BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS110G11

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAM31935.1|  ATPase 3                                               392   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848754.1|  hypothetical protein AMTR_s00026p00031910          396   3e-135   
gb|KHN17608.1|  Plasma membrane ATPase 4                                413   8e-135   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    413   9e-135   Glycine max [soybeans]
gb|KHN22686.1|  Plasma membrane ATPase 4                                413   1e-134   Glycine soja [wild soybean]
emb|CDP02997.1|  unnamed protein product                                410   2e-133   Coffea canephora [robusta coffee]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           409   2e-133   Cicer arietinum [garbanzo]
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     409   3e-133   Tarenaya hassleriana [spider flower]
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     407   3e-133   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             409   4e-133   Phaseolus vulgaris [French bean]
dbj|BAC77531.1|  plasma membrane H+-ATPase                              408   6e-133   Sesbania rostrata
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          408   6e-133   
gb|AAA34099.1|  plasma membrane H+ ATPase                               390   7e-133   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KJB53771.1|  hypothetical protein B456_009G004200                    404   8e-133   Gossypium raimondii
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          408   8e-133   Medicago truncatula
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 406   9e-133   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   400   9e-133   Citrus sinensis [apfelsine]
gb|AAB84202.2|  plasma membrane proton ATPase                           407   1e-132   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    407   2e-132   Tarenaya hassleriana [spider flower]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    407   2e-132   Tarenaya hassleriana [spider flower]
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             405   2e-132   
gb|KJB22047.1|  hypothetical protein B456_004G027300                    405   2e-132   Gossypium raimondii
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     390   2e-132   Camelina sativa [gold-of-pleasure]
dbj|BAH56991.1|  AT4G30190                                              403   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094202.1|  Plasma membrane ATPase 4                           407   3e-132   Morus notabilis
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 405   4e-132   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 406   5e-132   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                405   7e-132   Nicotiana sylvestris
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                405   7e-132   Nicotiana tomentosiformis
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    405   8e-132   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             405   8e-132   Citrus clementina [clementine]
gb|KJB22048.1|  hypothetical protein B456_004G027300                    405   1e-131   Gossypium raimondii
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   405   1e-131   Citrus sinensis [apfelsine]
emb|CDY69631.1|  BnaCnng64550D                                          392   1e-131   Brassica napus [oilseed rape]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           405   1e-131   Sesamum indicum [beniseed]
emb|CAN64375.1|  hypothetical protein VITISV_014422                     405   1e-131   Vitis vinifera
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                404   2e-131   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                404   2e-131   Vitis vinifera
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      404   2e-131   Solanum tuberosum [potatoes]
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         404   2e-131   Jatropha curcas
gb|AAB17186.1|  plasma membrane H+-ATPase                               404   2e-131   Solanum lycopersicum
gb|AAG01028.1|  plasma membrane H+-ATPase                               389   2e-131   Cucumis sativus [cucumbers]
gb|AAB41898.1|  H+-transporting ATPase                                  404   3e-131   Mesembryanthemum crystallinum
emb|CDY67606.1|  BnaAnng24780D                                          390   3e-131   Brassica napus [oilseed rape]
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    402   3e-131   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                404   3e-131   Prunus mume [ume]
ref|XP_007011593.1|  Plasma membrane ATPase 4 isoform 2                 396   3e-131   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           404   3e-131   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   401   3e-131   Citrus sinensis [apfelsine]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    404   3e-131   Glycine max [soybeans]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  404   4e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006382164.1|  H+-ATPase family protein                           404   4e-131   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     402   4e-131   Camelina sativa [gold-of-pleasure]
dbj|BAD16684.1|  plasma membrane H+-ATPase                              403   4e-131   Daucus carota [carrots]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                403   5e-131   Phoenix dactylifera
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           403   5e-131   Populus euphratica
dbj|BAD16688.1|  plasma membrane H+-ATPase                              403   6e-131   Daucus carota [carrots]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   401   6e-131   Citrus sinensis [apfelsine]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           403   6e-131   Elaeis guineensis
gb|KFK29576.1|  h(+)-atpase 2                                           403   7e-131   Arabis alpina [alpine rockcress]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             403   8e-131   Prunus persica
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             402   8e-131   Phaseolus vulgaris [French bean]
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             402   9e-131   Capsella rubella
ref|NP_194748.1|  H(+)-ATPase 2                                         402   9e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          402   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     402   1e-130   Camelina sativa [gold-of-pleasure]
dbj|BAA37150.1|  p-type H+-ATPase                                       402   1e-130   Vicia faba [broad bean]
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             402   1e-130   Eutrema salsugineum [saltwater cress]
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   401   1e-130   Citrus sinensis [apfelsine]
gb|EPS73574.1|  hypothetical protein M569_01174                         396   1e-130   Genlisea aurea
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          402   2e-130   Tarenaya hassleriana [spider flower]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           402   2e-130   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   400   2e-130   Citrus sinensis [apfelsine]
ref|NP_001190870.1|  H(+)-ATPase 2                                      402   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           402   2e-130   Glycine max [soybeans]
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    401   2e-130   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             401   2e-130   Elaeis guineensis
gb|AAA20600.1|  plasma-membrane H+ ATPase                               382   2e-130   Zea mays [maize]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  401   2e-130   Elaeis guineensis
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  401   2e-130   Nelumbo nucifera [Indian lotus]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          401   2e-130   Amborella trichopoda
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           401   3e-130   
gb|KHN15309.1|  Plasma membrane ATPase 4                                401   3e-130   Glycine soja [wild soybean]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             401   3e-130   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA20601.1|  plasma-membrane H+ ATPase                               382   3e-130   Zea mays [maize]
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    400   3e-130   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             401   3e-130   Citrus clementina [clementine]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             401   4e-130   Citrus sinensis [apfelsine]
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           401   4e-130   Cucumis melo [Oriental melon]
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          400   4e-130   Camelina sativa [gold-of-pleasure]
gb|AAY42950.1|  plasma membrane H+ ATPase                               401   4e-130   Lupinus albus
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    400   6e-130   Ricinus communis
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     381   6e-130   Camelina sativa [gold-of-pleasure]
gb|KJB65971.1|  hypothetical protein B456_010G123000                    400   6e-130   Gossypium raimondii
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             400   6e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    400   6e-130   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             400   6e-130   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                400   7e-130   Vitis vinifera
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             399   7e-130   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                399   7e-130   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           400   7e-130   
emb|CAB69823.1|  plasma membrane H+ ATPase                              400   7e-130   Prunus persica
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           400   7e-130   Cucumis melo [Oriental melon]
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    400   8e-130   Eucalyptus grandis [rose gum]
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    398   8e-130   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                400   8e-130   Eucalyptus grandis [rose gum]
ref|NP_179486.1|  H(+)-ATPase 1                                         400   9e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    400   9e-130   
emb|CDY14186.1|  BnaA08g13170D                                          399   9e-130   Brassica napus [oilseed rape]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          400   9e-130   Amborella trichopoda
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   400   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             400   1e-129   Elaeis guineensis
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                400   1e-129   Erythranthe guttata [common monkey flower]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           400   1e-129   Phoenix dactylifera
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    398   1e-129   
gb|KJB82762.1|  hypothetical protein B456_013G212200                    394   1e-129   Gossypium raimondii
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          399   1e-129   Brassica rapa
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          399   1e-129   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              399   1e-129   Daucus carota [carrots]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                399   1e-129   Erythranthe guttata [common monkey flower]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             399   2e-129   Phoenix dactylifera
gb|KJB55190.1|  hypothetical protein B456_009G068100                    399   2e-129   Gossypium raimondii
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         399   2e-129   Jatropha curcas
emb|CDY67153.1|  BnaAnng23670D                                          398   2e-129   Brassica napus [oilseed rape]
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     399   2e-129   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     395   2e-129   Camelina sativa [gold-of-pleasure]
gb|KJB55189.1|  hypothetical protein B456_009G068100                    399   2e-129   Gossypium raimondii
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 399   2e-129   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          399   2e-129   Brassica rapa
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     395   2e-129   Eucalyptus grandis [rose gum]
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    399   3e-129   Phoenix dactylifera
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   391   3e-129   Citrus sinensis [apfelsine]
ref|XP_007012006.1|  H(+)-ATPase 8                                      399   3e-129   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                399   3e-129   Cucumis melo [Oriental melon]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           399   3e-129   Elaeis guineensis
emb|CAN61424.1|  hypothetical protein VITISV_027272                     399   3e-129   Vitis vinifera
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   399   3e-129   Vicia faba [broad bean]
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    398   3e-129   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          398   3e-129   Brassica rapa
emb|CDY38294.1|  BnaA10g11420D                                          398   3e-129   Brassica napus [oilseed rape]
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    396   3e-129   
ref|NP_200545.1|  H(+)-ATPase 3                                         398   3e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   390   4e-129   Citrus sinensis [apfelsine]
emb|CBW30173.1|  Plasma membrane ATPase 4                               398   4e-129   Musa balbisiana [starchy banana]
ref|XP_010431653.1|  PREDICTED: ATPase 9, plasma membrane-type-like     389   4e-129   Camelina sativa [gold-of-pleasure]
emb|CBW30211.1|  Plasma membrane ATPase                                 398   4e-129   Musa balbisiana [starchy banana]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    399   4e-129   Phoenix dactylifera
gb|AAL09726.1|  AT5g57350/MJB24_16                                      398   4e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25913.1|  BnaC09g32850D                                          398   4e-129   Brassica napus [oilseed rape]
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          398   4e-129   Vitis vinifera
