BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS110D12

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       199   4e-56   Nicotiana tomentosiformis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       198   1e-55   Nicotiana sylvestris
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       189   1e-52   Solanum tuberosum [potatoes]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       189   2e-52   Solanum lycopersicum
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       187   6e-52   Solanum tuberosum [potatoes]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       184   2e-50   Solanum lycopersicum
gb|AFU61111.1|  F-box protein                                           178   1e-48   Capsicum annuum
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       172   1e-46   Nicotiana tomentosiformis
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       167   1e-44   Nicotiana sylvestris
emb|CDP10419.1|  unnamed protein product                                167   2e-44   Coffea canephora [robusta coffee]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       148   6e-38   Sesamum indicum [beniseed]
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   5e-36   Nelumbo nucifera [Indian lotus]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                140   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   8e-35   Nelumbo nucifera [Indian lotus]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         139   2e-34   Jatropha curcas
emb|CBI28209.3|  unnamed protein product                                136   1e-33   Vitis vinifera
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       136   2e-33   Vitis vinifera
gb|KJB54023.1|  hypothetical protein B456_009G017100                    135   3e-33   Gossypium raimondii
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   4e-33   
ref|XP_002524506.1|  grr1, plant, putative                              134   9e-33   Ricinus communis
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      133   2e-32   Gossypium arboreum [tree cotton]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_010086585.1|  hypothetical protein L484_002248                   133   2e-32   Morus notabilis
gb|KJB27084.1|  hypothetical protein B456_004G276800                    131   1e-31   Gossypium raimondii
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             130   2e-31   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      130   3e-31   Gossypium arboreum [tree cotton]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    130   4e-31   Gossypium raimondii
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             129   7e-31   Phaseolus vulgaris [French bean]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   9e-31   Pyrus x bretschneideri [bai li]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   3e-30   Eucalyptus grandis [rose gum]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   4e-30   Populus euphratica
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       126   9e-30   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   9e-30   Populus euphratica
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   9e-30   
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         125   1e-29   Jatropha curcas
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             125   3e-29   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     124   4e-29   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   8e-29   Eucalyptus grandis [rose gum]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       123   9e-29   Cicer arietinum [garbanzo]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   9e-28   
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   1e-27   Sesamum indicum [beniseed]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       120   2e-27   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             119   2e-27   
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   1e-26   Nicotiana tomentosiformis
emb|CBI21043.3|  unnamed protein product                                116   2e-26   Vitis vinifera
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            117   2e-26   Nicotiana sylvestris
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   3e-26   Elaeis guineensis
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   4e-26   Vitis vinifera
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   1e-25   Glycine max [soybeans]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   1e-25   Elaeis guineensis
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   1e-25   Cucumis melo [Oriental melon]
emb|CAN83761.1|  hypothetical protein VITISV_043743                     114   1e-25   Vitis vinifera
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   2e-25   Cucumis sativus [cucumbers]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      114   2e-25   Gossypium arboreum [tree cotton]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       114   2e-25   Phoenix dactylifera
gb|KJB07737.1|  hypothetical protein B456_001G042600                    113   3e-25   Gossypium raimondii
ref|XP_007011864.1|  EIN3-binding F box protein 1                       113   3e-25   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    113   3e-25   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    113   3e-25   
gb|AFT92041.1|  EIN3 binding F-box 1                                    113   4e-25   Malus domestica [apple tree]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     113   4e-25   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    112   4e-25   Eucalyptus grandis [rose gum]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             112   5e-25   Prunus persica
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   112   6e-25   Citrus sinensis [apfelsine]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    112   6e-25   Gossypium raimondii
ref|XP_002515516.1|  grr1, plant, putative                              112   7e-25   Ricinus communis
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   7e-25   Fragaria vesca subsp. vesca
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    112   8e-25   
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            112   9e-25   Sesamum indicum [beniseed]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   1e-24   Glycine max [soybeans]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             110   2e-24   Phaseolus vulgaris [French bean]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       110   2e-24   
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             110   3e-24   Phaseolus vulgaris [French bean]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                110   5e-24   Erythranthe guttata [common monkey flower]
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      109   7e-24   Gossypium arboreum [tree cotton]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    109   7e-24   Glycine max [soybeans]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    109   8e-24   Gossypium raimondii
gb|KJB65824.1|  hypothetical protein B456_010G114900                    109   9e-24   Gossypium raimondii
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   9e-24   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   9e-24   
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  108   1e-23   Cucumis sativus [cucumbers]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             108   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Populus euphratica
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Phoenix dactylifera
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Solanum tuberosum [potatoes]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     108   2e-23   Vitis vinifera
gb|AES91540.2|  EIN3-binding F-box-like protein                         107   3e-23   Medicago truncatula
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    107   4e-23   Prunus mume [ume]
ref|XP_003609343.1|  Ein3-binding f-box protein                         107   5e-23   
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   7e-23   Glycine max [soybeans]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          106   9e-23   Amborella trichopoda
