WS PIL+SV+SIGLLF++FLVGLELDLSSLRR+ K AF IA AGISL
Sbjct  71   GRITNYKNLIFPNWSIPILDSVASIGLLFFIFLVGLELDLSSLRRSSKRAFGIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIGI F+ R+ V+G D+V + P+ +FMGV+LSIT FP+LA
Sbjct  131  PFVSGIGIAFILRKAVKGQDQVDYVPFFLFMGVSLSITAFPLLA  174



>emb|CDX78197.1| BnaA09g33920D [Brassica napus]
Length=826

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLNFA PLLIVQT L++ VSR    L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSDGAWQGDNPLNFAFPLLIVQTALIVAVSRSLGLLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IAAAGI+L
Sbjct  71   GRNTAYMHRIFPTWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAAAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VF+GVALSIT FPVLA
Sbjct  131  PFLAGVGVAFVIRNTLYTAADRTGYAEFLVFIGVALSITAFPVLA  175



>ref|XP_008795058.1| PREDICTED: cation/H(+) antiporter 20 [Phoenix dactylifera]
Length=837

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLIVQTTLV+++SR  A +LKPLRQPKVIAEI+GG+ILGPSA 
Sbjct  11   SSNGIWQGDNPLHFAFPLLIVQTTLVLILSRSLAVILKPLRQPKVIAEIIGGIILGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP WS PILE+V+SIGLLF+LFLVGLELDL S+R++G+ AF IAAAGI+L
Sbjct  71   GRNKTYLHRIFPSWSTPILETVASIGLLFFLFLVGLELDLRSIRQSGRRAFSIAAAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G+ F+ R  + GAD  G+ P+ VFMGV+LSIT FPVLA
Sbjct  131  PFVCGVGVAFVLRSSLPGADSAGYGPFLVFMGVSLSITAFPVLA  174



>ref|XP_009611526.1| PREDICTED: cation/H(+) antiporter 20 [Nicotiana tomentosiformis]
Length=784

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG+NPL++A PLLI+QTTLV+ +SR   FLLKPLRQPKV+AEIL G++LGPSAF
Sbjct  11   SSDGIWQGENPLHYAFPLLIIQTTLVVFLSRCLTFLLKPLRQPKVVAEILAGIMLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ + + IFP WS PILESV+SIGLLF+LFLVGLELDL ++R++GK A  IA AGISL
Sbjct  71   GRNEAFARWIFPIWSTPILESVASIGLLFFLFLVGLELDLKTIRKSGKRAAGIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFVFGIG+ FL R+V++G D VG+  + +F+GV+LSIT FPVLA
Sbjct  131  PFVFGIGVAFLLRKVIKGVDRVGYGEFFLFIGVSLSITAFPVLA  174



>emb|CDY07571.1| BnaC06g14930D [Brassica napus]
Length=833

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQT L++ VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTALIVAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  YM  IFPEWS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IAAAGI+L
Sbjct  71   GRDPAYMDRIFPEWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAAAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G++F+ R  +   AD  GF  + VFMGVALSIT FPVLA
Sbjct  131  PFLAGVGVSFVIRNTLYTAADRPGFVEFIVFMGVALSITAFPVLA  175



>ref|XP_003566598.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 20-like 
[Brachypodium distachyon]
Length=838

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G W G NPL+FA PLLI+Q  L++++SRF AFLL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  16   SSNGMWXGDNPLHFAFPLLIIQALLILLLSRFLAFLLRPLRQPKVIAEIVAGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++T+FP WSAP+LES +S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  76   GRNKAYLRTLFPPWSAPVLESAASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  135

Query  470  PFVFGIGITFLFRR-VVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R   V GAD+ G+AP+ VFMGVALSIT FPVLA
Sbjct  136  PFACGVGVAFVVRAGAVPGADQAGYAPFLVFMGVALSITAFPVLA  180



>ref|XP_009103880.1| PREDICTED: cation/H(+) antiporter 20-like [Brassica rapa]
Length=841

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQT L++ VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTALIVAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  YM  IFPEWS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IAAAGI+L
Sbjct  71   GRDPAYMDRIFPEWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAAAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G++F+ R  +   AD  GF  + VFMGVALSIT FPVLA
Sbjct  131  PFLAGVGVSFVIRNTLYTAADRPGFVEFIVFMGVALSITAFPVLA  175



>ref|XP_004960505.1| PREDICTED: cation/H(+) antiporter 20-like [Setaria italica]
Length=854

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL FA PLLI+Q  L++V+SR  AFLL+PL QPKVIAE++ G++LGPSA 
Sbjct  18   SSNGVWQGDDPLRFAFPLLILQALLILVLSRALAFLLRPLHQPKVIAEMVAGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  78   GRNGAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ RR + GAD+ G+AP+ VFMGVALSIT FPVLA
Sbjct  138  PFACGVGVAFVLRRAIPGADQAGYAPFLVFMGVALSITAFPVLA  181



>ref|XP_002877937.1| cation/H+ exchanger [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54196.1| cation/H+ exchanger [Arabidopsis lyrata subsp. lyrata]
Length=842

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFIAGVGVAFVIRNTLYTAADRPGYAEFLVFMGVALSITAFPVLA  175



>emb|CDY69365.1| BnaA04g27810D, partial [Brassica napus]
Length=405

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLI+QT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIIQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTTYMDRIFPTWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEV-GFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +  A E  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAVERPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_009399874.1| PREDICTED: cation/H(+) antiporter 20-like [Musa acuminata subsp. 
malaccensis]
Length=842

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG NPL+FA PLLIVQTTLV+++ R  AFLLKPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   ASNGVWQGDNPLHFAFPLLIVQTTLVLLLGRSLAFLLKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP WS PILE+V+SIGLLF+LFLVGLELDL S+ R+G+ AF IAAAGISL
Sbjct  71   GRNKTYLHKLFPSWSMPILETVASIGLLFFLFLVGLELDLRSILRSGRRAFAIAAAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  V GAD  G+ P+ VFMGVALSIT FPVLA
Sbjct  131  PFSCGVGVAFVLRSTVPGADVAGYGPFLVFMGVALSITAFPVLA  174



>gb|KFK34621.1| hypothetical protein AALP_AA5G169800 [Arabis alpina]
Length=835

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSR  A   KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVFFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM +IFP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTAYMDSIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G++F+ R  +   AD+ G+A + VFMGVALSIT FPVLA
Sbjct  131  PFIAGVGVSFVIRNTLYTAADKPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_009787989.1| PREDICTED: cation/H(+) antiporter 20 [Nicotiana sylvestris]
Length=787

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG+NPL++A PLLI+QTTLV+ +SR   FLLKPL+QPKV+AEIL G++LGPSAF
Sbjct  11   SSDGIWQGENPLHYAFPLLIIQTTLVVFLSRSLTFLLKPLQQPKVVAEILAGIMLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ + + IFP WS PILESV+SIGLLF+LFLVGLELDL ++R++GK A  IA AGISL
Sbjct  71   GRSEVFTRWIFPTWSTPILESVASIGLLFFLFLVGLELDLKTIRKSGKKAAGIAFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFVFGIG+ FL R+V++G D VG+  + +F+GV+LSIT FPVLA
Sbjct  131  PFVFGIGVAFLLRKVIKGVDRVGYGEFFIFIGVSLSITAFPVLA  174



>gb|KDP35607.1| hypothetical protein JCGZ_09045 [Jatropha curcas]
Length=788

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 128/164 (78%), Gaps = 11/164 (7%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPLN+A PLLIVQT +V+ V+R  A+LL+PLRQP+V+AEI+GG++LGPSAF
Sbjct  27   SSDGAWQGDNPLNYAFPLLIVQTIIVLFVTRSLAYLLRPLRQPRVVAEIIGGILLGPSAF  86

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR +E+ Q +FP WS PILESV+S+           ELDLS++R++GK AF IA AGISL
Sbjct  87   GRKKEFFQILFPSWSTPILESVASL-----------ELDLSTIRQSGKRAFGIAVAGISL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+F +G++F+ R+ +   + + + PY +FMGV+LSIT FPVLA
Sbjct  136  PFLFCVGVSFILRKAIHVEETISYGPYLLFMGVSLSITAFPVLA  179



>ref|XP_008648635.1| PREDICTED: cation/H(+) antiporter 20 [Zea mays]
 gb|AFW74934.1| hypothetical protein ZEAMMB73_282004 [Zea mays]
Length=856

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++V+SR  AFLL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  17   SSNGVWQGDDPLHFAFPLLILQALLILVLSRLLAFLLRPLRQPKVIAEIVAGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  77   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  V GAD+ G+AP+ VFMGVALSIT FPV+A
Sbjct  137  PFACGVGVAFVLRAAVPGADQAGYAPFLVFMGVALSITAFPVMA  180



>ref|XP_010678053.1| PREDICTED: cation/H(+) antiporter 20 [Beta vulgaris subsp. vulgaris]
Length=843

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG  QG N L+ A PLLI+QTTL++VV+R  AF  KPLRQPKVIAEI+GG++LGPS F
Sbjct  11   ASDGILQGDNALHTAFPLLIIQTTLILVVTRLLAFAFKPLRQPKVIAEIVGGILLGPSVF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++YM+ +FP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+G+ AF IA AGISL
Sbjct  71   GRNEQYMEKVFPHWSTPILESVASIGLLFFLFLVGLELDLSSIRRSGREAFLIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G  +  + RR ++GAD  G+ P+ VFMGV+LSIT FPVLA
Sbjct  131  PFVGGAAVAVVLRRTIEGADRAGYGPFLVFMGVSLSITAFPVLA  174



>emb|CDY30847.1| BnaC04g27020D [Brassica napus]
Length=830

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLI+QT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIIQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTTYMDRIFPTWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGA-DEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +  A D  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRSTLYTAVDRPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_010528361.1| PREDICTED: cation/H(+) antiporter 20-like [Tarenaya hassleriana]
Length=822

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 5/169 (3%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDGAW+G +PLN+A PLLIVQT +V+  SRF  FLL+PLRQPKV+AEILGG++LGPSA 
Sbjct  13   ASDGAWEGDSPLNYAFPLLIVQTAVVLFTSRFLDFLLRPLRQPKVVAEILGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+++ +FP WS PILESV+SIGLLF+LFLVGLELDL+ LRR+G+ AF IA AGISL
Sbjct  73   GRNKEFLKLVFPPWSTPILESVASIGLLFFLFLVGLELDLAVLRRSGRKAFTIAVAGISL  132

Query  470  PFVFGIGITFLFRRVV-----QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFVFG  I+ L RR          + VG+  + VFMGVALSIT FPVLA
Sbjct  133  PFVFGAAISLLLRRTAVNNPHHHHETVGYGQFLVFMGVALSITAFPVLA  181



>ref|XP_006403661.1| hypothetical protein EUTSA_v10010121mg [Eutrema salsugineum]
 gb|ESQ45114.1| hypothetical protein EUTSA_v10010121mg [Eutrema salsugineum]
Length=842

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSR  A   KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVFFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRIFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD+ G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLAGVGVAFVIRNTLYTAADKPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_009139379.1| PREDICTED: cation/H(+) antiporter 20 [Brassica rapa]
Length=842

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLI+QT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIIQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTTYMDRIFPTWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADEV-GFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +  A E  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAVERPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_003542459.1| PREDICTED: cation/H(+) antiporter 20-like [Glycine max]
Length=824

 Score =   174 bits (441),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 106/164 (65%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FA PLLI+Q TL+I++SR  AFLLKP+RQPKVIA+I+ G++LGPS  
Sbjct  11   SSNGLWQGDNPLDFAFPLLILQITLIILLSRSLAFLLKPIRQPKVIAQIIAGIVLGPSVL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +   +FP WS P+LES++SIGLLF+LFLVGLELDL ++RR+GK A  IA AG+SL
Sbjct  71   GRNKTFKHRLFPPWSTPLLESLASIGLLFFLFLVGLELDLVTIRRSGKRALSIAVAGMSL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG+  + R+ V G D VGFA + VFMGVA+SIT FPVLA
Sbjct  131  PFVSGIGLALILRKTVDGTDRVGFAQFLVFMGVAISITAFPVLA  174



>emb|CDP05548.1| unnamed protein product [Coffea canephora]
Length=836

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS GAWQG NPL FA PLLI+QTT+V+++SR   FL KPLRQPKV+AEILGG++LGPSA 
Sbjct  11   SSGGAWQGDNPLQFAFPLLIIQTTIVVLISRVLEFLFKPLRQPKVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +MQ IFP WS PILESV S+G+LF+LFLVGLELDLSS+RR+GK AF IAAAG+SL
Sbjct  71   GRNKYFMQWIFPAWSIPILESVGSLGILFFLFLVGLELDLSSIRRSGKRAFGIAAAGMSL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G G+TFL R+VV G +        VFMGV+LSIT FPVLA
Sbjct  131  PFLLGAGLTFLTRKVVNGDNHQKHGQLLVFMGVSLSITAFPVLA  174



>gb|ABN05706.1| Sodium/hydrogen exchanger [Medicago truncatula]
Length=401

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NP+N ALPLLI+QT LV+ VSR  AF LKPLRQP+V+AEI+GG++LGPS  
Sbjct  7    SSDGAWQGDNPMNHALPLLIIQTILVMFVSRTLAFFLKPLRQPRVVAEIIGGILLGPSGI  66

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +M T+FP WS PILESV+SIGLLFYLFLVGLELDL ++ R+GK AF IA AGISL
Sbjct  67   GRNKTFMHTVFPSWSTPILESVASIGLLFYLFLVGLELDLRTINRSGKRAFNIAVAGISL  126

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPY---SVFMGVALSITGFPVLA  601
            PF+F IG+TFL ++V+    E     Y    +F+GV+LSIT FPVLA
Sbjct  127  PFLFAIGVTFLLQKVIHFNSETHKVSYFQLFIFLGVSLSITAFPVLA  173



>ref|XP_010427030.1| PREDICTED: cation/H(+) antiporter 20-like [Camelina sativa]
Length=839

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  +FP+WS PILESV+SIGLLF+LFLVGLELDLSS++R+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRVFPKWSMPILESVASIGLLFFLFLVGLELDLSSIKRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAADRPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_010515872.1| PREDICTED: cation/H(+) antiporter 20-like [Camelina sativa]
Length=837

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  +FP+WS PILESV+SIGLLF+LFLVGLELDLSS++R+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRVFPKWSMPILESVASIGLLFFLFLVGLELDLSSIKRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAADRPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_010504142.1| PREDICTED: cation/H(+) antiporter 20 [Camelina sativa]
Length=837

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQT L+I VSR  A L KPLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTALIIAVSRSLAVLFKPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  +FP+WS PILESV+SIGLLF+LFLVGLELDLSS++R+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRVFPKWSMPILESVASIGLLFFLFLVGLELDLSSIKRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAADRPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_006341222.1| PREDICTED: cation/H(+) antiporter 20-like [Solanum tuberosum]
Length=796

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG+N L++A PLLI+QTTLV+ +SR  AFLLKPLRQPKV+AEIL G++LGPSAF
Sbjct  12   SSDGVWQGENTLHYAFPLLIIQTTLVVFLSRLLAFLLKPLRQPKVVAEILAGIMLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +   IFP WS PILE VS+IGLLF+LFLVGLELDL+++ ++GK A  IA AGISL
Sbjct  72   GRNKTFTNCIFPSWSTPILECVSNIGLLFFLFLVGLELDLNTIHKSGKKAIGIAFAGISL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+F IG+ F+ R++++G D VG+  + +F+GV+LSIT FPVLA
Sbjct  132  PFLFSIGVAFVLRKIIKGIDSVGYGEFFLFIGVSLSITAFPVLA  175



>ref|XP_007208355.1| hypothetical protein PRUPE_ppa001677mg [Prunus persica]
 gb|EMJ09554.1| hypothetical protein PRUPE_ppa001677mg [Prunus persica]
Length=781