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           400   4e-129   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                398   4e-129   Erythranthe guttata [common monkey flower]
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     398   4e-129   Sesamum indicum [beniseed]
gb|KEH37844.1|  plasma membrane H+-ATPase                               397   5e-129   Medicago truncatula
dbj|BAD16687.1|  plasma membrane H+-ATPase                              398   5e-129   Daucus carota [carrots]
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     398   5e-129   Eucalyptus grandis [rose gum]
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    397   6e-129   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     398   6e-129   Tarenaya hassleriana [spider flower]
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    398   6e-129   Eucalyptus grandis [rose gum]
gb|ACL54575.1|  unknown                                                 398   6e-129   Zea mays [maize]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           398   6e-129   Pyrus x bretschneideri [bai li]
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     399   7e-129   Eucalyptus grandis [rose gum]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  397   7e-129   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     397   7e-129   Tarenaya hassleriana [spider flower]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        397   7e-129   Lilium longiflorum [Easter lily]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       397   7e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          397   7e-129   Sorghum bicolor [broomcorn]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           397   8e-129   
gb|ACE77057.1|  plasma membrane proton pump                             397   8e-129   Cucumis sativus [cucumbers]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    397   9e-129   Populus euphratica
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             396   9e-129   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          397   9e-129   Camelina sativa [gold-of-pleasure]
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     397   1e-128   Cicer arietinum [garbanzo]
emb|CDY47940.1|  BnaA02g08160D                                          397   1e-128   Brassica napus [oilseed rape]
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    397   1e-128   
emb|CDX87330.1|  BnaA07g35430D                                          395   1e-128   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    396   1e-128   Eucalyptus grandis [rose gum]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                397   1e-128   Erythranthe guttata [common monkey flower]
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          397   1e-128   Sesamum indicum [beniseed]
emb|CDY39956.1|  BnaC06g40340D                                          395   1e-128   Brassica napus [oilseed rape]
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    396   1e-128   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    397   1e-128   Cicer arietinum [garbanzo]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             397   1e-128   Capsella rubella
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     397   1e-128   Pyrus x bretschneideri [bai li]
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          397   1e-128   
emb|CDX72217.1|  BnaC07g42390D                                          396   1e-128   
emb|CDY51650.1|  BnaAnng10900D                                          396   1e-128   Brassica napus [oilseed rape]
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           397   2e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    397   2e-128   Glycine max [soybeans]
gb|KHN16462.1|  Plasma membrane ATPase 4                                397   2e-128   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      397   2e-128   Glycine max [soybeans]
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                397   2e-128   Elaeis guineensis
gb|KEH32174.1|  plasma membrane H+-ATPase                               396   2e-128   Medicago truncatula
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     396   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  397   2e-128   Phoenix dactylifera
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     395   2e-128   
gb|KJB82763.1|  hypothetical protein B456_013G212200                    396   2e-128   Gossypium raimondii
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       397   2e-128   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     396   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             397   2e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       397   2e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    396   2e-128   Pyrus x bretschneideri [bai li]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           396   2e-128   Malus domestica [apple tree]
gb|EPS65442.1|  hypothetical protein M569_09334                         396   2e-128   Genlisea aurea
dbj|BAO45902.1|  plasma membrane H+-ATPase                              396   2e-128   Acacia mangium
gb|AHK23067.1|  plasma membrane ATPase 4                                397   2e-128   Fagopyrum tataricum [Kangra buckwheat]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    396   2e-128   Fragaria vesca subsp. vesca
gb|AAK31799.2|  plasma membrane H+ ATPase                               396   2e-128   Lilium longiflorum [Easter lily]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             396   2e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                396   3e-128   Eucalyptus grandis [rose gum]
emb|CDY51651.1|  BnaAnng10910D                                          395   3e-128   Brassica napus [oilseed rape]
gb|AEO22063.1|  plasma membrane H+-ATPase                               396   3e-128   Aeluropus littoralis
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                396   3e-128   Fragaria vesca subsp. vesca
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           396   3e-128   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     396   3e-128   Brassica rapa
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                396   3e-128   Sesamum indicum [beniseed]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     396   3e-128   Morus notabilis
emb|CDX67957.1|  BnaA07g19970D                                          394   3e-128   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           396   3e-128   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     395   4e-128   Sesamum indicum [beniseed]
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    394   4e-128   Tarenaya hassleriana [spider flower]
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             395   4e-128   Capsella rubella
gb|EPS63902.1|  hypothetical protein M569_10880                         380   4e-128   Genlisea aurea
emb|CDX72218.1|  BnaC07g42400D                                          394   4e-128   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     395   4e-128   Camelina sativa [gold-of-pleasure]
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     395   4e-128   Sesamum indicum [beniseed]
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          395   4e-128   Camelina sativa [gold-of-pleasure]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           395   4e-128   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                395   4e-128   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     394   4e-128   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    396   5e-128   Fragaria vesca subsp. vesca
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       395   5e-128   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             395   5e-128   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    395   5e-128   Brassica rapa
ref|XP_003594954.1|  Plasma membrane ATPase                             395   6e-128   Medicago truncatula
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       397   6e-128   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    395   6e-128   Arabis alpina [alpine rockcress]
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             395   7e-128   Setaria italica
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     395   7e-128   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          395   7e-128   Cucumis melo [Oriental melon]
gb|AFM52333.1|  plasma membrane H+-ATPase                               395   8e-128   Malus baccata var. xiaojinensis
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    395   8e-128   Brassica rapa
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          395   8e-128   Prunus mume [ume]
gb|AEQ27822.1|  PM H+-ATPase R                                          395   9e-128   Eichhornia crassipes
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       395   9e-128   
gb|AAY42948.1|  plasma membrane H+ ATPase                               395   9e-128   Lupinus albus
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    394   9e-128   Tarenaya hassleriana [spider flower]
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     394   9e-128   Cucumis sativus [cucumbers]
gb|EPS57651.1|  hypothetical protein M569_17165                         394   1e-127   Genlisea aurea
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     394   1e-127   Cucumis melo [Oriental melon]
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         394   1e-127   Tarenaya hassleriana [spider flower]
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             394   2e-127   Eutrema salsugineum [saltwater cress]
ref|XP_010111939.1|  Plasma membrane ATPase 4                           394   2e-127   
gb|KFK27283.1|  h(+)-atpase 3                                           394   2e-127   Arabis alpina [alpine rockcress]
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    392   2e-127   Glycine max [soybeans]
dbj|BAF03589.1|  P-type H+-ATPase                                       394   2e-127   Zostera marina
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     394   2e-127   Pyrus x bretschneideri [bai li]
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    394   2e-127   Arabis alpina [alpine rockcress]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    394   2e-127   Nelumbo nucifera [Indian lotus]
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             394   2e-127   Elaeis guineensis
gb|AAA34052.1|  H+-translocating ATPase                                 394   2e-127   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                394   2e-127   Nicotiana sylvestris
ref|NP_001182902.1|  uncharacterized protein LOC100501185               381   2e-127   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             394   2e-127   Phaseolus vulgaris [French bean]
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              390   2e-127   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          394   2e-127   Brassica rapa
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    391   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          394   2e-127   Amborella trichopoda
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     394   2e-127   Pyrus x bretschneideri [bai li]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    394   2e-127   Nelumbo nucifera [Indian lotus]
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          394   2e-127   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          393   3e-127   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          393   3e-127   Tarenaya hassleriana [spider flower]
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         394   3e-127   Jatropha curcas
gb|ABA18112.1|  putative plasma membrane ATPase                         393   3e-127   Arabidopsis arenosa
ref|XP_007023380.1|  H(+)-ATPase 9                                      393   3e-127   
ref|NP_001234775.1|  plasma membrane ATPase 1                           394   3e-127   Solanum lycopersicum
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                393   3e-127   Erythranthe guttata [common monkey flower]
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               386   3e-127   Erythranthe guttata [common monkey flower]
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                393   4e-127   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             393   4e-127   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             391   4e-127   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     393   5e-127   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    393   5e-127   
gb|KEH24965.1|  plasma membrane H+-ATPase                               393   5e-127   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          393   5e-127   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           393   5e-127   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           393   5e-127   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          393   5e-127   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             393   5e-127   
gb|EPS63245.1|  hypothetical protein M569_11541                         392   6e-127   
ref|NP_178762.1|  H(+)-ATPase 6                                         392   6e-127   
gb|KEH35952.1|  plasma membrane H+-ATPase                               392   6e-127   
ref|NP_001059093.1|  Os07g0191200                                       393   6e-127   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          392   6e-127   
ref|NP_001234477.1|  plasma membrane H+-ATPase                          392   6e-127   
gb|ABW25091.1|  plasma membrane proton pump                             392   6e-127   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           392   6e-127   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           392   7e-127   
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    392   8e-127   
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    392   8e-127   
gb|KEH24964.1|  plasma membrane H+-ATPase                               392   8e-127   
gb|EPS66977.1|  hypothetical protein M569_07799                         391   8e-127   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           392   9e-127   
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                392   9e-127   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           392   9e-127   
gb|ABA18090.1|  putative plasma membrane ATPase                         392   9e-127   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    391   9e-127   
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           392   1e-126   
gb|EMS46830.1|  ATPase 9, plasma membrane-type                          384   1e-126   
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     392   1e-126   