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             105   2e-22   Citrus clementina [clementine]
ref|XP_003588766.1|  Ein3-binding f-box protein                         104   3e-22   Medicago truncatula
gb|ABK25485.1|  unknown                                                 104   3e-22   Picea sitchensis
gb|KHN33913.1|  EIN3-binding F-box protein 1                            104   3e-22   Glycine soja [wild soybean]
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    104   4e-22   
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             104   4e-22   
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    104   5e-22   
ref|XP_002308665.2|  grr1 family protein                                104   5e-22   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   6e-22   Populus euphratica
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   8e-22   Cicer arietinum [garbanzo]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    103   9e-22   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   3e-21   Citrus sinensis [apfelsine]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          101   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   4e-21   
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.4    2e-20   
dbj|BAH20224.1|  AT2G25490                                            98.2    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg           98.2    5e-20   Eutrema salsugineum [saltwater cress]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.8    8e-20   Cucumis sativus [cucumbers]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like     97.8    9e-20   Tarenaya hassleriana [spider flower]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                     97.8    9e-20   
gb|KHN07078.1|  EIN3-binding F-box protein 1                          96.7    2e-19   Glycine soja [wild soybean]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          96.7    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1          96.7    2e-19   Cucumis melo [Oriental melon]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.7    2e-19   Fragaria vesca subsp. vesca
ref|XP_002874252.1|  ein3-binding F box protein 2                     96.3    2e-19   
gb|EPS63879.1|  f-box family protein                                  96.7    2e-19   Genlisea aurea
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1          95.9    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     95.5    4e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002880682.1|  ein3-binding F box protein 1                     95.1    5e-19   
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...  95.1    7e-19   Glycine max [soybeans]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1          94.7    9e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg           94.4    1e-18   Capsella rubella
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1          93.2    3e-18   Camelina sativa [gold-of-pleasure]
gb|KEH32121.1|  EIN3-binding F-box-like protein                       93.2    3e-18   Medicago truncatula
ref|XP_003609344.1|  Ein3-binding f-box protein                       93.2    4e-18   
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          92.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg           92.8    4e-18   Capsella rubella
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     92.8    4e-18   Camelina sativa [gold-of-pleasure]
gb|KEH32122.1|  EIN3-binding F-box-like protein                       92.8    5e-18   Medicago truncatula
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.7    1e-17   Cucumis sativus [cucumbers]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg              91.3    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g           91.3    1e-17   Phaseolus vulgaris [French bean]
ref|NP_197917.1|  EIN3-binding F-box protein 2                        90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like     90.5    2e-17   Brassica rapa
gb|KJB07621.1|  hypothetical protein B456_001G033400                  90.5    2e-17   Gossypium raimondii
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.7    4e-17   Cucumis melo [Oriental melon]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                  89.7    5e-17   Arabis alpina [alpine rockcress]
gb|ACB59221.1|  F-box protein                                         89.4    6e-17   Brassica oleracea
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           89.0    8e-17   Phaseolus vulgaris [French bean]
emb|CDX87090.1|  BnaC09g04050D                                        88.2    1e-16   
emb|CDY19807.1|  BnaA09g04600D                                        88.2    1e-16   Brassica napus [oilseed rape]
emb|CDX88173.1|  BnaA06g27640D                                        87.8    2e-16   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          87.8    2e-16   Brassica rapa
gb|EPS63568.1|  ein3-binding f-box protein 3                          87.0    3e-16   Genlisea aurea
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     87.0    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like     86.3    7e-16   Tarenaya hassleriana [spider flower]
gb|AEK81539.1|  EIN3 binding F-box 1                                  85.9    8e-16   Dianthus caryophyllus [carnation]
emb|CDX80503.1|  BnaC07g29410D                                        84.0    4e-15   
ref|XP_003603398.1|  Ein3-binding f-box protein                       84.0    4e-15   
gb|AES73649.2|  EIN3-binding F-box-like protein                       83.6    5e-15   Medicago truncatula
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     81.6    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.5    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     80.5    6e-14   Tarenaya hassleriana [spider flower]
emb|CDX76980.1|  BnaC04g37750D                                        79.7    8e-14   
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     79.0    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg           78.2    3e-13   Eutrema salsugineum [saltwater cress]
dbj|BAD15849.1|  putative F-box protein                               77.4    7e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                        77.0    7e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          76.6    9e-13   Brassica rapa
emb|CDY35358.1|  BnaA04g14890D                                        76.6    9e-13   Brassica napus [oilseed rape]
dbj|BAJ88579.1|  predicted protein                                    75.5    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19526.1|  hypothetical protein F775_07091                       75.1    4e-12   
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          73.9    9e-12   Brachypodium distachyon [annual false brome]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     73.6    1e-11   
ref|NP_001237471.1|  grr1 protein                                     70.1    1e-10   
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.2    7e-10   Setaria italica
gb|EAZ01599.1|  hypothetical protein OsI_23635                        67.8    8e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD35544.1|  putative F-box protein Fbl2                          67.8    8e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        67.0    1e-09   
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  66.6    2e-09   
ref|NP_001147557.1|  LOC100281166                                     63.2    3e-08   Zea mays [maize]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    3e-08   Oryza brachyantha
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        58.9    6e-07   Sorghum bicolor [broomcorn]
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.8    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  55.8    7e-06   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  55.5    8e-06   
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     55.5    9e-06   Nelumbo nucifera [Indian lotus]
emb|CDP13515.1|  unnamed protein product                              48.9    3e-04   Coffea canephora [robusta coffee]
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like     49.7    8e-04   Setaria italica