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL+ A PLLIVQTTLV+ VSR  A LLKPLRQPKVIAEILGG++LGPSA 
Sbjct  11   SSDGAWQGDNPLHHAFPLLIVQTTLVLFVSRLLALLLKPLRQPKVIAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++Q IFP WS PILESV+SIGLLFYLFLVGLELDLSS+RR+G+ A  IA AGIS+
Sbjct  71   GRNKHFLQIIFPSWSTPILESVASIGLLFYLFLVGLELDLSSIRRSGRKAITIAIAGISV  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+G+TFL R+ + G ++VG+A   VF+GVALSIT FPVLA
Sbjct  131  PFLFGVGVTFLMRKAIHGENKVGYAQCLVFIGVALSITAFPVLA  174



>ref|XP_008241268.1| PREDICTED: cation/H(+) antiporter 20-like isoform X1 [Prunus 
mume]
Length=782

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NPL+ A PLLIVQTTLV+ VSR  A LLKPLRQPKVIAEILGG++LGPSA 
Sbjct  11   SSDGAWQGDNPLHHAFPLLIVQTTLVLFVSRLLALLLKPLRQPKVIAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++Q IFP WS PILESV+SIGLLFYLFLVGLELDLSS+RR+G+ A  IA  GISL
Sbjct  71   GRNKHFLQIIFPAWSTPILESVASIGLLFYLFLVGLELDLSSIRRSGRKAITIAIVGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG+G+TFL R+ + G ++VG+A   VF+GVALSIT FPVLA
Sbjct  131  PFLFGVGVTFLMRKAIHGENKVGYAQCLVFIGVALSITAFPVLA  174



>ref|XP_007027077.1| Monovalent cation:proton antiporter, putative [Theobroma cacao]
 gb|EOY07579.1| Monovalent cation:proton antiporter, putative [Theobroma cacao]
Length=825

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG+NPLN+A PLLI+QTT+V+  SRF A LLKPLRQPKV+AEI+GG++LGPSA 
Sbjct  50   SSDGVWQGENPLNYAFPLLILQTTIVLFTSRFLAVLLKPLRQPKVVAEIVGGILLGPSAL  109

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++  +FP WS PILES +SIGLLF+LFLVGLELDL+ +R++G+ AF IA AG+S+
Sbjct  110  GRNKDFLHLVFPAWSTPILESAASIGLLFFLFLVGLELDLTVIRQSGRKAFSIAIAGMSV  169

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FG  ++ L  + V G + V    Y +F+GVALSIT FPVLA
Sbjct  170  PFIFGAALSLLLHKAVNGEERVSIGQYILFLGVALSITAFPVLA  213



>ref|XP_006290596.1| hypothetical protein CARUB_v10016685mg [Capsella rubella]
 gb|EOA23494.1| hypothetical protein CARUB_v10016685mg [Capsella rubella]
Length=839

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPLNFA PLLIVQTTL+I VSR  A L KPLRQP VIAEI+GG++LGPSA 
Sbjct  11   SSNGVWQGDNPLNFAFPLLIVQTTLIIAVSRSLAVLFKPLRQPIVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  YM  +FP+WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTAYMDRVFPKWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G+ F+ R  +   AD  G+A + VFMGVALSIT FPVLA
Sbjct  131  PFLGGVGVAFVIRNTLYTAADRPGYAEFLVFMGVALSITAFPVLA  175



>ref|XP_010529842.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 20 [Tarenaya 
hassleriana]
Length=818

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GAWQG NPLNFA PLLIVQT L+I VSR  A L +PLRQPKVIAEI+GG++LGPSA 
Sbjct  11   SSNGAWQGDNPLNFAFPLLIVQTALIIAVSRSLALLFRPLRQPKVIAEIVGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+  IFP WS PILESV+SIGLLF+LFLVGLELDLSS+RR+GK AF IA AGI+L
Sbjct  71   GRNTAYIHRIFPSWSMPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFGIAVAGITL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ FL R+   +   + G+  + VFMGVALSIT FPVLA
Sbjct  131  PFAGGVGVAFLLRKTAYEDTGKPGYGEFLVFMGVALSITAFPVLA  175



>gb|AIG92839.1| CHX1 [Glycine max]
Length=376

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPLN ALPLLIVQT LV+ VSR  AFLLKP RQPKV+AEI+GG++LGPSA 
Sbjct  11   ASEGAWQGDNPLNHALPLLIVQTILVVFVSRTLAFLLKPFRQPKVVAEIIGGILLGPSAI  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++M  +FP WS  +LESV+S GLLFYLFLVGLELD  ++RR+GK AF IA AGI+L
Sbjct  71   GRNKKFMHIVFPAWSTTMLESVASFGLLFYLFLVGLELDFRTIRRSGKQAFNIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADE-VGFAPYSVFMGVALSITGFPVLA  601
            PF+  +G+TFL +R ++  +  +G+  + VF+GV+LSIT FPVLA
Sbjct  131  PFICAVGVTFLLQRAIRSENHNIGYVQHFVFLGVSLSITAFPVLA  175



>dbj|BAJ85710.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=738

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+QT L++++SR  A LL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  14   SSNGMWQGDDPLHFAFPLLILQTLLILLLSRVLALLLRPLRQPKVIAEIVAGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  74   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ RR + GAD+ G+AP+ VFMGVA+SIT FPVLA
Sbjct  134  PFACGVGVAFVIRRAIPGADQAGYAPFLVFMGVAMSITAFPVLA  177



>dbj|BAJ87099.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=852

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+QT L++++SR  A LL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  14   SSNGMWQGDDPLHFAFPLLILQTLLILLLSRVLALLLRPLRQPKVIAEIVAGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  74   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ RR + GAD+ G+AP+ VFMGVA+SIT FPVLA
Sbjct  134  PFACGVGVAFVIRRAIPGADQAGYAPFLVFMGVAMSITAFPVLA  177



>gb|KEH23991.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=710

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NP+N ALPLLI+QT LV+ VSR  AF LKPLRQP+V+AEI+GG++LGPS  
Sbjct  7    SSDGAWQGDNPMNHALPLLIIQTILVMFVSRTLAFFLKPLRQPRVVAEIIGGILLGPSGI  66

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +M T+FP WS PILESV+SIGLLFYLFLVGLELDL ++ R+GK AF IA AGISL
Sbjct  67   GRNKTFMHTVFPSWSTPILESVASIGLLFYLFLVGLELDLRTINRSGKRAFNIAVAGISL  126

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPY---SVFMGVALSITGFPVLA  601
            PF+F IG+TFL ++V+    E     Y    +F+GV+LSIT FPVLA
Sbjct  127  PFLFAIGVTFLLQKVIHFNSETHKVSYFQLFIFLGVSLSITAFPVLA  173



>ref|XP_004246412.1| PREDICTED: cation/H(+) antiporter 20 [Solanum lycopersicum]
Length=798

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDG WQG+N L++A PLLI+QTTLV+ +SR  AFLLKPL QPKV+AEIL G++LGPSAF
Sbjct  12   SSDGIWQGENTLHYAFPLLIIQTTLVVFLSRLLAFLLKPLHQPKVVAEILAGIMLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +   IFP WS PILE VS+IGLLF+LFLVGLELDL+++ ++GK A  IA AGISL
Sbjct  72   GRNKTFTNWIFPSWSTPILECVSNIGLLFFLFLVGLELDLNTIHKSGKKAIGIAFAGISL  131

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF F IG+ F+ R++++G D VG+  + +F+GV+LSIT FPVLA
Sbjct  132  PFFFSIGVAFVLRKIIKGIDSVGYGEFFLFIGVSLSITAFPVLA  175



>ref|XP_003625497.1| K(+)/H(+) antiporter [Medicago truncatula]
 gb|AES81715.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=812

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG NP+N ALPLLI+QT LV+ VSR  AF LKPLRQP+V+AEI+GG++LGPS  
Sbjct  7    SSDGAWQGDNPMNHALPLLIIQTILVMFVSRTLAFFLKPLRQPRVVAEIIGGILLGPSGI  66

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ +M T+FP WS PILESV+SIGLLFYLFLVGLELDL ++ R+GK AF IA AGISL
Sbjct  67   GRNKTFMHTVFPSWSTPILESVASIGLLFYLFLVGLELDLRTINRSGKRAFNIAVAGISL  126

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPY---SVFMGVALSITGFPVLA  601
            PF+F IG+TFL ++V+    E     Y    +F+GV+LSIT FPVLA
Sbjct  127  PFLFAIGVTFLLQKVIHFNSETHKVSYFQLFIFLGVSLSITAFPVLA  173



>ref|XP_008369867.1| PREDICTED: cation/H(+) antiporter 20-like [Malus domestica]
Length=406

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G WQG NPL+FA PLLIVQ TL+IVVSRF AFLLKPL QPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLWQGDNPLDFAFPLLIVQXTLIIVVSRFLAFLLKPLHQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSI-gllfylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN+ Y+  IFP WS PILE+V+SI  L F   +       S  RR+G+SAF IA AGIS
Sbjct  72   GRNKYYLHKIFPSWSTPILETVASIGLLFFLFLVGIELDLSSVRRRSGRSAFGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            LPF+ GIG+  + RR + G+D+ GF+ + VFMGV+LSIT FPVLA
Sbjct  132  LPFLCGIGVAVVLRRTIDGSDKAGFSQFVVFMGVSLSITAFPVLA  176



>ref|XP_008776558.1| PREDICTED: cation/H(+) antiporter 20-like [Phoenix dactylifera]
Length=812

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG+NPL +ALPLLI+QTTL++V+SR  AFL KPLRQPKV+AEI+GG++LGPSA 
Sbjct  7    SSDGAWQGENPLKYALPLLIIQTTLILVLSRALAFLFKPLRQPKVVAEIVGGIVLGPSAL  66

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR + Y++ IFP WS+PIL+++SS+GLLF+LFLVGLELDL S+RR+G+ AF IAA GI L
Sbjct  67   GRWKAYLRAIFPSWSSPILDTISSVGLLFFLFLVGLELDLHSIRRSGRRAFAIAAVGILL  126

Query  470  PFVFGIGITFLFRRVVQ--GADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+  IG+  L RR      ++++GF P+ VF+GVALSIT FPVLA
Sbjct  127  PFLSSIGVVLLLRRTTLFPSSNDIGFYPFLVFVGVALSITAFPVLA  172



>ref|XP_010412915.1| PREDICTED: cation/H(+) antiporter 20-like [Camelina sativa]
Length=733

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG W G NPLN A PLLI+Q T+V+  SRF   LLKPLRQPKV+AEILGG++LGPSA 
Sbjct  11   ASDGVWGGDNPLNCAFPLLIIQVTIVLFTSRFLTLLLKPLRQPKVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+++ +FPEWS PILESV+SIGLLF+LFLVGLELDL+ L R GK AF I+ AGISL
Sbjct  71   GRNKEFVKLVFPEWSTPILESVASIGLLFFLFLVGLELDLTVLGRTGKKAFAISFAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADE-VGFAPYSVFMGVALSITGFPVLA  601
            PFV G G++   RR V+   E  G+  + +F+GV+LSIT FPVLA
Sbjct  131  PFVLGAGVSLFLRRAVEEDHESTGYWQFLLFIGVSLSITAFPVLA  175



>gb|AIG92838.1| CHX1 [Glycine soja]
 gb|KHN09423.1| Cation/H(+) antiporter 20 [Glycine soja]
Length=811

 Score =   167 bits (423),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPLN ALPLLIVQT LV+ VSR  AFLLKP RQPKV+AEI+GG++LGPSA 
Sbjct  11   ASEGAWQGDNPLNHALPLLIVQTILVVFVSRTLAFLLKPFRQPKVVAEIIGGILLGPSAI  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++M  +FP WS  +LESV+S GLLFYLFLVGLELD  ++RR+GK AF IA AGI+L
Sbjct  71   GRNKKFMHIVFPAWSTTMLESVASFGLLFYLFLVGLELDFRTIRRSGKQAFNIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADE-VGFAPYSVFMGVALSITGFPVLA  601
            PF+  +G+TFL +R ++  +  +G+  + VF+GV+LSIT FPVLA
Sbjct  131  PFICAVGVTFLLQRAIRSENHNIGYVQHFVFLGVSLSITAFPVLA  175



>ref|XP_003520629.1| PREDICTED: cation/H(+) antiporter 20-like [Glycine max]
Length=811

 Score =   167 bits (423),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPLN ALPLLIVQT LV+ VSR  AFLLKP RQPKV+AEI+GG++LGPSA 
Sbjct  11   ASEGAWQGDNPLNHALPLLIVQTILVVFVSRTLAFLLKPFRQPKVVAEIIGGILLGPSAI  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++M  +FP WS  +LESV+S GLLFYLFLVGLELD  ++RR+GK AF IA AGI+L
Sbjct  71   GRNKKFMHIVFPAWSTTMLESVASFGLLFYLFLVGLELDFRTIRRSGKQAFNIAVAGITL  130

Query  470  PFVFGIGITFLFRRVVQGADE-VGFAPYSVFMGVALSITGFPVLA  601
            PF+  +G+TFL +R ++  +  +G+  + VF+GV+LSIT FPVLA
Sbjct  131  PFICAVGVTFLLQRAIRSENHNIGYVQHFVFLGVSLSITAFPVLA  175



>ref|XP_006654915.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 20-like 
[Oryza brachyantha]
Length=653

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++++SR  A +L+PLRQPKVIAEI+ G++LGPSA 
Sbjct  15   SSNGVWQGDDPLHFAFPLLILQALLILLLSRLLALMLRPLRQPKVIAEIVAGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  75   GRNKSYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRQAFAIAAAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ RR + GA + G+AP+ VFMGVALSIT FPVLA
Sbjct  135  PFACGVGVAFVLRRQLPGAAQAGYAPFLVFMGVALSITAFPVLA  178



>ref|XP_010907062.1| PREDICTED: cation/H(+) antiporter 20 [Elaeis guineensis]
Length=819

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SSDGAWQG+NPL +ALPLLI+QTTL++V+SR  AFL KPLRQPKV+AEI+ G++LGPSAF
Sbjct  13   SSDGAWQGENPLKYALPLLIIQTTLILVLSRTLAFLFKPLRQPKVVAEIVAGIVLGPSAF  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR + Y+Q IFP WS+PIL+++SS+GLLF+LFLVGLELDL S+ R+G+ AF IA AGI L
Sbjct  73   GRWKAYLQAIFPSWSSPILDTISSVGLLFFLFLVGLELDLHSICRSGRRAFAIATAGILL  132

Query  470  PFVFGIGITFLFRR--VVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+  +G+ FL RR  +   ++++ F P+ VF+GVALSIT FPVLA
Sbjct  133  PFLSSVGVVFLLRRTPLSSSSNDIDFYPFLVFIGVALSITAFPVLA  178



>ref|XP_009338768.1| PREDICTED: cation/H(+) antiporter 20-like [Pyrus x bretschneideri]
Length=834

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G WQG NPL+FA PLLI+QTTL+IVVSRF AFLLKPL QPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLWQGDNPLHFAFPLLIIQTTLIIVVSRFLAFLLKPLHQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgll-fylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN+ Y+  IFP WSAPILE+V+SIGLL F   +       S  RR+G+SAF IA AGIS
Sbjct  72   GRNKYYLHRIFPSWSAPILETVASIGLLFFLFLVGIELDLSSVRRRSGRSAFGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            LPF+ GIG+  + RR + G+D+ GF+ + VFMGV+LSIT FPVLA
Sbjct  132  LPFLCGIGVAVVLRRTIDGSDKAGFSQFVVFMGVSLSITAFPVLA  176



>ref|XP_008366721.1| PREDICTED: cation/H(+) antiporter 20-like [Malus domestica]
 ref|XP_008366722.1| PREDICTED: cation/H(+) antiporter 20-like [Malus domestica]
Length=845

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPLNFA PLLIVQTTL+IVVSRF AFLLKPLRQPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLLQGDNPLNFAFPLLIVQTTLIIVVSRFLAFLLKPLRQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgll-fylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN++Y+  IFP WS PILE+V+SIGLL F   +       S  RR+G+S+F IA AGIS
Sbjct  72   GRNKDYLHKIFPSWSTPILETVASIGLLFFLFLVGIELDLSSIRRRSGRSSFGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            +PF+ GIG+  + RR + GAD+VGF+ + VFMGV+LSIT FPVLA
Sbjct  132  VPFLCGIGVAVILRRTIDGADKVGFSQFVVFMGVSLSITAFPVLA  176