dbj|BAG94605.1|  unnamed protein product                                391   1e-126   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    392   1e-126   
ref|NP_189850.1|  H(+)-ATPase 8                                         392   1e-126   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    392   1e-126   
emb|CDX79363.1|  BnaC06g19400D                                          390   1e-126   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             388   1e-126   
gb|AFC88896.1|  plasma membrane H+-ATPase                               392   1e-126   
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  390   1e-126   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    392   1e-126   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     392   1e-126   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    392   1e-126   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     389   1e-126   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             392   1e-126   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     392   1e-126   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                392   1e-126   
ref|XP_002307856.1|  ATPase 6 family protein                            391   1e-126   
ref|XP_011468858.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    392   1e-126   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          392   1e-126   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    392   1e-126   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    392   2e-126   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             391   2e-126   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         392   2e-126   
ref|NP_001067382.1|  Os12g0638700                                       392   2e-126   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    391   2e-126   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           392   2e-126   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    391   2e-126   
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    390   2e-126   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             391   2e-126   
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     392   2e-126   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     391   2e-126   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    391   2e-126   
emb|CAC29435.1|  P-type H+-ATPase                                       391   2e-126   
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    392   2e-126   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     391   2e-126   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    391   2e-126   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    391   2e-126   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         391   2e-126   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         391   2e-126   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     391   2e-126   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                391   2e-126   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          391   2e-126   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           391   2e-126   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     390   2e-126   
gb|KEH31901.1|  plasma membrane H+-ATPase                               391   2e-126   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           391   2e-126   
gb|KEH39623.1|  plasma membrane H+-ATPase                               391   3e-126   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           391   3e-126   
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     390   3e-126   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    390   3e-126   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    391   3e-126   
gb|KJB19307.1|  hypothetical protein B456_003G094300                    389   3e-126   
gb|AAY42949.1|  plasma membrane H+ ATPase                               390   3e-126   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          391   3e-126   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    391   3e-126   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  390   3e-126   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                391   3e-126   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             390   3e-126   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             390   3e-126   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                391   3e-126   
ref|NP_001105360.1|  membrane H(+)-ATPase1                              390   3e-126   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    390   3e-126   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              390   3e-126   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                390   3e-126   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   391   3e-126   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          390   4e-126   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           390   4e-126   
gb|KJB56561.1|  hypothetical protein B456_009G125200                    390   4e-126   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    390   4e-126   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             390   4e-126   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              390   4e-126   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    391   4e-126   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             390   4e-126   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    390   4e-126   
emb|CDO98206.1|  unnamed protein product                                390   4e-126   
ref|NP_001054118.1|  Os04g0656100                                       390   4e-126   
ref|NP_001185450.1|  H(+)-ATPase 9                                      390   4e-126   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             390   4e-126   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          390   4e-126   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          390   4e-126   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     390   4e-126   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           390   4e-126   
emb|CAD29313.1|  plasma membrane H+-ATPase                              390   4e-126   
gb|AAR32129.2|  proton P-ATPase                                         390   4e-126   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     390   4e-126   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             390   4e-126   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          390   5e-126   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           390   5e-126   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    390   5e-126   
ref|NP_178181.1|  H(+)-ATPase 9                                         390   5e-126   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    390   5e-126   
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         390   5e-126   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    390   5e-126   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     390   5e-126   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     390   5e-126   
gb|KJB19303.1|  hypothetical protein B456_003G094300                    389   5e-126   
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     390   6e-126   
emb|CDX93092.1|  BnaA03g38140D                                          390   6e-126   
emb|CDY50939.1|  BnaC03g74390D                                          390   6e-126   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             390   6e-126   
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      390   6e-126   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    390   7e-126   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             387   7e-126   
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           390   7e-126   
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          390   7e-126   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          390   7e-126   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             390   7e-126   
gb|AAV44084.1|  putative plasma membrane H+ ATPase                      389   7e-126   
gb|KEH39757.1|  plasma membrane H+-ATPase                               386   7e-126   
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    390   7e-126   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    389   8e-126   
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like           389   9e-126   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           389   9e-126   
ref|XP_002324564.1|  ATPase 6 family protein                            389   9e-126   
gb|KJB54894.1|  hypothetical protein B456_009G053500                    389   9e-126   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           389   1e-125   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           389   1e-125   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          389   1e-125   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           389   1e-125   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    389   1e-125   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     389   1e-125   
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                          389   1e-125   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    390   1e-125   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             389   1e-125   
gb|KJB19302.1|  hypothetical protein B456_003G094300                    389   1e-125   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         389   1e-125   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         389   1e-125   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     389   1e-125   
gb|KHN13245.1|  Plasma membrane ATPase 1                                389   1e-125   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    389   1e-125   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             389   2e-125   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     389   2e-125   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    389   2e-125   
emb|CBI35956.3|  unnamed protein product                                389   2e-125   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     389   2e-125   
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           390   2e-125   
gb|EEC78976.1|  hypothetical protein OsI_19456                          389   2e-125   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    389   2e-125   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             389   2e-125   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             389   2e-125   
gb|AFW76177.1|  hypothetical protein ZEAMMB73_418989                    388   2e-125   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    389   2e-125   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          388   2e-125   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               388   3e-125   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             388   3e-125   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    389   3e-125   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          388   3e-125   
gb|KJB33644.1|  hypothetical protein B456_006G023600                    384   3e-125   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           388   3e-125   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                388   3e-125   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           388   3e-125   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             388   3e-125   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     388   3e-125   
ref|XP_002309321.1|  ATPase 6 family protein                            388   3e-125   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    389   3e-125   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    388   4e-125   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          389   4e-125   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         388   4e-125   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          387   4e-125   
gb|KEH39758.1|  plasma membrane H+-ATPase                               388   4e-125   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    388   4e-125   
gb|KJB19305.1|  hypothetical protein B456_003G094300                    388   4e-125   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    388   4e-125   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    388   5e-125   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    387   5e-125   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    387   5e-125   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           387   5e-125   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                387   5e-125   
emb|CDP14278.1|  unnamed protein product                                394   6e-125   
gb|AEQ27823.1|  PM H+-ATPase L                                          387   6e-125   
gb|KJB19306.1|  hypothetical protein B456_003G094300                    388   6e-125   
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             387   7e-125   
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     388   7e-125   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         387   7e-125   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             387   7e-125   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             387   7e-125   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     387   7e-125   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             387   7e-125   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    382   8e-125   
gb|KHN01287.1|  Plasma membrane ATPase 4                                385   8e-125   
gb|KHN38020.1|  Plasma membrane ATPase                                  385   8e-125   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          387   8e-125   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          387   8e-125   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          392   9e-125   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     387   9e-125   
emb|CAC29436.1|  P-type H+-ATPase                                       387   1e-124   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             387   1e-124   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    387   1e-124   
gb|KEH39753.1|  plasma membrane H+-ATPase                               387   1e-124   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             387   1e-124   