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 5/131 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RK+ARI+GPFVVE + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKKARISGPFVVEERTKNPSI  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LPDECLFEIFRRL GGRERS+AACVSKRWLML S+VRNSEI   +SH D+S+A+  NG
Sbjct  61   EILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEI---QSHTDISVAN--NG  115

Query  600  ASNDVEMSPAD  632
             S+D +M  AD
Sbjct  116  DSSDGKMVSAD  126



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RKRARI+GPF++E + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKRARISGPFIIEERTKNPSI  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LPDECLFEIFRRL GGR+RS+AACVSKRWLML S+VR+SEI     H DLS+AD  NG
Sbjct  61   EILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI----CHTDLSVAD--NG  114

Query  600  ASNDVEMSPAD  632
             S+D +M  AD
Sbjct  115  TSSDAKMVSAD  125



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSVRNSEI RSKS+ +L+
Sbjct  61   EILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEICRSKSYNNLN  113



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSV+NSEI RSKS+ +L+
Sbjct  61   EVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEICRSKSYNNLN  113



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 109/131 (83%), Gaps = 7/131 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            M TLVNYSGD++F +G SLCSADLGLML+LGHAD+YCP  KRARI+GPFVVE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLMLALGHADIYCPVSKRARISGPFVVEERTKNPSI  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   EVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  600  ASNDVEMSPAD  632
            AS+D +M+ AD
Sbjct  114  ASDDTKMASAD  124



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 109/131 (83%), Gaps = 7/131 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            M TLVNYSGD++F +G SLCSADLGL+L+LGHAD+YCP  KRARI+GPF+VE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLILALGHADIYCPVSKRARISGPFIVEERTKNPSI  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   ELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  600  ASNDVEMSPAD  632
            AS+D +M+ +D
Sbjct  114  ASDDTKMASSD  124



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MP LVNYSGDD+  +G S CSADLGLMLSLGHA+VYCP RKR+RI+GPFVVE + K PS+
Sbjct  1    MPALVNYSGDDELYSGGSFCSADLGLMLSLGHAEVYCPPRKRSRISGPFVVEDRSKGPSL  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            + LPDECLFEI RRL GGRER +A+C+SKRWLML+SSVR+SEI RSKS+ +L+
Sbjct  61   DDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEICRSKSYTNLN  113