>ref|XP_008241256.1| PREDICTED: cation/H(+) antiporter 20 [Prunus mume]
Length=848

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPLNFA PLLIVQTTL+IVVSRF AFLLKPLRQPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLLQGDNPLNFAFPLLIVQTTLIIVVSRFLAFLLKPLRQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgll-fylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN++Y+  IFP WS PILE+V+SIGLL F   +       S  RR+G+SA  IA AGIS
Sbjct  72   GRNKQYLHKIFPSWSTPILETVASIGLLFFLFLVGIELDLSSIRRRSGRSAVGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            +PF+ GIG+ FL R+ + GAD+ GF  + VFMGV+LSIT FPVLA
Sbjct  132  VPFICGIGVAFLLRKTIDGADKAGFTQFLVFMGVSLSITAFPVLA  176



>ref|XP_006410943.1| hypothetical protein EUTSA_v10016301mg [Eutrema salsugineum]
 gb|ESQ52396.1| hypothetical protein EUTSA_v10016301mg [Eutrema salsugineum]
Length=745

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG W+G NPLN A PLLIVQ  +V+  SRF AFLLKPLRQP+V+AEILGG++LGPSA 
Sbjct  11   ASDGVWEGDNPLNCAFPLLIVQVAIVLFSSRFLAFLLKPLRQPQVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ + + +FP+WS PILESV+SIGLLF+LFLVGLELDL+ L R GK AF I+ AGI L
Sbjct  71   GRNKYFTELVFPKWSTPILESVASIGLLFFLFLVGLELDLAVLSRTGKKAFAISFAGICL  130

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G  I+   RR V +  D  G+  + +F+GVALSIT FPVLA
Sbjct  131  PFALGAAISLFLRRAVEEDHDSAGYWQFLLFIGVALSITAFPVLA  175



>ref|XP_007208406.1| hypothetical protein PRUPE_ppa001365mg [Prunus persica]
 gb|EMJ09605.1| hypothetical protein PRUPE_ppa001365mg [Prunus persica]
Length=844

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPLNFA PLLIVQTTL+IVVSRF AFLLKPLRQPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLLQGDNPLNFAFPLLIVQTTLIIVVSRFLAFLLKPLRQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgll-fylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN++Y+  IFP WS PILE+V+SIGLL F   +       S  RR+G+SA  IA AGIS
Sbjct  72   GRNKQYLHKIFPSWSTPILETVASIGLLFFLFLVGIELDLSSIRRRSGRSAVGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            +PF+ GIG+  L R+ + GAD+ GF  + VFMGV+LSIT FPVLA
Sbjct  132  VPFICGIGVALLLRKTIDGADKAGFTQFLVFMGVSLSITAFPVLA  176



>ref|XP_011022576.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
Length=804

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  20   TSNGVFQGDNPLDYALPLAIVQICLVVLLTRILAFLLRPLRQPRVIAEIVGGILLGPSAL  79

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S P+L++++++GLLF+LFLVGLELDL SLRR GK A CIAAAGISL
Sbjct  80   GRNKHYLDKVFPAKSLPVLDTLANLGLLFFLFLVGLELDLKSLRRTGKKALCIAAAGISL  139

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  + +G D+   AP+ VFMGVALSIT FPVLA
Sbjct  140  PFLLGIGTSFALRGTISKGVDK---APFLVFMGVALSITAFPVLA  181



>ref|XP_009374674.1| PREDICTED: cation/H(+) antiporter 20-like [Pyrus x bretschneideri]
Length=857

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPLNFA PLLIVQTTL+IVVSRF  FLLKPLRQPKVIAEI GG++LGPSAF
Sbjct  12   ASSGLLQGDNPLNFAFPLLIVQTTLIIVVSRFLFFLLKPLRQPKVIAEIAGGILLGPSAF  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgll-fylflvgleldlSSLRRNGKSAFCIAAAGIS  466
            GRN++Y+  IFP WS PILE+V+SIGLL F   +       S  RR+G+S+F IA AGIS
Sbjct  72   GRNKDYLHKIFPSWSTPILETVASIGLLFFLFLVGIELDLSSIRRRSGRSSFGIALAGIS  131

Query  467  LPFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            +PF+ GIG+  + RR + GAD+VGF+ + VFMGV+LSIT FPVLA
Sbjct  132  VPFLCGIGVAVILRRTIDGADKVGFSEFVVFMGVSLSITAFPVLA  176



>ref|XP_010512999.1| PREDICTED: cation/H(+) antiporter 20-like [Camelina sativa]
Length=741

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG W G NPLN A PLLI+Q T+V+  SRF   LLKPLRQPKV+AEILGG++LGPSA 
Sbjct  11   ASDGVWGGDNPLNCAFPLLIIQVTIVLFTSRFLTLLLKPLRQPKVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP WS PILESV+S+GLLF+LFLVGLELDL+ + R GK AF I+ AGISL
Sbjct  71   GRNKDFVKLVFPAWSTPILESVASVGLLFFLFLVGLELDLTVIGRTGKKAFAISLAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADE-VGFAPYSVFMGVALSITGFPVLA  601
            PFV G G++   RR V+   E  G+  + +F+GV+LSIT FPVLA
Sbjct  131  PFVLGAGVSLFLRRAVEEDHESTGYWQFLLFIGVSLSITAFPVLA  175



>gb|KJB19059.1| hypothetical protein B456_003G082900 [Gossypium raimondii]
Length=800

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  +V+ ++R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDNPLDFALPLAILQICIVVALTRILAFLLKPLRQPRVIAEIVGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ TIFP  S  +L++++++GLLF+LFLVGLELD+ S+RR GK A  IA AGISL
Sbjct  77   GRNKNYLNTIFPTKSLTVLDTIANLGLLFFLFLVGLELDMKSVRRTGKKALSIAVAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG ++  R  + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  137  PFILGIGTSYALRATISKGVDE---APFLVFMGVALSITAFPVLA  178



>gb|KHG13786.1| Cation/H(+) antiporter 18 -like protein [Gossypium arboreum]
Length=800

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  +V+ ++R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDNPLDFALPLAILQICIVVALTRILAFLLKPLRQPRVIAEIVGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ TIFP  S  +L++++++GLLF+LFLVGLELD+ S+RR GK A  IA AGISL
Sbjct  77   GRNKNYLNTIFPTKSLTVLDTIANLGLLFFLFLVGLELDMKSVRRTGKKALSIAVAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG ++  R  + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  137  PFILGIGTSYALRATISKGVDE---APFLVFMGVALSITAFPVLA  178



>ref|XP_010055811.1| PREDICTED: cation/H(+) antiporter 18 [Eucalyptus grandis]
 ref|XP_010055812.1| PREDICTED: cation/H(+) antiporter 18 [Eucalyptus grandis]
 gb|KCW72362.1| hypothetical protein EUGRSUZ_E00818 [Eucalyptus grandis]
Length=804

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV++V+RF AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGVFQGDNPLDFALPLAILQICLVVLVTRFLAFLLRPLRQPRVIAEIVGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+Q IFP  S  +L++++++GLLF+LFLVGLELD SSLRR GK A  IAAAGISL
Sbjct  79   GRNHHYLQRIFPARSLTVLDTLANLGLLFFLFLVGLELDPSSLRRTGKKALSIAAAGISL  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  +  V   P+ VFMGVALSIT FPVLA
Sbjct  139  PFAMGIGTSFVLRGTI--SKSVDGPPFLVFMGVALSITAFPVLA  180



>ref|XP_007028838.1| Cation/H+ exchanger 19 [Theobroma cacao]
 gb|EOY09340.1| Cation/H+ exchanger 19 [Theobroma cacao]
Length=796

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL+FALPLLIVQ  LV+ ++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQNENPLDFALPLLIVQIILVVTLTRVLAFMLRPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+M  IFP+ S  +L+++++IGLLF+LFLVGLELD+ ++RR GK A  IAAAGISL
Sbjct  79   GRNKEFMNKIFPKRSMTVLDTLANIGLLFFLFLVGLELDIRAIRRTGKKALGIAAAGISL  138

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ R  + +G  E+ F    VFMGVALSIT FPVLA
Sbjct  139  PFVLGIGTSFVLRSTINKGVGEIAFL---VFMGVALSITAFPVLA  180



>ref|XP_002304537.2| hypothetical protein POPTR_0003s13470g [Populus trichocarpa]
 gb|EEE79516.2| hypothetical protein POPTR_0003s13470g [Populus trichocarpa]
Length=803

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGVFQGDNPLDYALPLAILQICLVVLLTRILAFLLRPLRQPRVIAEIVGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S P+L++++++GLLF+LFL+GLELDL SLRR GK A  IAAAGI L
Sbjct  79   GRNKHYLDKVFPAKSLPVLDTLANLGLLFFLFLIGLELDLKSLRRTGKKALGIAAAGIGL  138

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  + +GAD+   AP+ VFMGVALSIT FPVLA
Sbjct  139  PFLLGIGTSFALRGTISKGADK---APFLVFMGVALSITAFPVLA  180



>ref|XP_007040407.1| Cation/H+ exchanger 18 [Theobroma cacao]
 gb|EOY24908.1| Cation/H+ exchanger 18 [Theobroma cacao]
Length=806

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV+ ++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGLFQGDNPLDYALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP  S  +L++++++GLLF+LFLVGLELD  SLRR GK A CIA AGIS+
Sbjct  78   GRNEKYLNAIFPSRSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKKALCIALAGISV  137

Query  470  PFVFGIGITF-LFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F L   + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  138  PFALGIGTSFALHATISKGVDE---APFLVFMGVALSITAFPVLA  179



>ref|XP_009802616.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=801

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPL IVQ  LV+V++R  A+LL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+ TIFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A CIA AGISL
Sbjct  77   GRNEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAVAGISL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVLGIGTSFALRATISKG--VNQGPFLVFMGVALSITAFPVLA  178



>ref|XP_009586862.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=802

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPL IVQ  LV+V++R  A+LL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+ TIFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A CIA AGISL
Sbjct  77   GRNEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAVAGISL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVLGIGTSFALRATISKG--VNQGPFLVFMGVALSITAFPVLA  178



>ref|XP_006355611.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=823

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPL+++LPL+IVQ  LV+V++R  A++L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  13   TSSGLLQGDNPLHYSLPLVIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ TIFP  S P+L++++++GLLF+LFLVG ELD  SLRR GK A CIA AGI+L
Sbjct  73   GRNKNYLNTIFPPNSLPVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALCIAFAGITL  132

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + QG ++   AP+ VFMGVALSIT FPVLA
Sbjct  133  PFVLGIGTSFALRSTIAQGVNQ---APFLVFMGVALSITAFPVLA  174



>emb|CDX74952.1| BnaA05g06980D [Brassica napus]
Length=666

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG W+G NPL  A PLLIVQ  LV+  SRF AFLL+PLRQPKV+AEILGG++LGPSA 
Sbjct  11   ASDGIWEGDNPLKCAFPLLIVQVILVLFSSRFLAFLLRPLRQPKVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+++  FP+WS PILESV+SIGLLF+LFLVGLELD +++ + GK AF I+ AGI L
Sbjct  71   GRNKEFLELFFPKWSTPILESVASIGLLFFLFLVGLELDFAAIGQTGKKAFAISLAGICL  130

Query  470  PFVFGIGITFLFRRVVQGAD-EVGFAPYSVFMGVALSITGFPVLA  601
            PF  G  I+   R  V+      G+  + +F+GVALSIT FPVLA
Sbjct  131  PFALGAAISLFLRTAVEEDHGSAGYWQFLLFIGVALSITAFPVLA  175



>ref|XP_006841535.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
 gb|ERN03210.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
Length=794

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  113  SDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAFG  292
            S+GAWQG NPL+FALPLL++Q  LV++V+R  AFLL+PLRQP+VIAEI+GG++LGPSA G
Sbjct  14   SNGAWQGDNPLDFALPLLMLQICLVLIVTRLLAFLLRPLRQPRVIAEIIGGILLGPSALG  73

Query  293  RNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISLP  472
             N++Y++ +FP  S  +L+SV+++GLLF+LFL+GLELD++S+RR G+ A  IA AGI+LP
Sbjct  74   HNKDYLRRVFPPRSMTLLDSVANMGLLFFLFLIGLELDVNSIRRTGRKALGIALAGITLP  133

Query  473  FVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            F+ G+G +F+ +  V  A  VG A + VFMGVALSIT FPVLA
Sbjct  134  FLLGVGTSFVLKSTV--AKGVGTASFLVFMGVALSITAFPVLA  174



>gb|EEE62090.1| hypothetical protein OsJ_16874 [Oryza sativa Japonica Group]
Length=821

 Score =   154 bits (389),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++++SR  A LL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  18   SSNGVWQGDDPLHFAFPLLILQALLILLLSRLLALLLRPLRQPKVIAEIVAGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  78   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  + GA   G+AP+ VFMGVALSIT FPVLA
Sbjct  138  PFACGVGVAFVLRGELPGAARAGYAPFLVFMGVALSITAFPVLA  181



>ref|XP_004233089.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=828

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPL+++LPL+IVQ  LV+V++R  A+LL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  13   TSSGLLQGDNPLHYSLPLVIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  IFP  S P+L++++++GLLF+LFLVG ELD  SLRR GK A CIA AGI+L
Sbjct  73   GRNKNYLNAIFPPSSLPVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALCIALAGITL  132

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + QG ++   AP+ VFMGVALSIT FPVLA
Sbjct  133  PFVLGIGTSFALRSTIAQGVNQ---APFLVFMGVALSITAFPVLA  174



>ref|XP_010932682.1| PREDICTED: cation/H(+) antiporter 19-like [Elaeis guineensis]
Length=694

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG +PL+ ALPL+I+Q  LV+VV+R  AFLL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  18   TSEGAWQGDDPLHHALPLIILQICLVVVVTRTLAFLLRPLRQPRVVAEIIGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++ ++FP+ S  +L++V+++GLLF+LFLVGLELDL ++RR GK A  IA AGISL
Sbjct  78   GRNKRFLDSVFPKQSLTVLDTVANLGLLFFLFLVGLELDLRAIRRTGKKALAIALAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ R  V      G  P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFVLRTTVVKGTRQG--PFQVFMGVALSITAFPVLA  179



>ref|NP_001054455.1| Os05g0113300 [Oryza sativa Japonica Group]
 dbj|BAF16369.1| Os05g0113300 [Oryza sativa Japonica Group]
 gb|EAY96285.1| hypothetical protein OsI_18183 [Oryza sativa Indica Group]
Length=844

 Score =   154 bits (388),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++++SR  A LL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  18   SSNGVWQGDDPLHFAFPLLILQALLILLLSRLLALLLRPLRQPKVIAEIVAGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  78   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  + GA   G+AP+ VFMGVALSIT FPVLA
Sbjct  138  PFACGVGVAFVLRGELPGAARAGYAPFLVFMGVALSITAFPVLA  181



>ref|XP_009334467.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334468.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334469.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334470.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334471.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
 ref|XP_009334472.1| PREDICTED: cation/H(+) antiporter 18 [Pyrus x bretschneideri]
Length=807

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y++ IFP  S  +L++++++GLLF+LFLVGLELD  SLRR GK A CIA AGI+L
Sbjct  78   GRNKDYLEAIFPNRSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKKALCIALAGITL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  +  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFALKGTISKGVDG---PPFLVFMGVALSITAFPVLA  179



>ref|XP_008385052.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008385695.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008386303.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
 ref|XP_008386957.1| PREDICTED: cation/H(+) antiporter 18 [Malus domestica]
Length=807

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y++ IFP  S  +L++++++GLLF+LFLVGLELD  SLRR GK A CIA AGI+L
Sbjct  78   GRNKDYLEAIFPNRSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKKALCIALAGITL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  +  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFALKGTISKGVDG---PPFLVFMGVALSITAFPVLA  179