>emb|CAM31935.1| ATPase 3 [Arabidopsis thaliana]
 emb|CAM31936.1| ATPase 3 [Arabidopsis thaliana]
Length=232

 Score =   392 bits (1006),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  11   VLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTRGPG  190
            VLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLP T+GPG
Sbjct  1    VLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPATKGPG  60

Query  191  EEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAV  370
            EEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAV
Sbjct  61   EEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAV  120

Query  371  GMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKR  550
            G+  EI+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAITKR
Sbjct  121  GIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITKR  180

Query  551  MTAIEEMAGMDVLCSDKTGTLT  616
            MTAIEEMAGMDVLCSDKTGTLT
Sbjct  181  MTAIEEMAGMDVLCSDKTGTLT  202



>ref|XP_006848754.1| hypothetical protein AMTR_s00026p00031910 [Amborella trichopoda]
 gb|ERN10335.1| hypothetical protein AMTR_s00026p00031910 [Amborella trichopoda]
Length=368

 Score =   396 bits (1017),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGD++SIKLGDI+PADARLL GD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVL AIGNFCICS
Sbjct  127  HPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLAAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  187  IALGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSKQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   413 bits (1062),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  137  KTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   413 bits (1061),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  137  KTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 204/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  137  KTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  136  KTKVLRDGQWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  136  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  139  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  198

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  199  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  258

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  259  IAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  318

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  319  TKRMTAIEEMAGMDVLCSDKTGTLT  343