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 96/131 (73%), Gaps = 11/131 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVNYSGDD+F +G   CSA+           VYCP RKR RI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISGPFVVEDRSKDPSL  49

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LPDECLFEI RRL GGRERS+AACVSKRWLML+SSVRNSEI RSKS  +LS  + VNG
Sbjct  50   EILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEICRSKSQNNLSSVEEVNG  109

Query  600  ASNDVEMSPAD  632
             SND  M   D
Sbjct  110  DSNDTTMIYKD  120



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 94/131 (72%), Gaps = 11/131 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  419
            MPTLVN+SGDD+F +G   CSA+           VYCP RKR RI+ PFVVE + K PS+
Sbjct  1    MPTLVNHSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISSPFVVEDRSKDPSL  49

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            E LPDECLFEI RRLSGGRERS+AACVSK WLML+SSVR SEI RSKSH +LS  + V G
Sbjct  50   EILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEICRSKSHNNLSSVEEVKG  109

Query  600  ASNDVEMSPAD  632
             SND  M   D
Sbjct  110  NSNDTTMISKD  120



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEK  407
            MP LVNY GDDDF  G S+CSAD GL+LS+  ADVYCP RKR+R++ P+ V+     +E+
Sbjct  1    MPALVNYGGDDDFYTGRSICSADSGLVLSI--ADVYCPPRKRSRVSAPYAVDSRLFNKER  58

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
             PSIE LPDECLFEIFRRL G +ERS++ACVSKRWLML+SSVRNSE  RS S Q+     
Sbjct  59   NPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSEFCRSNSPQEQLATK  118

Query  588  XVNGASNDVEMSPAD  632
             V    +DVEM+ AD
Sbjct  119  EVKKTESDVEMNSAD  133



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQE  404
            MP LVN  GDDDF + G SLCS D G++ S+  H ++YCP RKR+RI+GP++V     ++
Sbjct  1    MPALVNIRGDDDFYSEGGSLCSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLFED  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  584
            K+PSI+ LPDECLFEIFRRL GGRERS++ACVSKRWL ++SSVR+SE  RSK  Q     
Sbjct  61   KRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSEFNRSKIPQGQPKT  120

Query  585  DXVNGASNDVE  617
              +  A N+ E
Sbjct  121  ISIEKAVNNTE  131



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            MPTLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RI+ PFV       
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            Q+K+ SIE LPDECLFEIFRRL GG+ERS+ A VSKRWL+L+SS+R +EI  SK+ Q
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEICTSKTTQ  117



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 90/136 (66%), Gaps = 16/136 (12%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQ----E  404
            MP LVNY GDDDF +  S CS D GL+ S+G HA+VYCP RKR+RI GP  +       +
Sbjct  1    MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  584
            K PSI+ LPDECLFEIF  LS GRERS++ACVSKRWL ++SSVR SE  R K+ Q+    
Sbjct  61   KTPSIDTLPDECLFEIFTHLSNGRERSTSACVSKRWLSVLSSVRCSEFHRIKTPQE----  116

Query  585  DXVNGASNDVEMSPAD  632
                   +D+EM   D
Sbjct  117  -------SDIEMESCD  125



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 12/142 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M TLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RIT PFV       
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF-----RSKS  563
            Q+K+ SIE LPDECLFEIFRRL GG+ERS  ACVSKRWL L+SS+R +E++     +   
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVYGIETTQPAK  120

Query  564  HQDLSIADXVNGASNDVEMSPA  629
            H+   ++D  +  S  V+  PA
Sbjct  121  HEGELVSDKTDEFSKLVKEEPA  142



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 13/138 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----QE  404
            MPTLVNYSGDD+F AG SLC+  +  + S+G   D+Y P  KRAR + PF+       Q 
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM--LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQN  58

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  584
            K+PSI+ LPDECLFEIFRR+ GG+ERSS ACVSKRWL+L+SS++ +EI  SK+     +A
Sbjct  59   KQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEICESKTL----VA  114

Query  585  D--XVNGASNDVEMSPAD  632
            D       SNDVEM  +D
Sbjct  115  DNEVTVSVSNDVEMISSD  132



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 86/120 (72%), Gaps = 7/120 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  401
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  402  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L+
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLN  122