>ref|XP_009383924.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=793

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+WQG NPL++ALPL IVQ  LVI V+RF AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSNGSWQGDNPLDYALPLAIVQICLVITVTRFLAFVLRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP+ S  +L+++++IGLLF+LFLVGLELD+ ++RR GK A  IA AGISL
Sbjct  64   GRSEAFLNTVFPKQSLTVLDTLANIGLLFFLFLVGLELDIRAIRRTGKRALGIAVAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG + + R  V      G  P+ VFMGVALSIT FPVLA
Sbjct  124  PFIMGIGTSVVLRHTVSKGVRAG--PFLVFMGVALSITAFPVLA  165



>ref|XP_009144111.1| PREDICTED: cation/H(+) antiporter 20-like [Brassica rapa]
Length=744

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG W+G NPL  A PLLIVQ  LV+  SRF AFLL+PLRQPKV+AEILGG++LGPSA 
Sbjct  11   ASDGIWEGDNPLKCAFPLLIVQVILVLFSSRFLAFLLRPLRQPKVVAEILGGILLGPSAL  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+++  FP+WS PILESV+SIGLLF LFLVGLELD +++ + GK AF I+ AGI L
Sbjct  71   GRNKEFLELFFPKWSTPILESVASIGLLFCLFLVGLELDFAAIGQTGKKAFAISLAGICL  130

Query  470  PFVFGIGITFLFRRVVQGAD-EVGFAPYSVFMGVALSITGFPVLA  601
            PF  G  I+   R  V+      G+  + +F+GVALSIT FPVLA
Sbjct  131  PFALGAAISLFLRTAVEEDHGSAGYWQFLLFIGVALSITAFPVLA  175



>ref|XP_001770267.1| predicted protein [Physcomitrella patens]
 gb|EDQ64942.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G WQG  P++FALPLLIVQ  LV+ ++R  AF+LKPL+QP+V+AEI+GG++LGPSAF
Sbjct  4    TSNGVWQGDVPVHFALPLLIVQIVLVLAITRALAFVLKPLKQPRVVAEIIGGILLGPSAF  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+ TIFP  S  ILE  + +GLLF+LF+VGLELD++ +R+ GK A  IAAAGI+L
Sbjct  64   GRNKDYLHTIFPHESVIILEVFADMGLLFFLFMVGLELDMTQIRKTGKQAMSIAAAGITL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G++F+    +  A E  F P+ VFMGVA+SIT FPVLA
Sbjct  124  PFVAGVGVSFVLHLTI--APEGAFGPFLVFMGVAMSITAFPVLA  165



>gb|AAS75243.2| putative Na+/H+ antiporter [Oryza sativa Japonica Group]
Length=679

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG +PL+FA PLLI+Q  L++++SR  A LL+PLRQPKVIAEI+ G++LGPSA 
Sbjct  18   SSNGVWQGDDPLHFAFPLLILQALLILLLSRLLALLLRPLRQPKVIAEIVAGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP WSAP+LESV+S+GLLF+LFLVGLELDL S+RR+G+ AF IAAAGISL
Sbjct  78   GRNKAYLRALFPPWSAPVLESVASLGLLFFLFLVGLELDLRSVRRSGRRAFAIAAAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G+ F+ R  + GA   G+AP+ VFMGVALSIT FPVLA
Sbjct  138  PFACGVGVAFVLRGELPGAARAGYAPFLVFMGVALSITAFPVLA  181



>ref|XP_006841531.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
 gb|ERN03206.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
Length=797

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +2

Query  113  SDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAFG  292
            S+GA+Q +NPL++ALPL +VQ  LV+ V+R  AFLLKPLRQP+VIAEI+GG++LGPSA G
Sbjct  17   SNGAFQDENPLDYALPLAMVQICLVLTVTRSLAFLLKPLRQPRVIAEIIGGILLGPSAVG  76

Query  293  RNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISLP  472
            RN+ Y+  IFP  S  +L+++++IGLLF+LFLVGLELDL S+RR G+ A  IA AGI+LP
Sbjct  77   RNKAYLHRIFPPRSMTVLDTIANIGLLFFLFLVGLELDLKSVRRTGRKALGIALAGITLP  136

Query  473  FVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            FV G+G +F+ +  +  A  VG AP+ VFMGVALSIT FPVLA
Sbjct  137  FVLGVGTSFVLKSTI--AKGVGTAPFLVFMGVALSITAFPVLA  177



>ref|XP_003538685.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006590501.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006590502.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=805

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG NPL+FALPL I+Q  LV+VVSR  A+LLKPLRQP+VIAEI+GG+ILGPS  
Sbjct  18   TSNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSVL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ YMQ +FP  S P+L+++++IGL+F+LFL GLELDL SLR++G     IA AGISL
Sbjct  78   GRNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ ++ + +G+D   F    VFMGVALSIT FPVLA
Sbjct  138  PFVIGIGTSFVLKQTIAKGSDNAAFL---VFMGVALSITAFPVLA  179



>ref|XP_008451984.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis melo]
Length=796

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG NPLN+ALPL I+Q  LV++++R  +FLL+P+RQP+VIAEI+GG++LGPSA 
Sbjct  23   TSDGIFQGDNPLNYALPLAILQICLVVLLTRVLSFLLRPIRQPRVIAEIVGGILLGPSAL  82

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+ T+FP  S  +L++++++GLLF+LFLVGLELDL SLRR GK A CIA AGI+L
Sbjct  83   GRNLSYLHTVFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLRRTGKRAMCIAFAGITL  142

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ R  + +G +E   A   VFMGVALSIT FPVLA
Sbjct  143  PFVLGIGTSFVLRSTISKGVNE---AALLVFMGVALSITAFPVLA  184



>ref|XP_007210366.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
 gb|EMJ11565.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
Length=808

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G ++ Y+ TIFP+ S  +L++++++GLLF+LFLVGLELD  S+RR GK A CIAAAGI+L
Sbjct  78   GHSKNYLDTIFPKRSLTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALCIAAAGITL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFALRATISKGVDG---PPFLVFMGVALSITAFPVLA  179



>gb|KHG06329.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=802

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  AFLL+PLRQP+VIAEI+GG++LGPS  
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGILLGPSVL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP  S  +L++++++GLLF+LFLVGLELD  S+RR GK A  IA AGISL
Sbjct  78   GRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSIAVAGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG ++  R  + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  138  PFMLGIGTSYALRATISKGVDE---APFLVFMGVALSITAFPVLA  179



>gb|KHG06330.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=818

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  AFLL+PLRQP+VIAEI+GG++LGPS  
Sbjct  34   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGILLGPSVL  93

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP  S  +L++++++GLLF+LFLVGLELD  S+RR GK A  IA AGISL
Sbjct  94   GRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSIAVAGISL  153

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG ++  R  + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  154  PFMLGIGTSYALRATISKGVDE---APFLVFMGVALSITAFPVLA  195



>ref|XP_008238994.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
 ref|XP_008238995.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
Length=808

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G ++ Y+ TIFP+ S  +L++++++GLLF+LFLVGLELD  S+RR GK A CIAAAGI+L
Sbjct  78   GHSKNYLDTIFPKRSLTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALCIAAAGITL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFALRATISKGVDG---PPFLVFMGVALSITAFPVLA  179



>gb|KJB19061.1| hypothetical protein B456_003G083100 [Gossypium raimondii]
Length=802

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+ ++R  AFLL+PLRQP+VIAEI+GG++LGPS  
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGILLGPSVL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP  S  +L++++++GLLF+LFLVGLELD  S+RR GK A  IA AGISL
Sbjct  78   GRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSIAVAGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG ++  R  + +G DE   AP+ VFMGVALSIT FPVLA
Sbjct  138  PFMIGIGTSYALRATISKGVDE---APFLVFMGVALSITAFPVLA  179



>ref|XP_006388233.1| hypothetical protein POPTR_0271s00200g [Populus trichocarpa]
 gb|ERP47147.1| hypothetical protein POPTR_0271s00200g [Populus trichocarpa]
Length=437

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  79   GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  139  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  180



>ref|XP_006343906.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=802

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPL IVQ  LV+V++R  A+LL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++Y+ TIFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A CIA AGIS+
Sbjct  77   GRSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAIAGISV  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + QG ++    P+ VFMGVALSIT FPVLA
Sbjct  137  PFVLGIGTSFALRATISQGVNQ---GPFLVFMGVALSITAFPVLA  178



>ref|XP_010676379.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676380.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
Length=800

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G +QG+NPL+FALPL+IVQ  LVIV++R  AFLL+PLRQP+VIAEI+GGV+LGPSAF
Sbjct  15   TSTGVFQGENPLDFALPLVIVQIILVIVLTRTLAFLLRPLRQPRVIAEIIGGVLLGPSAF  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ TIFP  S P+L++++++GL+F+LFLVGLELD  +LRR GK A  IA AGISL
Sbjct  75   GRSEAFLHTIFPAKSLPVLDTLANLGLIFFLFLVGLELDPKALRRTGKKALSIALAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +     V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFAMGIGTSFVLRATISKG--VNQAPFIVFMGVALSITAFPVLA  176



>ref|XP_008776559.1| PREDICTED: cation/H(+) antiporter 19-like [Phoenix dactylifera]
Length=806

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDGAWQG +PL+ ALPL+I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSDGAWQGDSPLHHALPLIILQICLVVVVTRSLAFLLRPLRQPRVIAEIIGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ ++FP+ S  +L++V++IGLLF+LFLVGLELDL ++RR GK A  IA AGISL
Sbjct  78   GRSKRFLNSVFPKESLTVLDTVANIGLLFFLFLVGLELDLRAIRRTGKKALAIALAGISL  137

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  VV+G  +    P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSVVLRSTVVKGTRQ---GPFLVFMGVALSITAFPVLA  179



>ref|XP_004245551.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325373.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325374.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=802

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPL IVQ  LV+V++R  A++L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  17   TSNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++Y+ TIFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A CIA AGIS+
Sbjct  77   GRSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAIAGISV  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  + QG ++    P+ VFMGVALSIT FPVLA
Sbjct  137  PFVLGIGTSFALRATISQGVNQ---GPFLVFMGVALSITAFPVLA  178



>gb|KHN35057.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=791

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG NPL+FALPL I+Q  LV+VVSR  A+LLKP RQP+VIAEI+GG+ILGPS  
Sbjct  4    TSNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPFRQPRVIAEIIGGIILGPSVL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ YMQ +FP  S P+L+++++IGL+F+LFL GLELDL SLR++G     IA AGISL
Sbjct  64   GRNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISL  123

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ ++ + +G+D   F    VFMGVALSIT FPVLA
Sbjct  124  PFVIGIGTSFVLKQTIAKGSDNAAFL---VFMGVALSITAFPVLA  165



>ref|XP_006478542.1| PREDICTED: cation/H(+) antiporter 19-like [Citrus sinensis]
Length=813

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL++ALPL+I+Q  LV+  +RF AFLLKPLRQP+VIAEI+GGV+LGPSA 
Sbjct  19   TSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGVLLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP+ S  +LE++++IGLLF+LFLVGLELD+ S+ R GK +  IA AGI+L
Sbjct  79   GRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGIALAGITL  138

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  V++GA++   AP  VFMGV+LSIT FPVLA
Sbjct  139  PFALGIGTSFVLRSTVLKGANQ---APLLVFMGVSLSITAFPVLA  180



>ref|XP_009765985.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=803

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A+LL+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   TSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVIAEIVGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+Q IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  76   GRNEKYLQAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALSIALAGISV  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  + QG ++    P+ +FMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRATISQGVNQ---GPFLIFMGVALSITAFPVLA  177



>gb|KDO46881.1| hypothetical protein CISIN_1g003517mg [Citrus sinensis]
Length=813

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL++ALPL+I+Q  LV+  +RF AFLLKPLRQP+VIAEI+GGV+LGPSA 
Sbjct  19   TSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGVLLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP+ S  +LE++++IGLLF+LFLVGLELD+ S+ R GK +  IA AGI+L
Sbjct  79   GRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGIALAGITL  138

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  V++GA++   AP  VFMGV+LSIT FPVLA
Sbjct  139  PFALGIGTSFVLRSTVLKGANQ---APLLVFMGVSLSITAFPVLA  180



>ref|XP_002276346.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658644.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
Length=786

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPLLIVQ  LV+VV+R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+ +IFP  S  +L++++++GLLF+LFLVGLELDL+SLRR GK A  IA AGISL
Sbjct  74   GRNKQYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSVVLRATISKGVDAG--PFLVFMGVALSITAFPVLA  175



>emb|CBI34426.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPL IVQ  LV+VV+R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLLKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ +IFP  S  +L++++++GLLF+LF+VGLELDL SL R GK A  IA AGISL
Sbjct  74   GRNKHYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F+ R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSFVLRATISKGVDAG--PFVVFMGVALSITAFPVLA  175



>ref|XP_006441942.1| hypothetical protein CICLE_v10018885mg [Citrus clementina]
 gb|ESR55182.1| hypothetical protein CICLE_v10018885mg [Citrus clementina]
Length=813

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL++ALPL+I+Q  LV+  +RF AFLLKPLRQP+VIAEI+GGV+LGPSA 
Sbjct  19   TSNGSFQGENPLDYALPLIILQICLVVAFTRFLAFLLKPLRQPRVIAEIIGGVLLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP+ S  +LE++++IGLLF+LFLVGLELD+ S+ R GK +  IA AGI+L
Sbjct  79   GRSERFLNTVFPKKSMTVLETLANIGLLFFLFLVGLELDIKSILRTGKKSLGIALAGITL  138

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  V++GA++   AP  VFMGV+LSIT FPVLA
Sbjct  139  PFALGIGTSFVLRSTVLKGANQ---APLLVFMGVSLSITAFPVLA  180



>gb|EPS57674.1| hypothetical protein M569_17143, partial [Genlisea aurea]
Length=213

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G W G NPL++A PLLI+QT L+I++SR  AFL KPLRQP+V+AEILGG++LGPSA 
Sbjct  9    SSNGIWLGDNPLDYAFPLLIIQTILIILLSRTLAFLFKPLRQPRVVAEILGGILLGPSAL  68

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR + +   +FP+WS PILESV+++GL+F+LFL+G+ELDL S+RRNG+ A  I  +GI  
Sbjct  69   GRWEGFSNGVFPKWSTPILESVANMGLIFFLFLIGMELDLGSIRRNGRRAAAIGISGIGA  128

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
             F  G  +   FRR +       +  Y++FMGVA+SIT FPVLA
Sbjct  129  TFGIGAAVALAFRRTIDAGSRASYVTYAIFMGVAMSITAFPVLA  172



>ref|XP_011007076.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=683

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  79   GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  139  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  180



>ref|XP_006343907.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=790

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A++L+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  4    TSNGVFQGDNPLDYALPLAIVQICLVLVLTRLLAYILRPLRQPRVIAEIVGGVLLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  64   GRNQKYLHAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALSIALAGISV  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  V     V   P+ +FMGVALSIT FPVLA
Sbjct  124  PFALGIGTSFVLRETVSKG--VNQGPFLIFMGVALSITAFPVLA  165



>ref|XP_006846040.1| hypothetical protein AMTR_s00012p00029570 [Amborella trichopoda]
 gb|ERN07715.1| hypothetical protein AMTR_s00012p00029570 [Amborella trichopoda]
Length=862

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL+FALPLLIVQTTLV++VSR  AFL+KPLRQP V+AEI GG++LGPSA 
Sbjct  87   SSNGVWQGDNPLDFALPLLIVQTTLVLLVSRSLAFLIKPLRQPSVVAEIAGGILLGPSAL  146

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP WS P LE+V+ IGL+F+LFLVGLELDLSS+ + G   F IAAAGISL
Sbjct  147  GRNKVYLNRVFPIWSTPTLETVAGIGLIFFLFLVGLELDLSSVHKGGCRVFTIAAAGISL  206

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G  I   FR V+      G+  + VFMGV+LS+T FPVLA
Sbjct  207  PFACGALIALPFRTVLNPHTSAGYTAFLVFMGVSLSVTAFPVLA  250