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   407 bits (1046),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  67   KTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  127  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLP T+
Sbjct  137  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPATK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAIGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   408 bits (1049),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPV +
Sbjct  136  KTKVLRDGQWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVNK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   408 bits (1049),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  136  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=388

 Score =   390 bits (1003),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLRDG+W E++A++LVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  GPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL+QQGAI
Sbjct  255  IAVGMIIEIIVMYPIQHRKYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLAQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>gb|KJB53771.1| hypothetical protein B456_009G004200 [Gossypium raimondii]
Length=825

 Score =   404 bits (1039),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  7    KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  66

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  67   NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  126

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  127  IAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  186

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  187  TKRMTAIEEMAGMDVLCSDKTGTLT  211



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   408 bits (1048),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  136  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   406 bits (1043),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  67   KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   400 bits (1027),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  132  KTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  192  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVTR
Sbjct  132  KTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTR  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  192  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSE+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  67   KTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>gb|KJB22047.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=885

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  67   KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_010496530.1| PREDICTED: ATPase 8, plasma membrane-type-like, partial [Camelina 
sativa]
Length=400

 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLL+GD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>dbj|BAH56991.1| AT4G30190 [Arabidopsis thaliana]
Length=816

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  7    KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  66

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  67   HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  126

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  127  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  186

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  187  TKRMTAIEEMAGMDVLCSDKTGTLT  211



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   407 bits (1045),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   405 bits (1042),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   406 bits (1043),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   405 bits (1041),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   405 bits (1041),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSE+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSE+EA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  135  KTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>emb|CDY69631.1| BnaCnng64550D, partial [Brassica napus]
Length=524

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+ASILVPGD++S+KLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  135  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGMLAEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  HPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  HPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|AAG01028.1| plasma membrane H+-ATPase [Cucumis sativus]
Length=453

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVS+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  72   KTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  131

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLTAIGNFCICS
Sbjct  132  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLTAIGNFCICS  191

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EII M PIQHRKYRDGIDNL VLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  192  IALGMLIEIIGMCPIQHRKYRDGIDNLFVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  251

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  252  TKRMTAIEEMAGMDVLCSDKTGTLT  276



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEASILVPGDI+SIKLGDI+PADARLLEGDALK+DQSALTGES+PVT+
Sbjct  137  KTKVLRDGRWGEQEASILVPGDIISIKLGDIVPADARLLEGDALKIDQSALTGESMPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PGEEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  197  NPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAIGMLIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>emb|CDY67606.1| BnaAnng24780D, partial [Brassica napus]
Length=507

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+ASILVPGD++S+KLGDI+PADARLL+GD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLQGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE++A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_007011593.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY29212.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=674

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KT+VLRDG+W+EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTRVLRDGKWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD L VDQ+ALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  257  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   404 bits (1037),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   404 bits (1037),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   402 bits (1034),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  132  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAVGMLVELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   403 bits (1036),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   403 bits (1036),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+ AE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIFAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  132  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   403 bits (1035),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   403 bits (1035),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE++A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   402 bits (1034),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD L VDQ+ALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  257  IAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   402 bits (1034),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   402 bits (1034),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            +TKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  136  ETKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  SPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAM TVLSVT AIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMSTVLSVTTAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
               +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  ESYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLTEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICS
Sbjct  191  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDGRWSEQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKILRDGRWSEQEAQILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PGEEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  196  NPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  256  IAVGMLIEVVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   400 bits (1027),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD L VDQ+ALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GMLAEIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  257  IAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVS+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSE+EA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>gb|AAA20600.1| plasma-membrane H+ ATPase, partial [Zea mays]
Length=347

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLR+GRW+E+E++ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  15   KAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  74

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ V+SGSTCKQGEIEAVVI TGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  75   GPGDGVYSGSTCKQGEIEAVVIXTGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  134

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMY IQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG+HRL+QQGAI
Sbjct  135  IAVGMLVELVVMYAIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGAHRLAQQGAI  194

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  195  TKRMTAIEEMAGMDVLCSDKTGTLT  219



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  SPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  132  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  SPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVS+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD L VDQ+ALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GMLAEIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  257  IAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAIGMIVEIIVMYPIQHRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|AAA20601.1| plasma-membrane H+ ATPase, partial [Zea mays]
Length=347

 Score =   382 bits (982),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLR+GRW+E+E++ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  15   KAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  74

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  75   GPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  134

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMY IQHR YR GIDNLLVLLIGGIPI MPTVLSVTMAIG+HRL+QQGAI
Sbjct  135  IAVGMLVELVVMYAIQHRAYRPGIDNLLVLLIGGIPIXMPTVLSVTMAIGAHRLAQQGAI  194

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  195  TKRMTAIEEMAGMDVLCSDKTGTLT  219



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGES+PV +
Sbjct  113  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESIPVNK  172

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  173  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  232

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  233  IAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  292

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  293  TKRMTAIEEMAGMDVLCSDKTGTLT  317



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   401 bits (1030),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   401 bits (1030),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++AEII+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   401 bits (1030),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   400 bits (1029),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  252  IAVGIVIELIVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   401 bits (1030),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W E+EA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCI S
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCIVS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IAIGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010430916.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=334

 Score =   381 bits (979),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLL+GD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKT  604
            TKRMTAIEEMAGMDVLCSDKT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKT  334



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDN+LVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIVELIVMYPIQHRKYRDGIDNMLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSE++A+ILVPGDI+SIKLGDI+PADARLL+GD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGES+PV +
Sbjct  138  KTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESIPVNK  197

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  198  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  257

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  258  IAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  317

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  318  TKRMTAIEEMAGMDVLCSDKTGTLT  342



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   400 bits (1028),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQEASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQEASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P EEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   399 bits (1024),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E++A+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  67   KTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  187  IAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   399 bits (1024),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE++A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  127  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IAIGMVIEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  142  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  201

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  202  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  261

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA GML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  262  IAFGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  321

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  322  TKRMTAIEEMAGMDVLCSDKTGTLT  346



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQEASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQEASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P EEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   400 bits (1027),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA++LVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  117  KTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  176

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  177  NPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  236

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  237  IAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  296

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  297  TKRMTAIEEMAGMDVLCSDKTGTLT  321



>ref|XP_009410182.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   398 bits (1023),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGDI+SIKLGDIIPADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  67   KTKVLRDGKWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQAALTGESLPVTR  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  127  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VGML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  187  IVVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   400 bits (1028),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA++LVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   400 bits (1027),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+  EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   400 bits (1028),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   399 bits (1026),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPAD RLLEGD LKVDQSALTGESLPVT+
Sbjct  122  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADGRLLEGDPLKVDQSALTGESLPVTK  181

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  182  HPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  241

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  242  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  301

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  302  TKRMTAIEEMAGMDVLCSDKTGTLT  326