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 12/143 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  401
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  402  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L+
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLN  122

Query  579  IADXVNG-----ASNDVEMSPAD  632
             +  ++        +D+EM  A+
Sbjct  123  ESSKLDKELTIPVPDDIEMISAE  145



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 88/134 (66%), Gaps = 12/134 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPF---VVEV-  398
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  579  IADXVNGASNDVEM  620
            + + V   S DVEM
Sbjct  116  VKENVGSNSGDVEM  129



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 86/127 (68%), Gaps = 7/127 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SSVR  ++ ++    +  
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRKVDLCKNPVADNSD  120

Query  579  IADXVNG  599
              +  NG
Sbjct  121  XTEMTNG  127



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 89/135 (66%), Gaps = 17/135 (13%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            MP LVNYSGDD+F +G SLC+   DLG   S+G H D Y P  KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q K+PSI+ LPDECLFEIFRR+ GG+ERS+ ACVSKRWL L+SS+R +E+   +      
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAELCNER------  114

Query  579  IADXVNGASNDVEMS  623
                +    NDVEM+
Sbjct  115  ----IVPGCNDVEMA  125



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 87/134 (65%), Gaps = 12/134 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPF---VVEV-  398
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  579  IADXVNGASNDVEM  620
            + +     S DVEM
Sbjct  116  VKENFGSNSGDVEM  129



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 91/138 (66%), Gaps = 17/138 (12%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            MP LVNY GDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SS+R  ++ ++       
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRKVDLCKNP------  114

Query  579  IADXVNGASNDVEMSPAD  632
            +AD     S+D EM+  D
Sbjct  115  VADN----SDDTEMTNGD  128



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 88/135 (65%), Gaps = 17/135 (13%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE----VQEK  407
            MPTLVNYSGDD+F +G S     +       H D+YCP  KRARI+ PF +E     Q +
Sbjct  1    MPTLVNYSGDDEFYSGGSCSPYSIA-----SHVDLYCPPSKRARISAPFALEGSFFEQAE  55

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            KPSI+ LPDECLFEI R + GG+ER S+ACVSKRWLMLMSS+R +E+  SKS  +L    
Sbjct  56   KPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEM-PSKSENELV---  111

Query  588  XVNGASNDVEMSPAD  632
                +S DVEM   D
Sbjct  112  ----SSGDVEMVAFD  122



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            MP LVNY GDDDF +G S    S DLG + S+    DVY P RKRARIT PFVV      
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  572
            Q K+ SI+ LPDECLFEIF+RL GGRERSS ACVSK WLML+ S+R  E   SK+ ++
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGEYESSKAVKE  118



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            MP LVNYSGDD+  +G SL   S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            Q K+PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   SK+ +
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCSSKNRE  117



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 91/136 (67%), Gaps = 10/136 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  401
            M  L ++SG DDF  G S+     +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  581
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R+ EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEISDNKTTQALDL  120

Query  582  ----ADXVNGASNDVE  617
                 D   G  +DVE
Sbjct  121  NYESTDKKGGDVSDVE  136



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  401
            M  L ++SG DDF  G S+ +   +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  581
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R++EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEISDNKTTQALDL  120

Query  582  ----ADXVNGASNDVE  617
                 D   G  ++VE
Sbjct  121  NYESTDKKGGDVSEVE  136



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 91/139 (65%), Gaps = 15/139 (11%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITGPFVVEV---  398
            MP LVNYSGDD+   G+S      DLG M +LG +    YC   KRARI  P + E    
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  399  -QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
             +++KP+IE LP+ECLFEIFRRLS G+ERSS +CVSKRWLMLMS +  +EI++S++  + 
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIYKSENLTEG  120

Query  576  SIADXVNGASNDVEMSPAD  632
            S       AS DVEM+  D
Sbjct  121  S-------ASCDVEMASVD  132



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 85/138 (62%), Gaps = 17/138 (12%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            MP LVN SGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+R  ++ +S       
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRKVDLCKSP------  114

Query  579  IADXVNGASNDVEMSPAD  632
                V   SND EM   D
Sbjct  115  ----VVDNSNDAEMITGD  128



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGHA-DVYCPSRKRARITGPFVV---EVQ  401
            MPTLVNY G+D F  G SLC  S DL  + S+G + D+Y P  KRARI GP+ V   E +
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  402  EKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
             ++PS I  LPDECLFEIFRRL GGRERS+ ACVSK WL L+SS+R +EI          
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  120