>gb|KHN25663.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=806

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG +PL+FALPL I+Q  LV+VVSR  A+LLKPLRQP+VIAEI+GG+ILGPSA 
Sbjct  18   TSNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ YMQ +FP  S  +L+++++IGL+F+LFL GLELDL SLR++G     IA AGISL
Sbjct  78   GRNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ ++ + +GAD   F    VFMGVALSIT FPVLA
Sbjct  138  PFVIGIGSSFVLKQTIAKGADSAAFL---VFMGVALSITAFPVLA  179



>ref|XP_006573800.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006573801.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006573802.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=806

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG +PL+FALPL I+Q  LV+VVSR  A+LLKPLRQP+VIAEI+GG+ILGPSA 
Sbjct  18   TSNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ YMQ +FP  S  +L+++++IGL+F+LFL GLELDL SLR++G     IA AGISL
Sbjct  78   GRNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ ++ + +GAD   F    VFMGVALSIT FPVLA
Sbjct  138  PFVIGIGSSFVLKQTIAKGADSAAFL---VFMGVALSITAFPVLA  179



>ref|XP_004245552.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Solanum 
lycopersicum]
Length=802

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A++L+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   ASNGVFQGDNPLDYALPLAIVQICLVLVLTRLLAYILRPLRQPRVIAEIVGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  76   GRNQKYLHAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALSIALAGISV  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  V QG ++    P+ +FMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRATVSQGVNQ---GPFLIFMGVALSITAFPVLA  177



>ref|XP_009608562.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=801

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPL++ALPL IVQ  LV+V++R  A++L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  13   TSSGVLQGDNPLHYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  IFP+ S  +L++++++GLLF+LFLVG ELD  SLRR GK A  IA AGI+L
Sbjct  73   GRNQKYLNAIFPKSSLTVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALSIALAGITL  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +  A+ V   P+ VFMGVALSIT FPVLA
Sbjct  133  PFVLGIGTSFALRATI--AEGVNQGPFLVFMGVALSITAFPVLA  174



>ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
 gb|EEF51282.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
Length=805

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG NPL++ALPL IVQ  LV+V++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSDGVFQGDNPLDYALPLAIVQIVLVVVLTRVLAFLLRPLRQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +Y+  IFP  S  +L++++++GLLF+LFLVGLELDL SLRR GK A  IA AGISL
Sbjct  77   GRNTDYLHRIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLRRTGKKALSIALAGISL  136

Query  470  PFVFGIGITFLFRRVVQ-GADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG++F+ R  +  G  E   AP  VFMGVALSIT FPVLA
Sbjct  137  PFVMGIGVSFVLRNTISPGVKE---APLLVFMGVALSITAFPVLA  178



>ref|XP_007131515.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
 gb|ESW03509.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
Length=814

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV++ +RF AFLLKPLRQP+VIAE++GG++LGPSA 
Sbjct  15   TSNGAFQHENPLDYALPLLILQICLVVIFTRFLAFLLKPLRQPRVIAEVIGGILLGPSAI  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++ TIFP+ S  +LE+V+++GLLF+LFLVGLELD+ S+R+ G  A  IA AGISL
Sbjct  75   GRNEKFLNTIFPKKSLTVLETVANLGLLFFLFLVGLELDMRSIRKTGHKALAIALAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV  IG ++  R  +  +  V   P+ +FMGVALSIT FPVLA
Sbjct  135  PFVLAIGTSYALRATI--SKNVDPTPFLIFMGVALSITAFPVLA  176



>emb|CBI34425.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPLLIVQ  LV+VV+R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+ +IFP  S  +L++++++GLLF+LFLVGLELDL+SLRR GK A  IA AGISL
Sbjct  74   GRNKQYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSVVLRATISKGVDAG--PFLVFMGVALSITAFPVLA  175



>ref|XP_002314344.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
 gb|EEF00515.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
Length=800

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  64   GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  124  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  165



>ref|XP_010999352.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=815

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  79   GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  139  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  180



>emb|CAN81239.1| hypothetical protein VITISV_031074 [Vitis vinifera]
Length=786

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPLLIVQ  LV+VV+R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPIHFALPLLIVQICLVLVVTRCLAFLLKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ +IFP  S  +L++++++GLLF+LFLVGLELDL+SLRR GK A  IA AGISL
Sbjct  74   GRNKXYLHSIFPPKSLTVLDTLANLGLLFFLFLVGLELDLNSLRRTGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSVVLRATISKGVDAG--PFLVFMGVALSITAFPVLA  175



>ref|XP_011012790.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=834

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  43   TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSAL  102

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  103  GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  162

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  163  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  204



>ref|XP_008800286.1| PREDICTED: cation/H(+) antiporter 19-like [Phoenix dactylifera]
Length=816

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+WQG+NPL  +LPL IVQ  LVIVV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGSWQGENPLEASLPLAIVQICLVIVVTRSLAFLLRPLRQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++++++T FP+ S  +L+++++IGLL++LFLVGLELDL ++RR GK A  IA AGISL
Sbjct  77   GRSEKFLETFFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGKRALIIAIAGISL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  +  A  V  AP+ VFMGVALSIT FPVLA
Sbjct  137  PFIMGIGTSFALRTTI--AKGVAEAPFLVFMGVALSITAFPVLA  178



>ref|XP_009766374.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
 ref|XP_009766375.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=802

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A+LL+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   TSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVIAEIVGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  76   GRNEKYLHAIFPSRSLTVLDTLANFGLLFFLFLVGLELDPRSLRRTGKKALSIALAGISV  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  A  V   P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRGTI--AKGVSQGPFLVFMGVALSITAFPVLA  177



>ref|XP_009782586.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=801

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G  QG NPL++ALPL IVQ  LV+V++R  A++L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  13   TSSGVLQGDNPLHYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGPSAL  72

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+  IFP+ S  +L++++++GLLF+LFLVG ELD  SLRR GK A  IA AGI+L
Sbjct  73   GRNEKYLNAIFPKSSLTVLDTLANLGLLFFLFLVGTELDPRSLRRTGKKALSIALAGITL  132

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +  A+ V   P+ VFMGVALSIT FPVLA
Sbjct  133  PFVLGIGTSFALRATI--AEGVNQGPFLVFMGVALSITAFPVLA  174



>ref|XP_010261447.1| PREDICTED: cation/H(+) antiporter 18 isoform X2 [Nelumbo nucifera]
Length=795

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG NPL+FALPL+I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQGDNPLDFALPLVILQICLVLVVTRTLAFLLRPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S  +L++++++GLLF+LFLVG+ELD  SLRR GK A  IA AGIS+
Sbjct  79   GRNKSYLNAVFPAKSLTVLDTLANLGLLFFLFLVGVELDPKSLRRTGKKALGIAVAGISV  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+ R  +  +  V   P+ VFMGVA SIT FPVLA
Sbjct  139  PFVLGVGSSFILRHTI--SKSVNGPPFLVFMGVAFSITAFPVLA  180



>ref|XP_010261446.1| PREDICTED: cation/H(+) antiporter 18 isoform X1 [Nelumbo nucifera]
Length=810

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG NPL+FALPL+I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  34   TSNGAFQGDNPLDFALPLVILQICLVLVVTRTLAFLLRPLRQPRVIAEIIGGILLGPSAL  93

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S  +L++++++GLLF+LFLVG+ELD  SLRR GK A  IA AGIS+
Sbjct  94   GRNKSYLNAVFPAKSLTVLDTLANLGLLFFLFLVGVELDPKSLRRTGKKALGIAVAGISV  153

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+ R  +  +  V   P+ VFMGVA SIT FPVLA
Sbjct  154  PFVLGVGSSFILRHTI--SKSVNGPPFLVFMGVAFSITAFPVLA  195



>ref|XP_002276249.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
 ref|XP_010658648.1| PREDICTED: cation/H(+) antiporter 18 [Vitis vinifera]
Length=787

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPL IVQ  LV+VV+R  AFLLKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLLKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ +IFP  S  +L++++++GLLF+LF+VGLELDL SL R GK A  IA AGISL
Sbjct  74   GRNKHYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F+ R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSFVLRATISKGVDAG--PFVVFMGVALSITAFPVLA  175



>gb|KDP25351.1| hypothetical protein JCGZ_20507 [Jatropha curcas]
Length=806

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 128/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG NPL++ALPL I+Q  LVIV++R  A LLKP+RQP+VIAEI+GG++LGPSA 
Sbjct  16   TSDGIFQGDNPLDYALPLAIIQIVLVIVLTRLIAVLLKPMRQPRVIAEIVGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+  IFP  S  +L++++++GLLF+LFLVGLELDL SL R GK AF IA AGI+L
Sbjct  76   GRNTNYLHRIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLGRTGKKAFSIALAGITL  135

Query  470  PFVFGIGITFLFRRVVQ-GADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG++F+ R  +  G  E   AP  VFMGVALSIT FPVLA
Sbjct  136  PFVLGIGVSFVLRATISPGVKE---APLLVFMGVALSITAFPVLA  177



>ref|XP_009586863.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009586864.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=803

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A+LL+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   TSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVIAEIVGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++Y+Q IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  76   GRNEKYLQAIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALSIALAGISV  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG + + R  + QG ++    P+ +FMGVALSIT FPVLA
Sbjct  136  PFALGIGTSIVLRATISQGVNQ---GPFLIFMGVALSITAFPVLA  177



>ref|XP_010541366.1| PREDICTED: cation/H(+) antiporter 17-like [Tarenaya hassleriana]
Length=820

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL++ALPLLI+Q  +V+V++R  AF L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   ASNGVFQGENPLDYALPLLILQICIVVVLTRTLAFFLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GLLF+LFLVGLELD  SLRR GK+A  IA AGI+L
Sbjct  75   GKSSKFLNTVFPAKSITVLDTIANLGLLFFLFLVGLELDPKSLRRTGKNALSIAVAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +  +D V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFVLGIGTSFALRHTI--SDGVSNAPFLVFMGVALSITAFPVLA  176



>ref|XP_010999354.1| PREDICTED: cation/H(+) antiporter 19-like [Populus euphratica]
Length=691

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +R  AFL KPLRQP+VIAEI+GG++LGPSA 
Sbjct  19   TSNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLHKPLRQPRVIAEIIGGILLGPSAL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++ T+FP  S  +L++V++IGLLF+LFLVGLELD+ S+RR GK +  IA AGI+L
Sbjct  79   GRSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITL  138

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +        AP+ VFMGV+LSIT FPVLA
Sbjct  139  PFLLGIGTSFVLRSTISKGS--AHAPFLVFMGVSLSITAFPVLA  180



>ref|XP_008341283.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
 ref|XP_008341284.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
Length=806

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDYALPLAILQICLVVTLTRILAYLLRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G N++Y++ IFP+ S  +L++++++GLLF+LF+VGLELD  S+RR GK A CIA AGI L
Sbjct  78   GHNKDYIEAIFPKRSLTVLDTLANLGLLFFLFIVGLELDPKSIRRTGKKALCIALAGIIL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  +  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSFALKETISKGVDG---PPFLVFMGVALSITAFPVLA  179



>gb|EYU23396.1| hypothetical protein MIMGU_mgv1a001514mg [Erythranthe guttata]
Length=804

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+F+LPLLI+Q  LV+ ++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  17   ASNGVFQGDNPLHFSLPLLIIQICLVVALTRALAYLLRPLRQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  +FP  S  +L++++++GLLF+LFLVGLELD  +LRR GK A  IA AGI+L
Sbjct  77   GRNQKYLHAVFPARSLTVLDTIANLGLLFFLFLVGLELDPKALRRTGKKALSIALAGITL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  + +V   P+ VFMGVA+SIT FPVLA
Sbjct  137  PFALGIGTSFVLRSTI--SKDVAQGPFLVFMGVAVSITAFPVLA  178



>emb|CDY67925.1| BnaA03g58740D [Brassica napus]
Length=793

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL++ALPLLI+Q  +V+ ++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLHYALPLLILQICIVLFLTRALAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GLLF+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLSTVFPAKSLTVLDTLANLGLLFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>ref|XP_006664208.1| PREDICTED: cation/H(+) antiporter 19-like [Oryza brachyantha]
Length=797

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+QG+NPL+FALPL I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSQGAFQGENPLDFALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++Q +FP  S  +L++++++GLLF+LFLVGLELD+S++RR GK A  IA AGIS 
Sbjct  64   GRSSKFLQHVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAGISA  123

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+GA +   AP+ VFMGVALSIT FPVLA
Sbjct  124  PFALGIGTSFAFRATIVKGAPQ---APFLVFMGVALSITAFPVLA  165



>ref|XP_009402780.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=768

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+W G NPL+ +LPL+I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVIAEIIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ +M  +FP+    +L+++++IGLLF+LFLVGLELDL S+RR GK A  IA AGI+L
Sbjct  74   GRSKRFMDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGALAIAIAGITL  133

Query  470  PFVFGIGITFLFRR-VVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  +V+GA +    P+ VFMGVALSIT FPVLA
Sbjct  134  PFVLGIGTSVVLRHTIVEGAHQ---GPFLVFMGVALSITAFPVLA  175



>ref|XP_004298856.1| PREDICTED: cation/H(+) antiporter 18-like [Fragaria vesca subsp. 
vesca]
Length=804

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL+I+Q  +V+ ++R  A+ L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSNGVFQGDNPLHYALPLVILQICIVVTLTRILAYFLRPLRQPRVIAEIIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G N++Y+  IFP  S  +L++++++GLLF+LFLVGLELD  SLRR GK A  IA AGI+L
Sbjct  76   GHNKDYINAIFPAKSLTVLDTIANLGLLFFLFLVGLELDPKSLRRTGKKALSIALAGITL  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ +  + +G D    AP+ VFMGVALSIT FPVLA
Sbjct  136  PFVLGIGTSFVLKETISKGVDG---APFLVFMGVALSITAFPVLA  177



>ref|XP_009402107.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=808

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+WQG NPL+ ALPL I+Q  LVI ++RF AF+L PLRQP+V+AEI+GGV+LGPSA 
Sbjct  15   TSNGSWQGDNPLDSALPLAILQICLVIALTRFLAFVLHPLRQPRVVAEIIGGVLLGPSAI  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ +++ +FP+ S  +L++++S+GL+F+LFLVG+ELDL ++RR G+ A  IA AGISL
Sbjct  75   GRSERFLKMVFPKQSLTVLDTLASVGLIFFLFLVGMELDLRAIRRTGQRALAIAIAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  V  A  V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFVMGIGTSVVLRHTV--AKGVPEAPFLVFMGVALSITAFPVLA  176



>ref|XP_004963208.1| PREDICTED: cation/H(+) antiporter 19-like [Setaria italica]
Length=807

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+QG+NPL +ALPL I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSQGAFQGENPLEYALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++++ T+FP  S  +L++++++GLLF+LFLVGLELD+S++RR GK A  IA AGIS+
Sbjct  76   GRSEKFLHTVFPAQSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAGISV  135

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+GA +    P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFAFRATIVKGAPQ---GPFLVFMGVALSITAFPVLA  177



>ref|XP_009137382.1| PREDICTED: cation/H(+) antiporter 17-like [Brassica rapa]
Length=823

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NP+++ALPLLI+Q  +V+ ++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPMHYALPLLILQICIVLFLTRALAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GLLF+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLSTVFPAKSLTVLDTLANLGLLFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>emb|CAN81240.1| hypothetical protein VITISV_031075 [Vitis vinifera]
Length=787

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPL IVQ  LV+VV+R  AFL+KPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPVHFALPLAIVQICLVVVVTRCLAFLMKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ +IFP  S  +L++++++GLLF+LF+VGLELDL SL R GK A  IA AGISL
Sbjct  74   GRNKXYLHSIFPPKSLTVLDTLANLGLLFFLFIVGLELDLKSLHRAGKKALSIAVAGISL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F+ R  +    + G  P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGVGTSFVLRATISKGVDAG--PFVVFMGVALSITAFPVLA  175