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   400 bits (1027),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGD++SIKLGDI+PADARLL GD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PGEEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  HPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+  EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW E+EA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  SPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IFVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSE+EA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  136  KTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMIVEIIVMYPIQHRIYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009410181.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGDI+SIKLGDIIPADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  67   KTKVLRDGKWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQAALTGESLPVTR  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  127  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VGML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  187  IVVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPAD RLLEGD LKVDQSALTGESLPVT+
Sbjct  130  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADGRLLEGDPLKVDQSALTGESLPVTK  189

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  190  HPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  249

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  250  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  309

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  310  TKRMTAIEEMAGMDVLCSDKTGTLT  334



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  132  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  192  HPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  252  IAVGMLIEVIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  132  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  HPYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P  EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  194  HPYNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLAEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG WSEQ+ASILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPV++
Sbjct  136  KTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVSK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  EIIVM+PIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIIEMIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQ+RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIVELIVMYPIQNRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>emb|CDY67153.1| BnaAnng23670D [Brassica napus]
Length=918

 Score =   398 bits (1023),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPAD RLLEGD LKVDQSALTGESLPVTR
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADCRLLEGDPLKVDQSALTGESLPVTR  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  252  IAVGIVIELIVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_010468541.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=797

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLP T+
Sbjct  134  KTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML E+I+MYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIIEMIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009120261.1| PREDICTED: ATPase 3, plasma membrane-type [Brassica rapa]
Length=952

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  135  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCI S
Sbjct  195  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCIIS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  255  IAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A++LVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+  E+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLP T+
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLRDGRW+EQ+ASILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAIGNFCICS
Sbjct  195  GPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+A+ILVPGD++S+KLGDIIPADARLLEGDALK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWGEQDAAILVPGDVISVKLGDIIPADARLLEGDALKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+ASILVPGD++S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  256  IAIGMLIEILVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VGML EI++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IGVGMLIEILIMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   399 bits (1025),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  149  KTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  208

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  209  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  268

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQ RKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  269  IAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  328

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  329  TKRMTAIEEMAGMDVLCSDKTGTLT  353



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQ+ALTGESLPVTR
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALTGESLPVTR  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TN VGHFQ VL +IGNFCICS
Sbjct  193  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQMVLKSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  253  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGD+VSIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_009128001.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
 emb|CDY28167.1| BnaA01g06820D [Brassica napus]
Length=948

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPAD RLLEGD LKVDQSALTGESLPVTR
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADCRLLEGDPLKVDQSALTGESLPVTR  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  251  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>emb|CDY38294.1| BnaA10g11420D [Brassica napus]
Length=952

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  135  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCI S
Sbjct  195  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCIIS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  255  IAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_004508384.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=865

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGD++SIKLGDI+PADARLLEGDALK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDLISIKLGDIVPADARLLEGDALKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  254  IAVGMLIEIVVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  EI+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  252  IAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score =   390 bits (1003),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLRDGRW+EQ+ASILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAIGNFCICS
Sbjct  195  GPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGMIVEIIVMYPIQDREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010431653.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=624

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+W+EQEA+ILVPGDI+SIKLGDIIPAD RLL+GD LKVDQSALTGESLPVT+
Sbjct  136  KTKLLRDGKWNEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQ GHFQKVLTAIGNFCICS
Sbjct  196  NPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   399 bits (1025),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLP T+
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  EI+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  252  IAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>emb|CDY25913.1| BnaC09g32850D [Brassica napus]
Length=952

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  135  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCI S
Sbjct  195  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCIIS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  255  IAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQ RKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  254  IAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   400 bits (1028),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  220  KTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  279

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  280  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  339

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  340  IAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  399

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  400  TKRMTAIEEMAGMDVLCSDKTGTLT  424



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  132  KTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  192  HPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IAVGMLIEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   398 bits (1023),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESL VT+
Sbjct  134  KTKVLRDGKWSEQEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  YPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|KEH37844.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=903

 Score =   397 bits (1019),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  134  KTKVLRDGKWSEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGQEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQ+R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMVIEIIVMYPIQNRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   398 bits (1022),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  131  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAIGNFCICS
Sbjct  191  NPHDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  251  IAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   398 bits (1022),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   397 bits (1020),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGD++SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICS
Sbjct  191  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAVGMLIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGD+VSIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGDALKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VG+L EIIVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE++A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAIGMVIEIIVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   399 bits (1024),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGDALKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VG+L EIIVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010539792.1| PREDICTED: ATPase 3, plasma membrane-type-like [Tarenaya hassleriana]
Length=918

 Score =   397 bits (1019),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLRDG+WSE+EA+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KAKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PGEE+FSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  SPGEEIFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMY IQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IALGMLVEIVVMYAIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQEACILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  197  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EI+VMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  257  IAVGMFVEIVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  138  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  197

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  198  MPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  257

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  258  IAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  317

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  318  TKRMTAIEEMAGMDVLCSDKTGTLT  342



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LKVDQSALTGESLPVTR
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTR  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IAVGIIVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   397 bits (1021),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+ASILVPGD++S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  256  IAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   397 bits (1021),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQ+ASILVPGD++S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  256  IAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   397 bits (1021),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E++A+ILVPGDI+S+KLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWNEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_006401213.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
 gb|ESQ42666.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
Length=917

 Score =   396 bits (1018),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = +2

Query  8    KVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTRGP  187
             +LRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+GP
Sbjct  102  NLLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATKGP  161

Query  188  GEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA  367
            GEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA
Sbjct  162  GEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA  221

Query  368  VGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITK  547
            VG+L E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAITK
Sbjct  222  VGILIELLVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITK  281

Query  548  RMTAIEEMAGMDVLCSDKTGTLT  616
            RMTAIEEMAGMDVLCSDKTGTLT
Sbjct  282  RMTAIEEMAGMDVLCSDKTGTLT  304



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   397 bits (1020),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  E++VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  252  IAVGIFIELVVMYPIQGRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_004488894.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cicer arietinum]
Length=947

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVTR
Sbjct  134  KTKVLRDGKWSEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTR  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGSEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EIIVMYPIQ+R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAIGMLVEIIVMYPIQNRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>emb|CDY47940.1| BnaA02g08160D [Brassica napus]
 emb|CDY42259.1| BnaC02g11560D [Brassica napus]
Length=951

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/205 (95%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLP T+
Sbjct  134  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCI S
Sbjct  194  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCIIS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  254  IAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  133  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTR  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>emb|CDX87330.1| BnaA07g35430D [Brassica napus]
Length=861

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSEQEA+ILVPGDI+SIKLGDI+PAD RLLEGD LK+DQSALTGESLPVT+
Sbjct  103  KTKLLRDGKWSEQEAAILVPGDIISIKLGDIVPADGRLLEGDPLKIDQSALTGESLPVTK  162

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQ GHFQKVLTAIGNFCICS
Sbjct  163  NPGQEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTAIGNFCICS  222

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  223  IAIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  282

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  283  TKRMTAIEEMAGMDVLCSDKTGTLT  307



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGD++SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
               +EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NSYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLAEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESL VT+
Sbjct  134  KTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>emb|CDY39956.1| BnaC06g40340D [Brassica napus]
Length=861

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSEQEA+ILVPGDI+SIKLGDI+PAD RLLEGD LK+DQSALTGESLPVT+
Sbjct  103  KTKLLRDGKWSEQEAAILVPGDIISIKLGDIVPADGRLLEGDPLKIDQSALTGESLPVTK  162

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQ GHFQKVLTAIGNFCICS
Sbjct  163  NPGQEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTAIGNFCICS  222

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  223  IAIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  282

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  283  TKRMTAIEEMAGMDVLCSDKTGTLT  307



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGD++SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  NPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  255  IAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_004508383.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=949

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGD++SIKLGDI+PADARLLEGDALK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWSEQEAAILVPGDLISIKLGDIVPADARLLEGDALKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  254  IAVGMLIEIVVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEASILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLP T+
Sbjct  132  KTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPATK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  192  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  E++VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LS+QGAI
Sbjct  252  IAVGLAIELVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSEQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  133  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTR  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  133  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTR  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>emb|CDX72217.1| BnaC07g42390D [Brassica napus]
Length=910

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  130  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  189

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  190  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  249

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  250  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  309

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEE+AGMDVLCSDKTGTLT
Sbjct  310  TKRMTAIEELAGMDVLCSDKTGTLT  334



>emb|CDY51650.1| BnaAnng10900D [Brassica napus]
Length=910

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  130  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  189

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  190  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  249

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  250  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  309

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEE+AGMDVLCSDKTGTLT
Sbjct  310  TKRMTAIEELAGMDVLCSDKTGTLT  334



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLL+GD LK+DQSALTGESLPVTR
Sbjct  134  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTR  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  254  IAVGMAIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDIIPADARLLEGDAL VDQSALTGESLPVT+
Sbjct  133  KTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P EEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDIIPADARLLEGDAL VDQSALTGESLPVT+
Sbjct  133  KTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P EEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDIIPADARLLEGDAL VDQSALTGESLPVT+
Sbjct  133  KTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P EEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLL+GD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IGLGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|KEH32174.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=948

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGD+VSIKLGDI+PADARLLEGDALK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWTEQEAAILVPGDLVSIKLGDIVPADARLLEGDALKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLIEIIVMYPIQQRSYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/205 (94%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLG IIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIISIKLGVIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  191  YPGNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  251  IAVGMVIEIIVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+E+EA+ILVPGDI+SIKLGDIIPADARLL+GD LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008776221.1| PREDICTED: ATPase 8, plasma membrane-type-like [Phoenix dactylifera]
Length=887

 Score =   395 bits (1014),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW E+EA++LVPGDI+SIKLGDIIPADARLL+GD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGRWLEEEAAMLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  127  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I VGML EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  187  IGVGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI++IKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  138  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  197

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  198  MPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  257

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  258  IAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  317

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  318  TKRMTAIEEMAGMDVLCSDKTGTLT  342



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  NPGNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI++MYP+QHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMLIEIVIMYPVQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRD +WSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  139  KTKVLRDAKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  198

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  199  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  258

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  259  IAVGMLIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  318

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  319  TKRMTAIEEMAGMDVLCSDKTGTLT  343



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  164  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  223

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  224  MPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  283

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  284  IAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  343

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  344  TKRMTAIEEMAGMDVLCSDKTGTLT  368



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVTR
Sbjct  133  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTR  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  197  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVT+AIGSHRLSQQGAI
Sbjct  257  IAIGMLIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTIAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEE+AGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEELAGMDVLCSDKTGTLT  341



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGD+LKVDQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDSLKVDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
               +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  DAHDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGMLTEILVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E+EA+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWNEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+E+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML EIIVMYPIQ RKYRDG++NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  256  IAVGMLTEIIVMYPIQRRKYRDGVENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KTKVLRDGRWSEQDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLV+STNQVGHFQKVLTAIGNFCICS
Sbjct  195  GPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVNSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM  E+IVMYP QHRKYR GIDNLLVLLIGGIPIAMPTV+SVTMAIGSHRLSQQGAI
Sbjct  255  IAIGMAIEVIVMYPTQHRKYRSGIDNLLVLLIGGIPIAMPTVMSVTMAIGSHRLSQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESL VT+
Sbjct  137  KTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLAVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  197  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQIVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML E++VMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  254  IALGMLVEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW E++A+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWMEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMY IQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  256  IAVGMMVEIVVMYAIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+A++LVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+  E+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>emb|CDY51651.1| BnaAnng10910D [Brassica napus]
Length=899

 Score =   395 bits (1014),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  119  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  178

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  179  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  238

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  239  IAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  298

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  299  TKRMTAIEEMAGMDVLCSDKTGTLT  323



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGDI+S+KLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  137  KTKVLRDGKWSEEEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICS
Sbjct  197  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  257  IAIGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+E++A+ILVPGDI+S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  254  IAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009137895.1| PREDICTED: ATPase 2, plasma membrane-type-like [Brassica rapa]
Length=947

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  130  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  189

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  190  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  249

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  250  IAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  309

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEE+AGMDVLCSDKTGTLT
Sbjct  310  TKRMTAIEELAGMDVLCSDKTGTLT  334



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            K KVLRDGRWSE+EASILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  135  KAKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  194

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+ ++SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  195  GPGDGIYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  254

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EIIVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL+QQGAI
Sbjct  255  IAVGMVIEIIVMYPIQHREYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLAQQGAI  314

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  315  TKRMTAIEEMAGMDVLCSDKTGTLT  339



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGD++SIKLGDI+PAD+RLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADSRLLEGDLLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  253  IALGMVIEIIVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>emb|CDX67957.1| BnaA07g19970D [Brassica napus]
Length=895

 Score =   394 bits (1013),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTK+LRDG+WSEQEA+ILVPGDI+SIKLGDI+PAD RLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKLLRDGKWSEQEAAILVPGDIISIKLGDIVPADGRLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQ GHFQKVLTAIGNFCICS
Sbjct  196  NPGQEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAIGMVIEIVVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRWSEQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L EIIVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESL VT+
Sbjct  134  KTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ+VLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQQVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   394 bits (1012),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  67   KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  126

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  127  MPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  186

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML E++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  187  IALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  246

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  247  TKRMTAIEEMAGMDVLCSDKTGTLT  271



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLP T+
Sbjct  134  KTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML E+I+MYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>gb|EPS63902.1| hypothetical protein M569_10880, partial [Genlisea aurea]
Length=446