>ref|XP_009620181.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620183.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620184.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009620185.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=802

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 125/164 (76%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL IVQ  LV+V++R  A+LL+PLRQP+VIAEI+GGVILGPSA 
Sbjct  16   TSNGVFQGDNPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVIAEIVGGVILGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +Y+  IFP  S  +L+++++ GLLF+LFLVGLELD  SLRR GK A  IA AGIS+
Sbjct  76   GRNAKYLHAIFPSRSLTVLDTLANFGLLFFLFLVGLELDPRSLRRTGKKALSIALAGISV  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRGTI--GKGVSQGPFLVFMGVALSITAFPVLA  177



>emb|CDX94208.1| BnaC07g38420D [Brassica napus]
Length=798

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL++ALPLLI+Q  +V+ ++R  AFL +PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLHYALPLLILQICIVLFLTRVLAFLFRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GLLF+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLSTVFPTKSLTVLDTLANLGLLFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>gb|EYU40046.1| hypothetical protein MIMGU_mgv1a001527mg [Erythranthe guttata]
Length=802

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPLLIVQ  LV+V++R  A++L+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   ASNGVFQGDNPLHFALPLLIVQICLVVVLTRVLAYILRPLRQPRVIAEIIGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +Y+Q IFP  S  +L++++++GLLF+LFLVGLELD  SLR+ GK A  IA AGISL
Sbjct  76   GRNHKYLQAIFPARSLTVLDTLANLGLLFFLFLVGLELDPKSLRQTGKKALSIALAGISL  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  + +G +E    P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGVGTSIVLRATISKGVNE---GPFLVFMGVALSITAFPVLA  177



>ref|XP_009135538.1| PREDICTED: cation/H(+) antiporter 19 [Brassica rapa]
Length=799

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GA+Q +NPL++ALPL+I+Q  LV+V +R  A+LLKPL+QP+VIAEI+GG++LGP+A 
Sbjct  17   SSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAEIIGGILLGPTAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y++TIFPE S  +L+++++IGLLF+LFLVGLELD +++R+ GK +  IA AGISL
Sbjct  77   GRSKVYLETIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGKKSLLIALAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+    + +G  ++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVIGVGASFILSSTISKGVHQL---PFIVFMGVALSITAFPVLA  178



>ref|XP_006413527.1| hypothetical protein EUTSA_v10024412mg [Eutrema salsugineum]
 gb|ESQ54980.1| hypothetical protein EUTSA_v10024412mg [Eutrema salsugineum]
Length=826

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL+ ALPLLI+Q  +V++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLHHALPLLILQICIVLLLTRVLAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLNTVFPSKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFILGIGTSFVLRGSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>ref|XP_009137322.1| PREDICTED: cation/H(+) antiporter 17 [Brassica rapa]
Length=817

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL  ALPLLI+Q  +V+ ++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFILRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G+N +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKNSKFLDTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD    AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGASKAPFLVFMGVALSITAFPVLA  176



>emb|CDY35447.1| BnaC03g62130D [Brassica napus]
Length=799

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPLLI+Q  +V++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFILGIGTSFVLRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>ref|XP_011080876.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
 ref|XP_011080877.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
Length=800

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL+FALPLLI+Q  LV+V++R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSNGVFQGDDPLHFALPLLILQICLVVVLTRVLAYLLRPLRQPRVIAEIIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +Y+  IFP  S  +L++++++GLLF+LFLVGLELD  +LRR G+ A  IA AGI+L
Sbjct  76   GRNPKYLHAIFPPQSLTVLDTIANLGLLFFLFLVGLELDPRALRRTGRKALSIALAGITL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRETISKG--VSHGPFLVFMGVALSITAFPVLA  177



>ref|XP_007158549.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
 gb|ESW30543.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
Length=802

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 4/164 (2%)
 Frame = +2

Query  113  SDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAFG  292
            S+G +QG NPL+FALPL I+Q  LV+VVSR  A+LLKPLRQP+VIAEI+GG++LGPSA G
Sbjct  19   SNGVFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGILLGPSALG  78

Query  293  RNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISLP  472
            R++ YMQ +FP  S  +L+++++IGL+F+LFL GLELDL SLR++G     IA AGISLP
Sbjct  79   RSKSYMQAVFPSRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGHRVLAIAMAGISLP  138

Query  473  FVFGIGITFLFRR-VVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            FV GIG +F+ ++ + +G+D   F    VFMGVALSIT FPVLA
Sbjct  139  FVMGIGSSFVLKQSIAKGSDSAAFL---VFMGVALSITAFPVLA  179



>ref|XP_011077450.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 20 [Sesamum 
indicum]
Length=806

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+G WQG NPL++A PLLI+QTTL++++ R  AFL KPLRQPKV+AE++ G++LGPSAF
Sbjct  11   SSNGVWQGDNPLDYAFPLLIIQTTLILLLCRLLAFLFKPLRQPKVVAEMMSGILLGPSAF  70

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+E+M+ IFP+WS PILES++++GLLF+LFLVGLELDL+S+RR G+ AF IA AGISL
Sbjct  71   GRNEEFMRRIFPKWSTPILESLATVGLLFFLFLVGLELDLNSIRRGGRRAFAIALAGISL  130

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSV  556
             FV GIG+T +FR+ V GAD+VG+  + V
Sbjct  131  TFVIGIGVTSVFRQAVDGADKVGYXAFPV  159



>gb|EAZ29140.1| hypothetical protein OsJ_13203 [Oryza sativa Japonica Group]
Length=712

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPL F+LPLLIVQ  LV+V +R  A+ L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSEGAWQGDNPLRFSLPLLIVQICLVVVFTRGLAYALRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++  +FP+ S  +L++++++GLLF+LFLVGLELD +SLRR G++A  +AAAGISL
Sbjct  64   GRNKRFLDNVFPKDSLTVLDTLANVGLLFFLFLVGLELDPASLRRTGRTALAVAAAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +  A +    P  VFMGVALSIT FPVLA
Sbjct  124  PFALGVGASLVLRAAI--APDAPRGPLIVFMGVALSITAFPVLA  165



>emb|CDP12106.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+ PL++ALPL+I+Q  LVIV++R  A+LL+PLRQP+V+AEI+GGV+LGPSA 
Sbjct  16   TSNGVFQGETPLDYALPLVILQICLVIVLTRTLAYLLRPLRQPRVVAEIIGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +++ T+FP  S  +L++++++GLLF+LFLVGLELD  SLRR GK A  IA AGI+L
Sbjct  76   GRNHKFLHTVFPPRSLTVLDTIANLGLLFFLFLVGLELDPKSLRRTGKKALAIALAGITL  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F  R  + +G  E    P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFALRATISKGVSE---GPFLVFMGVALSITAFPVLA  177



>ref|XP_010909726.1| PREDICTED: cation/H(+) antiporter 19 [Elaeis guineensis]
Length=807

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+WQG+NPL  +LPL IVQ  LVI V+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGSWQGENPLEASLPLAIVQICLVIAVTRSLAFLLRPLRQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ +++T FP+ S  +L+++++IGLL++LFLVGLELDL ++RR GK A  IA AGISL
Sbjct  77   GRSETFLETFFPKNSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGKRALIIAIAGISL  136

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  137  PFIMGIGTSFALRTTINKG--VAEGPFLVFMGVALSITAFPVLA  178



>ref|XP_008662071.1| PREDICTED: cation/H(+) antiporter 19-like [Zea mays]
Length=800

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+QG+NPL++ALPL I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSQGAFQGENPLDYALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  ++  +FP  S  +L+++++IGLLF+LFLVGLELD+S++RR GK A  IA AGIS 
Sbjct  74   GRSHRFLHAVFPAQSMTVLDTLANIGLLFFLFLVGLELDISAIRRTGKKALAIALAGISA  133

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+G  +    P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGIGTSFAFRATIVKGTPQ---GPFLVFMGVALSITAFPVLA  175



>gb|EPS69500.1| hypothetical protein M569_05263 [Genlisea aurea]
Length=798

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL FALPL+I+Q  LV V++R  A+LL+PLRQP+VIAE++GG++LGPSA 
Sbjct  16   TSNGVFQGDDPLQFALPLVIIQICLVFVLTRGLAYLLRPLRQPRVIAEVIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+ TIFP+ S  +L++++++GL+F+LFLVGLELD  SLRR GK A  IA  GI++
Sbjct  76   GRNENYIHTIFPKNSLTVLDTLANLGLIFFLFLVGLELDPKSLRRTGKRALSIALGGITI  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F  R  +  A E    P+ VFMGVALSIT FPVLA
Sbjct  136  PFAMGIGTSFALRATI--AKEAAHGPFLVFMGVALSITAFPVLA  177



>gb|ACC91238.1| putative cation/hydrogen exchanger [Arabidopsis halleri]
Length=821

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL+ ALPLLI+Q  +V++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLDHALPLLILQICIVLLLTRILAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFINTVFPPKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKRALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFILGIGTSFALRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>ref|NP_001067282.2| Os12g0616500 [Oryza sativa Japonica Group]
 gb|ABA99860.2| cation/hydrogen exchanger, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30301.2| Os12g0616500 [Oryza sativa Japonica Group]
Length=802

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+Q +NPL+FALPL+I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSQGAFQKENPLDFALPLIILQICLVVVVTRVLAYLLRPLRQPRVIAEIIGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++  +FP  S  +L++++++GLLF+LFLVGLELD+S++RR GK A  IA AGIS 
Sbjct  75   GRSSKFLHNVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAGISA  134

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+GA +   AP+ VFMGVALSIT FPVLA
Sbjct  135  PFALGIGTSFAFRATIVKGAPQ---APFLVFMGVALSITAFPVLA  176



>ref|XP_002442551.1| hypothetical protein SORBIDRAFT_08g021730 [Sorghum bicolor]
 gb|EES16389.1| hypothetical protein SORBIDRAFT_08g021730 [Sorghum bicolor]
Length=812

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+QG+NPL++ALPL IVQ  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSQGAFQGENPLDYALPLAIVQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++  +FP  S  +L+++++IGLLF+LFLVGLELD+S++RR GK A  IA AGIS 
Sbjct  74   GRSHKFLNAVFPAQSMTVLDTLANIGLLFFLFLVGLELDISAIRRTGKKALAIALAGISA  133

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+G  +    P+ VFMGVALSIT FPVLA
Sbjct  134  PFALGIGTSFAFRATIVKGTPQ---GPFLVFMGVALSITAFPVLA  175



>emb|CDX82359.1| BnaA03g34620D [Brassica napus]
Length=778

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 94/165 (57%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            SS+GA+Q +NPL++ALPL+I+Q  LV+V +R  A+LLKPL+QP+VIAEI+GG++LGP+A 
Sbjct  17   SSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAEIIGGILLGPTAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFPE S  +L+++++IGLLF+LFLVGLELD +++R+ GK +  IA AGISL
Sbjct  77   GRSKVYLDTIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGKKSLLIALAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+    + +G  ++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVIGVGASFILSSTISKGVHQL---PFIVFMGVALSITAFPVLA  178



>gb|EYU23392.1| hypothetical protein MIMGU_mgv1a024127mg, partial [Erythranthe 
guttata]
Length=773

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPLLI+Q  LV+V++R  A+ L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  16   ASNGVFQGDNPLHFALPLLIIQICLVVVLTRVLAYCLRPLRQPRVVAEIIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  +FP  S  +L++++++GLLF+LFLVGLELD  +LR+ GK A  IA AGI+L
Sbjct  76   GRNQKYLHAVFPPQSLTVLDTIANLGLLFFLFLVGLELDPKALRQTGKKALSIALAGITL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  ++ V   P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGIGTSFVLRATI--SEGVSQGPFLVFMGVALSITAFPVLA  177



>gb|EAY92425.1| hypothetical protein OsI_14159 [Oryza sativa Indica Group]
Length=780

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPL F+LPLLIVQ  LV+V +R  A+ L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSEGAWQGDNPLRFSLPLLIVQICLVVVFTRGLAYALRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++  +FP+ S  +L++++++GLLF+LFLVGLELD +SLRR G++A  +AAAGISL
Sbjct  64   GRNKRFLDNVFPKDSLTVLDTLANVGLLFFLFLVGLELDPASLRRTGRTALAVAAAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +  A +    P  VFMGVALSIT FPVLA
Sbjct  124  PFALGVGASLVLRAAI--APDAPRGPLIVFMGVALSITAFPVLA  165



>ref|XP_008369567.1| PREDICTED: cation/H(+) antiporter 19-like [Malus domestica]
Length=817

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FA+PLLI+Q  LV+V +R  AFLLKPLRQP+VIAE++GG++LGPSAF
Sbjct  14   TSNGSFQGENPLDFAIPLLILQIVLVVVFTRTLAFLLKPLRQPRVIAEVIGGILLGPSAF  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+Q+++ T+FP  +  +L++V++IGLLF+LFLVGLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F  R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFALRATVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>ref|XP_006654211.1| PREDICTED: cation/H(+) antiporter 19-like [Oryza brachyantha]
Length=786

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG+NPL+ ALPL I+Q  +V+V++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFLLRPLRQPRVIAEIIGGILLGPSAI  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  ++ T+FP+ S  +L+++++IGLLF+LFLVGLELDL SLRR G  A  IA AGISL
Sbjct  64   GRSSAFIDTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRSLRRTGAGALAIAVAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GI  +F+ +  V  A  V   P+ VFMGVALSIT FPVLA
Sbjct  124  PFVLGIATSFVLQNTV--ARGVPTGPFLVFMGVALSITAFPVLA  165



>ref|NP_001173696.1| Os03g0828600 [Oryza sativa Japonica Group]
 gb|AAL79755.1|AC096687_19 putative ion antiporter [Oryza sativa Japonica Group]
 gb|ABF99678.1| cation/hydrogen exchanger, putative [Oryza sativa Japonica Group]
 dbj|BAH92424.1| Os03g0828600 [Oryza sativa Japonica Group]
Length=780

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPL F+LPLLIVQ  LV+V +R  A+ L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSEGAWQGDNPLRFSLPLLIVQICLVVVFTRGLAYALRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++  +FP+ S  +L++++++GLLF+LFLVGLELD +SLRR G++A  +AAAGISL
Sbjct  64   GRNKRFLDNVFPKDSLTVLDTLANVGLLFFLFLVGLELDPASLRRTGRTALAVAAAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G + + R  +  A +    P  VFMGVALSIT FPVLA
Sbjct  124  PFALGVGASLVLRAAI--APDAPRGPLIVFMGVALSITAFPVLA  165



>ref|XP_004146578.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 ref|XP_004164368.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53373.1| hypothetical protein Csa_4G050280 [Cucumis sativus]
Length=805

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV++++R   F  +PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVILTRLLGFAFRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+QE++ T+FP  S  +L++++++GLLF+LFLVGLELDL SLRR GK A  IA AGI+L
Sbjct  78   GRSQEFLHTVFPARSLSVLDTLANLGLLFFLFLVGLELDLKSLRRTGKGAMAIAVAGITL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +++ R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSYVLRSTISKG--VSGPPFLVFMGVALSITAFPVLA  179



>emb|CDY03530.1| BnaC01g15520D [Brassica napus]
Length=798

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL  ALPLLI+Q  +V+ ++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD    AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGASKAPFLVFMGVALSITAFPVLA  176



>ref|XP_008451982.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis melo]
Length=805

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV++++R   F L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVLLTRLLGFALRPLRQPRVIAEIVGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+QE++  +FP  S  +L++++++GLLF+LFLVGLELDL SLRR GK A  IA AGI+L
Sbjct  78   GRSQEFLHRVFPARSLAVLDTLANLGLLFFLFLVGLELDLKSLRRTGKGAMAIAVAGITL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +++ R  + +G D     P+ VFMGVALSIT FPVLA
Sbjct  138  PFVLGIGTSYVLRSTISKGVDG---PPFLVFMGVALSITAFPVLA  179



>ref|XP_002442550.1| hypothetical protein SORBIDRAFT_08g021720 [Sorghum bicolor]
 gb|EES16388.1| hypothetical protein SORBIDRAFT_08g021720 [Sorghum bicolor]
Length=793

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG+NPL+FALPL+I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  5    ASNGAFQGENPLDFALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  64

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++ T+FP  S  +L++++++GLLF+LFLVGLELD+S++RR G+ A  I+ +GI+L
Sbjct  65   GRSTKFLHTVFPPASMTVLDTLANLGLLFFLFLVGLELDISAIRRTGRKALAISLSGIAL  124

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F FR  V    +   AP+ VFMGVALSIT FPVLA
Sbjct  125  PFALGVGTSFAFRATV--VKDAPHAPFLVFMGVALSITAFPVLA  166



>ref|XP_004505591.1| PREDICTED: cation/H(+) antiporter 19-like [Cicer arietinum]
Length=815

 Score =   144 bits (363),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 93/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NP+++ALPLLIVQ  LV+  +RF AFL KPLRQP+VIAE++GG++LGPSA 
Sbjct  15   TSNGAFQHENPMDYALPLLIVQIILVVAFTRFIAFLCKPLRQPRVIAEVIGGILLGPSAI  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++++++T FP  S  +LE+++++GLLF+LFLVGLELD+ S+RR G  A CIA AGI+L
Sbjct  75   GRSKKFLETFFPARSLTVLETLANVGLLFFLFLVGLELDMRSIRRTGPKALCIAVAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  +  + +V    + VFMGV+LSIT FPVLA
Sbjct  135  PFVLGIGTSLVLRSTI--SKDVDPTSFLVFMGVSLSITAFPVLA  176



>ref|XP_009359907.1| PREDICTED: cation/H(+) antiporter 19-like [Pyrus x bretschneideri]
Length=824

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FA+PLLIVQ  LV+V +R  AFLLKPLRQP+VIAE++GG++LGPSAF
Sbjct  14   TSNGSFQGENPLDFAIPLLIVQIVLVVVFTRTLAFLLKPLRQPRVIAEVIGGILLGPSAF  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+Q+++ T+FP  +  +L++V++IGLLF+LFLVGLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F  R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFALRATVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>gb|KDO76404.1| hypothetical protein CISIN_1g003702mg [Citrus sinensis]
Length=801

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV++++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP  S  +L++++++GLLF+LFLVGLE+D  S+RR GK A  IA  GISL
Sbjct  74   GRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSIALGGISL  133

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F  R  V +G D+   AP+ +FMGVA SIT FPVLA
Sbjct  134  PFALGIGTSFALRATVSKGVDQ---APFLIFMGVAFSITAFPVLA  175



>ref|XP_006439425.1| hypothetical protein CICLE_v10018903mg [Citrus clementina]
 gb|ESR52665.1| hypothetical protein CICLE_v10018903mg [Citrus clementina]
Length=801

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV++++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP  S  +L++++++GLLF+LFLVGLE+D  S+RR GK A  IA  GISL
Sbjct  74   GRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSIALGGISL  133

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F  R  V +G D+   AP+ +FMGVA SIT FPVLA
Sbjct  134  PFALGIGTSFALRATVSKGVDQ---APFLIFMGVAFSITAFPVLA  175



>ref|XP_009402488.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=792

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+W G NPL+ +LPL+I+Q  LV+VV+R  AFLL+PLRQP+V+AEI+GG++LGPSA 
Sbjct  14   TSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVVAEIIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ +   +FP+    +L+++++IGLLF+LFLVGLELDL S+RR GK A  IA AGI+L
Sbjct  74   GRSKRFTDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGALAIAIAGITL  133

Query  470  PFVFGIGITFLFRR-VVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  +V+GA +    P+ VFMGVALSIT FPVLA
Sbjct  134  PFVLGIGTSVVLRHTIVEGARQ---GPFLVFMGVALSITAFPVLA  175



>ref|XP_008654236.1| PREDICTED: uncharacterized protein LOC100191437 isoform X1 [Zea 
mays]
 gb|AFW81495.1| hypothetical protein ZEAMMB73_283365 [Zea mays]
Length=796

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG+NPL+ ALPL I+Q  +V+V++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVIAEIIGGILLGPSAV  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  ++ T+FP+ S  +L+++++IGLL++LFLVGLELDL ++R  G +A  IA AGISL
Sbjct  75   GRSTAFLNTVFPKQSLTVLDTIANIGLLYFLFLVGLELDLRAIRHTGSTALVIAVAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ +  V  A  V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIMGIGTSFVLQHTV--ARGVPTAPFLVFMGVALSITAFPVLA  176



>ref|XP_010106576.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXC10830.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=798

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL+FALPL+I+Q  LV+VV+R  AFL++PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGDDPLHFALPLVILQICLVLVVTRVLAFLMRPLRQPRVIAEIIGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ Y+  IFP  S  +L++++++GLLF+LFLVGLELD  S+RR GK A  IA  GISL
Sbjct  75   GRNQNYLHAIFPARSLTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALGIAIVGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +     V  A + VFMGVALSIT FPVLA
Sbjct  135  PFALGIGSSFILRATISKG--VSSAAFLVFMGVALSITAFPVLA  176



>ref|XP_006476453.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476454.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Citrus 
sinensis]
 ref|XP_006476455.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Citrus 
sinensis]
Length=801

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV++++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGVFQGDNPLDYALPLAILQICLVVLLTRLLAFVLRPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+++++ +FP  S  +L++++++GLLF+LFLVGLE+D  S+RR GK A  IA  GISL
Sbjct  74   GRNKDFLKAVFPSRSLTVLDTLANLGLLFFLFLVGLEMDPKSIRRAGKKALSIALGGISL  133

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F  R  V +G D+   AP+ +FMGVA SIT FPVLA
Sbjct  134  PFALGIGTSFALRATVSKGVDQ---APFLIFMGVAFSITAFPVLA  175



>ref|XP_003550583.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +RF AFL +PLRQP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGAFQHENPLDYALPLLILQICLVVFFTRFIAFLCRPLRQPRVIAEIIGGILLGPSAI  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++ T+FP+ S  +L+++ +IGLLF+LFLVGLELD+ ++RR G  A  IA  GI++
Sbjct  77   GRNEKFLNTVFPKKSITVLDTLGNIGLLFFLFLVGLELDMRAIRRTGHKALGIALCGITV  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  V +GA+ V F    VFMGVALSIT FPVLA
Sbjct  137  PFVLGIGTSFALRATVSKGAEPVSFL---VFMGVALSITAFPVLA  178



>emb|CDY69175.1| BnaCnng62230D [Brassica napus]
Length=776

 Score =   144 bits (362),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 93/165 (56%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPL+I+Q  LV+V +R  A+LLKPL+QP+VIAEI+GG++LGP+A 
Sbjct  17   TSNGAFQNENPLDYALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAEIIGGILLGPTAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFPE S  +L+++++IGLLF+LFLVGLELD +++R+ GK +  IA AGISL
Sbjct  77   GRSKVYLDTIFPEKSMTVLDTLANIGLLFFLFLVGLELDFAAIRKTGKKSLLIALAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+    + +G  ++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVIGVGASFILSSTISKGVHQL---PFIVFMGVALSITAFPVLA  178



>gb|KHN17780.1| Cation/H(+) antiporter 19 [Glycine soja]
Length=800

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+  +RF AFL +PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSNGAFQHENPLDYALPLLILQICLVVFFTRFIAFLCRPLRQPRVIAEIIGGILLGPSAI  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++ T+FP+ S  +L+++ +IGLLF+LFLVGLELD+ ++RR G  A  IA  GI++
Sbjct  64   GRNEKFLNTVFPKKSITVLDTLGNIGLLFFLFLVGLELDMRAIRRTGHKALGIALCGITV  123

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  V +GA+ V F    VFMGVALSIT FPVLA
Sbjct  124  PFVLGIGTSFALRATVSKGAEPVSFL---VFMGVALSITAFPVLA  165



>gb|EEC69681.1| hypothetical protein OsI_39126 [Oryza sativa Indica Group]
Length=802

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+Q +NPL+FALPL+I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSQGAFQKENPLDFALPLIILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++  +FP  S  +L++++++GLLF+LFLVGLELD+S++RR GK A  IA AGIS 
Sbjct  75   GRSSKFLHNVFPPKSMTVLDTLANLGLLFFLFLVGLELDISAIRRTGKKALAIALAGISA  134

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F FR  +V+GA +   AP+ VFMGVALSIT FPVLA
Sbjct  135  PFALGIGTSFAFRATIVKGAPQ---APFLVFMGVALSITAFPVLA  176



>emb|CDY24802.1| BnaA08g15080D [Brassica napus]
Length=799

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPLLI+Q  +V++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+ 
Sbjct  75   GKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITF  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFILGIGTSFVLRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>emb|CDY47629.1| BnaA01g13360D [Brassica napus]
Length=798

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL  ALPLLI+Q  +V+ ++R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGENPLQHALPLLILQICIVLFLTRVLAFILRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+L
Sbjct  75   GKSSKFLDTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+FGIG +F  R  +  AD    AP+ VFMGVALSIT FPVLA
Sbjct  135  PFIFGIGTSFALRSSI--ADGASKAPFLVFMGVALSITAFPVLA  176



>ref|XP_010101602.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB88792.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=813

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL++ALPL I+Q  LV+ ++R  AFLL+PLRQP+VIAEI+GG++LGPSAF
Sbjct  18   TSNGVFQGDNPLDYALPLAILQILLVVALTRTLAFLLRPLRQPRVIAEIVGGILLGPSAF  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP+ S  +L++++++GLLF+LFLVGLELDL +LRR GK AF IA  GISL
Sbjct  78   GRNKAYLDAVFPDKSLTVLDTLANLGLLFFLFLVGLELDLKALRRTGKKAFSIAIVGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F  R  +     V    + VF+GVALSIT FPVLA
Sbjct  138  PFIIGIGTSFALRATISKG--VQGPAFLVFIGVALSITAFPVLA  179



>ref|XP_002297994.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
 gb|EEE82799.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
Length=804

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  18   TSNGVFQGDNPLDFALPLAILQICLVVVVTRGLAFLLRPLRQPRVIAEIIGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+Q +FP  S  +L+++++IGL+F+LFL GLELD  SL R GK A  IA AGISL
Sbjct  78   GRSKGYLQAVFPTRSLTVLDTLANIGLIFFLFLAGLELDPKSLGRTGKKALAIAMAGISL  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  + +V    + VFMGVALSIT FPVLA
Sbjct  138  PFAMGIGTSFILRLTI--SKDVNSTAFLVFMGVALSITAFPVLA  179



>ref|XP_009109299.1| PREDICTED: cation/H(+) antiporter 17-like [Brassica rapa]
Length=824

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG +PL++ALPLLI+Q  +V++++R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGVFQGDDPLHYALPLLILQICIVLLLTRVLAFLLRPLRQPRVIAEIVGGILLGPSAL  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ +++ T+FP  S  +L++++++GL+F+LFLVGLELD  SL+R GK A  IA AGI+ 
Sbjct  75   GKSSKFLNTVFPAKSLTVLDTLANLGLIFFLFLVGLELDPKSLKRTGKKALSIALAGITF  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ R  +  AD V  AP+ VFMGVALSIT FPVLA
Sbjct  135  PFILGIGTSFVLRSSI--ADGVSKAPFLVFMGVALSITAFPVLA  176



>ref|XP_010533613.1| PREDICTED: cation/H(+) antiporter 18-like [Tarenaya hassleriana]
Length=808

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NP++FALPL I+Q  +V+ ++R  A+LL+PLRQP+VIAE++GG++LGPS  
Sbjct  19   TSNGVFQGDNPIDFALPLAILQICIVVALTRGLAYLLRPLRQPRVIAEVIGGIMLGPSLL  78

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFP  S  +LE+++++G+LF+LFL GLE+D  SLRR GK A  IAAAGISL
Sbjct  79   GRSKGYLNTIFPSKSLTVLETLANLGILFFLFLAGLEIDTGSLRRTGKKALAIAAAGISL  138

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ +  + +G D   F    +FMGVALSIT FPVLA
Sbjct  139  PFVMGIGSSFVLKATISKGVDGTAFL---IFMGVALSITAFPVLA  180



>emb|CDP12105.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q  NPL+FALPL I+Q  LV+VV+R  AF LKPLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGAFQHDNPLDFALPLAILQICLVLVVTRCLAFALKPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y++ +FP  S  +L+++++IGLLF+LFL GLEL+  +L+R GK+A  IA AGIS+
Sbjct  74   GRNKSYLKAVFPPRSLTVLDTLANIGLLFFLFLAGLELNFKTLQRTGKTALSIAIAGISV  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG  F  R  +  A++   A + VFMGVALSIT FPVLA
Sbjct  134  PFALGIGSAFALRATI--AEDANAAAFFVFMGVALSITAFPVLA  175



>ref|XP_006406710.1| hypothetical protein EUTSA_v10020094mg [Eutrema salsugineum]
 gb|ESQ48163.1| hypothetical protein EUTSA_v10020094mg [Eutrema salsugineum]
Length=801

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q ++PL+FALPL+I+Q  LV+V +R  A+LLKPL+QP+VIAEI+GG++LGP+A 
Sbjct  17   TSNGAFQNESPLDFALPLIILQICLVVVFTRLLAYLLKPLKQPRVIAEIIGGILLGPTAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFP+ S  +L+++++IGLLF+LFLVGLELD S++R+ GK +  IA AGISL
Sbjct  77   GRSKVYLDTIFPKKSMTVLDTLANIGLLFFLFLVGLELDFSAIRKTGKKSLLIAVAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G +F+    + +G  ++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFIMGVGTSFVLSSTISKGVHQL---PFIVFMGVALSITAFPVLA  178



>ref|XP_010541354.1| PREDICTED: cation/H(+) antiporter 17-like [Tarenaya hassleriana]
Length=826

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG+NPL++ALPL+I+Q  +V+V++R  +F L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGIFQGENPLDYALPLVILQICIVVVLTRTLSFFLRPLRQPRVIAEIVGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            G++ ++  TIFP  S  +L++V+++GLLF+LFLVGLELD  SLRR GK+A  IA AG++ 
Sbjct  74   GKSSKFRDTIFPPRSLTVLDTVANLGLLFFLFLVGLELDPRSLRRTGKNALSIAIAGMTF  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  +  +D V  AP+ VFMGVALSIT FPVLA
Sbjct  134  PFVLGIGTSFALRHTI--SDGVDNAPFLVFMGVALSITAFPVLA  175



>ref|XP_002440851.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
 gb|EES19281.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
Length=796

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG+NPL+ ALPL I+Q  +V+V++R  AF+L+PLRQP+V+AEI+GG++LGPSA 
Sbjct  15   TSDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVVAEIIGGILLGPSAV  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  ++ T+FP+ S  +L+++++IGLL++LFLVGLELDL ++RR G +A  IA AGISL
Sbjct  75   GRSTAFLNTVFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGSTALVIAVAGISL  134

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ GIG +F+ +  V  A  V   P+ VFMGVALSIT FPVLA
Sbjct  135  PFIMGIGTSFVLQHTV--ARGVPTGPFLVFMGVALSITAFPVLA  176



>ref|XP_004298855.1| PREDICTED: cation/H(+) antiporter 18-like [Fragaria vesca subsp. 
vesca]
Length=803

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 125/165 (76%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  +V+ ++R  A+LLKPLRQP+VIAEI+GGV+LGPSA 
Sbjct  18   TSNGVFQGDNPLHFALPLAILQICIVVALTRGLAYLLKPLRQPRVIAEIIGGVLLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+Q IFP  S  +L++++++GLLF+LFL GLE+D  +LR+ GK A  IA  GISL
Sbjct  78   GRNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKALRQTGKKALAIAVIGISL  137

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  + +G D   F    VFMGVALSIT FPVLA
Sbjct  138  PFALGIGSSFVLRATISKGVDLTAFL---VFMGVALSITAFPVLA  179



>ref|NP_001159300.1| uncharacterized protein LOC100304392 [Zea mays]
 gb|ACN25719.1| unknown [Zea mays]
 tpg|DAA47523.1| TPA: hypothetical protein ZEAMMB73_566840 [Zea mays]
Length=795