 Score =   380 bits (977),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KT+VLRDG+WSEQEA+ILVPGDIVSIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  144  KTRVLRDGKWSEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  203

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEA+VIATG++TFFGKAAHLVDST  VGHFQ+VLTAIGNFCICS
Sbjct  204  HPGSEVFSGSTCKQGEIEAIVIATGINTFFGKAAHLVDSTQNVGHFQRVLTAIGNFCICS  263

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G++ E+IVMYPIQ R YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  264  IAIGIVIEVIVMYPIQRRSYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  323

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  324  TKRMTAIEEMAGMDVLCSDKTGTLT  348



>emb|CDX72218.1| BnaC07g42400D [Brassica napus]
Length=911

 Score =   394 bits (1013),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  251  IAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_010496144.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLP T+
Sbjct  134  KTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML E+I+MYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESL VT+
Sbjct  134  KTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLP T+
Sbjct  134  KTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML E+I+MYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+L EIIVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G+L EIIVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   394 bits (1011),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W+EQEA+ILVPGDI+SIKLGDI+PADARLL+GDALK+DQSALTGESLPVTR
Sbjct  59   KTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLDGDALKIDQSALTGESLPVTR  118

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GP +EVFSGST KQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  119  GPSDEVFSGSTVKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  178

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ E++VMYPIQ RKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  179  IALGMVIELVVMYPIQKRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  238

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  239  TKRMTAIEEMAGMDVLCSDKTGTLT  263



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   396 bits (1018),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESL VT+
Sbjct  137  KTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLAVTK  196

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  197  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  256

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+  EI+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  257  IAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  316

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  317  TKRMTAIEEMAGMDVLCSDKTGTLT  341



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   395 bits (1016),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_007203995.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
 gb|EMJ05194.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
Length=948

 Score =   395 bits (1015),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  194  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IAVGMAIEIVVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_009137897.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X2 [Brassica 
rapa]
Length=948

 Score =   395 bits (1015),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  251  IAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   395 bits (1016),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD L VDQ+ALTGESLPVTR
Sbjct  138  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAALTGESLPVTR  197

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VL AIGNFCICS
Sbjct  198  HPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVLRAIGNFCICS  257

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGMLAEIIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  258  IAVGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  317

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  318  TKRMTAIEEMAGMDVLCSDKTGTLT  342



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   397 bits (1019),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDI+SIKLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  164  KTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  223

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  224  MPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  283

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EIIVMYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS+QGAI
Sbjct  284  IAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAI  343

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  344  TKRMTAIEEMAGMDVLCSDKTGTLT  368



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLP T+
Sbjct  134  KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPATK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            I +GML EII+MYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   395 bits (1015),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   395 bits (1015),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGD LKVDQSALTGESLPVT+
Sbjct  141  KTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTK  200

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  201  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  260

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  261  IAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  320

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  321  TKRMTAIEEMAGMDVLCSDKTGTLT  345



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   395 bits (1014),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W E+EA+ILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   395 bits (1014),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW+EQ+ASILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLTAIGNFCICS
Sbjct  196  NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLTAIGNFCICS  255

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG+L EIIVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  256  IAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  315

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  TKRMTAIEEMAGMDVLCSDKTGTLT  340



>ref|XP_009137896.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X1 [Brassica 
rapa]
Length=976

 Score =   395 bits (1015),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+ VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  191  HPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GM+ EI+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAI
Sbjct  251  IAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =   395 bits (1014),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA ILVPGD++SIKLGDI+PADARLLEGD LK+DQ+ALTGESLPVT+
Sbjct  133  KTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+IGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM  EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMAIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   395 bits (1014),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG WSEQ+A+ILVPGDI+SIKLGDI+PADARLL+GD LK+DQSALTGESLPVT+
Sbjct  132  KTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALTGESLPVTK  191

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVF+GSTCKQGEIEAVVIATGVHTFFGKAAHLVDS NQVGHFQKVLTAIGNFCICS
Sbjct  192  NPGDEVFTGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSANQVGHFQKVLTAIGNFCICS  251

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+G++ EIIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  252  IALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  311

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  312  TKRMTAIEEMAGMDVLCSDKTGTLT  336



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   395 bits (1016),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGD LKVDQSALTGESLPVT+
Sbjct  131  KTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTK  190

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
            GPG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAIGNFCICS
Sbjct  191  GPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAIGNFCICS  250

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVG++ EIIVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAI
Sbjct  251  IAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAI  310

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  311  TKRMTAIEEMAGMDVLCSDKTGTLT  335



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   395 bits (1014),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/210 (92%), Positives = 201/210 (96%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W E+EA+ILVPGDI+SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  136  KTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  195

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHT-----FFGKAAHLVDSTNQVGHFQKVLTAIGN  346
             PG+EVFSGSTCKQGEIEAVVIATGVHT     FFGKAAHLVDSTNQVGHFQKVLTAIGN
Sbjct  196  NPGDEVFSGSTCKQGEIEAVVIATGVHTTGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGN  255

Query  347  FCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS  526
            FCI SIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS
Sbjct  256  FCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS  315

Query  527  QQGAITKRMTAIEEMAGMDVLCSDKTGTLT  616
            QQGAITKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  316  QQGAITKRMTAIEEMAGMDVLCSDKTGTLT  345



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =   394 bits (1013),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W EQEA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  134  KTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  193

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICS
Sbjct  194  MPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICS  253

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML E++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  254  IALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  313

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  314  TKRMTAIEEMAGMDVLCSDKTGTLT  338



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   394 bits (1013),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+W E+EA+ILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  HPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGM+ EI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  253  IAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



>gb|EPS57651.1| hypothetical protein M569_17165 [Genlisea aurea]
Length=955

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSEQ+ASILVPGD++S+KLGDIIPADARLLEGD LK+DQSALTGESLPVT+
Sbjct  140  KTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTK  199

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TN VGHFQKVLT+IGNFCICS
Sbjct  200  NPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQKVLTSIGNFCICS  259

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IAVGML E++VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  260  IAVGMLIEVVVMYPIQRRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  319

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  320  TKRMTAIEEMAGMDVLCSDKTGTLT  344



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    KTKVLRDGRWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTGESLPVTR  181
            KTKVLRDG+WSE+EA+ILVPGD++SIKLGDI+PADARLLEGD LK+DQSALTGESLPVT+
Sbjct  133  KTKVLRDGKWSEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTK  192

Query  182  GPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  361
             PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  193  NPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  252

Query  362  IAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  541
            IA+GML EI+VMYPIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL++QGAI
Sbjct  253  IAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLAEQGAI  312

Query  542  TKRMTAIEEMAGMDVLCSDKTGTLT  616
            TKRMTAIEEMAGMDVLCSDKTGTLT
Sbjct  313  TKRMTAIEEMAGMDVLCSDKTGTLT  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090