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+QG NPL+FALPL+I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  5    ASNGAFQGDNPLDFALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  64

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++ T+FP  S  +L++++++GLLF+LFLVGLELD++++RR G+ A  I+ +GI+L
Sbjct  65   GRSTKFLHTVFPPASMTVLDTLANLGLLFFLFLVGLELDIAAIRRTGRKALAISLSGIAL  124

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F FR  V    +   AP+ VFMGVALSIT FPVLA
Sbjct  125  PFALGVGTSFAFRATV--VKDARHAPFLVFMGVALSITAFPVLA  166



>ref|XP_009614856.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009614857.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
 ref|XP_009614858.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana tomentosiformis]
Length=787

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+VV+R  AFLL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRVIAEIIGGILLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S  +L+++++IGLLF+LFLVGLELDL SLR++GK    IA AGISL
Sbjct  76   GRNKAYLNAVFPPKSITVLDTLANIGLLFFLFLVGLELDLKSLRQSGKKVLGIAVAGISL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +  A  V    + VFMGVALSIT FPVLA
Sbjct  136  PFALGIGSSFILRETI--AKGVNAPSFLVFMGVALSITAFPVLA  177



>ref|XP_009393134.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=798

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G+W G NPL+ ALPL+I+Q  LV+VV+R  AF+L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  14   TSNGSWDGDNPLHHALPLIILQICLVVVVTRALAFVLRPLRQPRVIAEIIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+  + + +FP+ S  +L++V++IGL+F+LFLVGLELD+ ++RR GK A  IA AGISL
Sbjct  74   GRSTRFTENVFPKHSMTVLDTVANIGLIFFLFLVGLELDIRAIRRTGKGALAIALAGISL  133

Query  470  PFVFGIGITFLFR-RVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G + + R  +V+G  +    P+ VFMGVALSIT FPVLA
Sbjct  134  PFVLGVGTSVVLRSTIVKGTRQ---GPFLVFMGVALSITAFPVLA  175



>ref|XP_004981194.1| PREDICTED: cation/H(+) antiporter 19-like [Setaria italica]
Length=797

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GAWQG NPL+F+LPL+I+Q  LV+V++R  AF L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  4    TSEGAWQGGNPLHFSLPLIILQVCLVLVLTRGLAFALRPLRQPRVIAEIIGGILLGPSAL  63

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ ++  +FP  S  +L+++++IGLLF+LFLVGLELD +SLRR G+ AF IA AGISL
Sbjct  64   GRSKVFLDHVFPPESLTVLDTLANIGLLFFLFLVGLELDPASLRRTGRRAFAIAVAGISL  123

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF FG+G +   R  +      G  P  VFMGVALSIT FPVLA
Sbjct  124  PFAFGVGSSLALRAAIDPGAPRG--PLVVFMGVALSITAFPVLA  165



>ref|XP_007225273.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
 gb|EMJ26472.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
Length=816

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FALPLLI+Q  LV+V +R  AFLLKPLRQP+VIAE++GG++LGPSA 
Sbjct  14   TSNGSFQGENPLDFALPLLILQICLVVVFTRTLAFLLKPLRQPRVIAEVIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++++ T+FP  S  +L++V++IGLLF+LFL+GLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSEKFLHTVFPAKSMTVLDTVANIGLLFFLFLIGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F+ R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFVLRSTVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>ref|XP_008222309.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 19 [Prunus 
mume]
Length=815

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FALPLLI+Q  LV+V +R  AFLLKPLRQP+VIAE++GG++LGPSA 
Sbjct  14   TSNGSFQGENPLDFALPLLILQICLVVVFTRTLAFLLKPLRQPRVIAEVIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++++ T+FP  S  +L++V++IGLLF+LFL+GLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSEKFLHTVFPAKSMTVLDTVANIGLLFFLFLIGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F+ R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFVLRATVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>gb|KEH32403.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=811

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  +V+  +R  A+L KPL+QP+VIAEI+GG++LGPSA 
Sbjct  15   TSNGAFQHENPLDYALPLLILQICVVVTFTRCIAYLCKPLKQPRVIAEIIGGILLGPSAI  74

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+++++ T+FP+ S  +L+++++IGLLF+LFLVGLELD+ S+RR GK A  IA  GI+ 
Sbjct  75   GRSEKFLHTVFPKRSLTVLDTLANIGLLFFLFLVGLELDMRSIRRTGKKALAIALCGITF  134

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + R  + +GA  V   P+ VFMGVALSIT FPVLA
Sbjct  135  PFVLGIGTSVVLRATISKGAQPV---PFLVFMGVALSITAFPVLA  176



>ref|XP_011073516.1| PREDICTED: cation/H(+) antiporter 18-like [Sesamum indicum]
Length=801

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +Q  +PL+FALPL+IVQ  LV+V++R  A+LL+PLRQP+VIAEI+GGV+LGPSA 
Sbjct  16   TSNGVFQEDDPLHFALPLVIVQICLVVVLTRVLAYLLRPLRQPRVIAEIIGGVLLGPSAL  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRNQ+Y+  IFP  S  +L++++++GLLF+LFLVGLELD   LRR GK A  IA  GI L
Sbjct  76   GRNQKYLDAIFPPRSLTVLDTLANLGLLFFLFLVGLELDPKGLRRTGKKALSIALGGIGL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +FL R  +     V   P+ VFMGVALSIT FPVLA
Sbjct  136  PFALGVGTSFLLRATISKG--VNQGPFLVFMGVALSITAFPVLA  177



>ref|XP_004963207.1| PREDICTED: cation/H(+) antiporter 19-like isoform X1 [Setaria 
italica]
Length=798

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S GA+QG+NPL++ALPL+I+Q  LV+VV+R  A+LL+PLRQP+VIAEI+GG++LGPSA 
Sbjct  5    ASHGAFQGENPLDYALPLIILQICLVLVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSAL  64

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+ +++ T+FP  S  +L++++++GLLF+LFLVGLELD+S++RR G+ A  I+ +GI+L
Sbjct  65   GRSTKFLHTVFPPESMTVLDTLANLGLLFFLFLVGLELDISAIRRTGRKALAISLSGIAL  124

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G +F FR  +    +   AP+ VFMGVALSIT FPVLA
Sbjct  125  PFALGVGTSFAFRATI--VKDAPHAPFLVFMGVALSITAFPVLA  166



>ref|XP_002978431.1| hypothetical protein SELMODRAFT_50946, partial [Selaginella moellendorffii]
 gb|EFJ20417.1| hypothetical protein SELMODRAFT_50946, partial [Selaginella moellendorffii]
Length=775

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S G WQG NP+ F+L LLIVQ  LV+ V+R    LLKPLRQP+VIAEI+GGV+LGPSA 
Sbjct  2    TSHGIWQGDNPIEFSLSLLIVQIILVLTVTRVLGLLLKPLRQPRVIAEIIGGVLLGPSAL  61

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN +Y+  IF + S  IL + +++GL+F+LF+VGLELDL+SL+R GK A  I+ AGISL
Sbjct  62   GRNSDYLAKIFTKQSLSILTTFANMGLMFFLFMVGLELDLASLKRTGKQAAAISIAGISL  121

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  G+G++F+    V    +  F P+ VFMGVALSIT FPVLA
Sbjct  122  PFAAGVGVSFVLHNTVN--PDTKFIPFLVFMGVALSITAFPVLA  163



>ref|XP_008390248.1| PREDICTED: cation/H(+) antiporter 19 [Malus domestica]
Length=817

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FALPLLI+Q  LV+V +R  AFLL+PLRQP+VIAE++GG++LGPSA 
Sbjct  14   TSNGSFQGENPLDFALPLLILQIVLVVVFTRTLAFLLRPLRQPRVIAEVIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+Q+++ T+FP  +  +L++V++IGLLF+LFLVGLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F  R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFALRATVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>ref|XP_004252574.1| PREDICTED: cation/H(+) antiporter 18 [Solanum lycopersicum]
 ref|XP_010314495.1| PREDICTED: cation/H(+) antiporter 18 [Solanum lycopersicum]
Length=790

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL I+Q  LV+VV+R  AFLL+PLRQP+VIAE++GG++LGPSA 
Sbjct  12   TSNGIFQGDNPLDFALPLAILQICLVLVVTRGLAFLLRPLRQPRVIAEVIGGILLGPSAL  71

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ Y+  +FP  S  +L++++++GLLF+LFL GLELD+ SLR++GK    IA  GI+L
Sbjct  72   GRNKGYLNAVFPPKSITVLDTLANVGLLFFLFLAGLELDVKSLRQSGKKVLAIAITGITL  131

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+ R  + QG +   F    VFMGVALSIT FPVLA
Sbjct  132  PFVLGVGTSFILRGTINQGVNATAFL---VFMGVALSITAFPVLA  173



>ref|XP_009353458.1| PREDICTED: cation/H(+) antiporter 19 [Pyrus x bretschneideri]
Length=818

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G++QG+NPL+FALPLLI+Q  LV+V +R  AFLL+PLRQP+VIAE++GG++LGPSA 
Sbjct  14   TSNGSFQGENPLDFALPLLILQIVLVVVFTRTLAFLLRPLRQPRVIAEVIGGILLGPSAL  73

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR+Q+++ T+FP  +  +L++V++IGLLF+LFLVGLELD+ ++RR GK +  IA AGI+L
Sbjct  74   GRSQKFLHTVFPAKAMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGKKSLGIAVAGITL  133

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+  +F  R  V     V   P+ VF+GVALSIT FPVLA
Sbjct  134  PFVLGVFTSFALRATVSKG--VSQGPFLVFIGVALSITAFPVLA  175



>ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana]
 sp|Q9LUN4.1|CHX19_ARATH RecName: Full=Cation/H(+) antiporter 19; AltName: Full=Protein 
CATION/H+ EXCHANGER 19; Short=AtCHX19 [Arabidopsis thaliana]
 dbj|BAB02053.1| Na+/H+ exchangeing protein-like [Arabidopsis thaliana]
 gb|AAX49547.1| cation/H+ exchanger [Arabidopsis thaliana]
 gb|AEE75983.1| cation/H(+) antiporter 19 [Arabidopsis thaliana]
Length=800

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q ++PL+FALPL+I+Q  LV+V +R  A+ LKPL+QP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFP+ S  +L+++++IGLLF+LFLVGLELD +++++ GK +  IA AGISL
Sbjct  77   GRSKAYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFAAIKKTGKKSLLIAIAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF+ G+G +F+    + +G D++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFIVGVGTSFVLSATISKGVDQL---PFIVFMGVALSITAFPVLA  178



>gb|EAY97346.1| hypothetical protein OsI_19269 [Oryza sativa Indica Group]
Length=553

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 125/164 (76%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG++PL  ALPL IVQ  +V+V++R  AF L+PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSDGVFQGEDPLEAALPLAIVQICIVVVLTRVLAFFLRPLRQPRVIAEIIGGIMLGPSAI  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  ++ T+FP+ S  +L+++++IGLLF+LFLVGLELDL ++RR G  A  IA AGISL
Sbjct  76   GRNSAFINTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRAIRRTGAGALAIAVAGISL  135

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG + + +  V      G  P+ VFMGVALSIT FPVLA
Sbjct  136  PFVLGIGTSVVLQNTVNRGVPTG--PFLVFMGVALSITAFPVLA  177



>ref|XP_002883073.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59332.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=800

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q ++PL+FALPL+I+Q  LV+V +R  A+ LKPL+QP+VIAEI+GG++LGPSA 
Sbjct  17   TSNGAFQNESPLDFALPLIILQIVLVVVFTRLLAYFLKPLKQPRVIAEIIGGILLGPSAL  76

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++ Y+ TIFP+ S  +L+++++IGLLF+LFLVGLELD +++R+ GK +  IA AGISL
Sbjct  77   GRSKAYLDTIFPKKSLTVLDTLANIGLLFFLFLVGLELDFTAIRKTGKKSLLIALAGISL  136

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV G+G +F+    + +G +++   P+ VFMGVALSIT FPVLA
Sbjct  137  PFVVGVGTSFVLSATISKGVNQL---PFIVFMGVALSITAFPVLA  178



>ref|XP_004146576.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53371.1| hypothetical protein Csa_4G050260 [Cucumis sativus]
Length=799

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+G +QG NPL+FALPL+I+Q  LV+ ++R  AFLL+PL+QP+VI EI+GG++LGPSA 
Sbjct  18   TSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQPRVIGEIIGGILLGPSAL  77

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN+ ++ TIFP  S  +L+++++IGLLF+LFLVGLELDL S+RR GK AF IA  GI +
Sbjct  78   GRNKNFLHTIFPSNSITLLDTIANIGLLFFLFLVGLELDLKSIRRTGKKAFGIAITGICV  137

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PF  GIG +F+ R  +     V  + + +FMGVALSIT FPVLA
Sbjct  138  PFALGIGSSFVLRETISKG--VNASAFLIFMGVALSITAFPVLA  179



>ref|XP_004146577.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 ref|XP_004164367.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53372.1| hypothetical protein Csa_4G050270 [Cucumis sativus]
Length=798

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +SDG +QG NPLN+ALPL I+Q  LV++++R  +FLL+P+RQP+VIAEI+GG++LGPSA 
Sbjct  23   TSDGIFQGDNPLNYALPLAILQICLVVLLTRLLSFLLRPIRQPRVIAEIVGGILLGPSAL  82

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN  Y+ TIFP  S  +L++++++GLLF+LFLVGLELDL SLRR GK A CIA AGI+L
Sbjct  83   GRNLAYLHTIFPPRSLTVLDTLANLGLLFFLFLVGLELDLKSLRRTGKRAMCIAFAGITL  142

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F+ R  + +G +E   A   VFMGVALSIT FPVLA
Sbjct  143  PFVLGIGTSFILRSTISKGVNE---AALLVFMGVALSITAFPVLA  184



>ref|XP_007154518.1| hypothetical protein PHAVU_003G125300g [Phaseolus vulgaris]
 gb|ESW26512.1| hypothetical protein PHAVU_003G125300g [Phaseolus vulgaris]
Length=817

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+V +RF AFL +PLRQP+VIAEI+GG++LGPSA 
Sbjct  22   TSNGAFQHENPLDYALPLLILQICLVVVFTRFLAFLFRPLRQPRVIAEIIGGILLGPSAI  81

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GR++++   +FPE S  +L++V++IGLLF+LFLVGLELD+ ++RR G  A  IA  GI++
Sbjct  82   GRSEKFKNAVFPEKSITVLDTVANIGLLFFLFLVGLELDMRAIRRTGHKALGIALCGITV  141

Query  470  PFVFGIGITFLFRRVVQGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +   R  V    E    P+ VFMGVALSIT FPVLA
Sbjct  142  PFVLGIGTSIALRATVSKDAE--LLPFLVFMGVALSITAFPVLA  183



>ref|XP_003542393.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +2

Query  110  SSDGAWQGQNPLNFAlpllivqttlvivvSRFFAFLLKPLRQPKVIAEILGGVILGPSAF  289
            +S+GA+Q +NPL++ALPLLI+Q  LV+V +R  AFL +PLRQP+VIAEI+GG++LGPSA 
Sbjct  16   TSNGAFQHENPLDYALPLLILQICLVVVFTRVIAFLCRPLRQPRVIAEIIGGILLGPSAI  75

Query  290  GRNQEYMQTIFPEWSAPILESVSSIgllfylflvgleldlSSLRRNGKSAFCIAAAGISL  469
            GRN++++ T+FP+ S  +L+++ ++GLLF+LFLVGLELD+ ++RR G  A  IA  GI++
Sbjct  76   GRNEKFLSTVFPKKSITVLDTLGNVGLLFFLFLVGLELDMRAIRRTGHKALAIALCGITV  135

Query  470  PFVFGIGITFLFRRVV-QGADEVGFAPYSVFMGVALSITGFPVLA  601
            PFV GIG +F  R  V +GA+ V F    VFMGVALSIT FPVLA
Sbjct  136  PFVLGIGTSFALRATVSKGAEPVSFL---VFMGVALSITAFPVLA  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370