Query  579  IADXVNGASNDVEMSPAD  632
              +    +S DV+M   D
Sbjct  121  DEEMKTSSSGDVQMVSCD  138



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 90/136 (66%), Gaps = 13/136 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            MP LVNYSGDD+  +G S    S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q  +PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   S +  +  
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCNSSAAAE--  118

Query  579  IADXVNGA--SNDVEM  620
              +   GA   NDVEM
Sbjct  119  --EKGTGAPVRNDVEM  132



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 86/135 (64%), Gaps = 12/135 (9%)
 Frame = +3

Query  249  LVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QEK  407
             +  SGDDDF +G S    S DLG + S+    DVYCP RKRARI  PF+       Q K
Sbjct  51   FIGISGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNK  110

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            +PSI+ LP+ECLFEIF+RL GGRERSS ACVSK WLML++S+R SE   SK      + +
Sbjct  111  QPSIDVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSEYESSK-----VVKE  165

Query  588  XVNGASNDVEMSPAD  632
              +  S DVEM  +D
Sbjct  166  NTDLVSEDVEMISSD  180



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 12/136 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  398
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  572
            Q K+PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCYSNPVAEEE  120

Query  573  LSIADXVNGASNDVEM  620
               A  V    NDVEM
Sbjct  121  KETAAPV---CNDVEM  133



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 77/112 (69%), Gaps = 7/112 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR  554
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+   ++ +
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSIWKVDLCK  112



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 7/134 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  L  ++GDDDF  G  + +   +  L+LSLG H DVY PSRKR+RI+ PFV+      
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   E+   K+ Q L+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDELCSKKTTQLLN  120

Query  579  IADXVNGASNDVEM  620
             +   NG + D+E+
Sbjct  121  ESAEKNGEAEDLEI  134



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 91/136 (67%), Gaps = 12/136 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  398
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  572
            Q  +PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCNSNPVAEEE  120

Query  573  LSIADXVNGASNDVEM  620
               A  V    NDVEM
Sbjct  121  KETAAPV---CNDVEM  133



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  410
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  411  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  588  XVNGASNDVEMSPAD  632
                +S DVEM  +D
Sbjct  121  MKTSSSVDVEMVSSD  135



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  410
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  411  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  588  XVNGASNDVEMSPAD  632
                +S DVEM  +D
Sbjct  121  MKTSSSVDVEMVSSD  135



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 76/113 (67%), Gaps = 9/113 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLG--LMLSLGHADVYCPSRKRARITGPF----VVEVQ  401
            MP LVN SGDD+   G S+   DLG  L     + DVYC   KRARI+ PF    V   Q
Sbjct  1    MPALVNSSGDDEMYPGGSM---DLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQ  57

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            + KPS+E LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++  SEI R+ 
Sbjct  58   DHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEIERTN  110



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  407
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  588  XVNG  599
             V+G
Sbjct  121  EVSG  124



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEK  407
            M  + ++ GD DF  G  L     + GL L LG H DVY P RKR+RI+ PFVV  V ++
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVAKQ  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            +PSIE LPDECLFE+FRRL GG ERS+ ACVSKRWLML+SS+   EI
Sbjct  61   QPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEI  107



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 97/178 (54%), Gaps = 29/178 (16%)
 Frame = +3

Query  117  SGLWIWNANLGRNPNLGCVDFAAKSNLF--CSLFGGFF*KETAMPTLVNYSGDDDFLAGS  290
            S + +++  L R    GC  F+    LF  CS           MP LVNY GDD F  GS
Sbjct  60   SSVLVFHLFLLRLVFFGCCFFSPARVLFSDCSPSA-----SATMPALVNYRGDDLFSIGS  114

Query  291  SLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EKKPSIEALPDECLFEIFR  458
                          H D YCP RKRAR++  F     E + E +PSI+ LPDECL+EIFR
Sbjct  115  --------------HVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFR  160

Query  459  RLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNGASNDVEMSPAD  632
            RL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     + V   S+ VEM   D
Sbjct  161  RLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----EVVASVSDHVEMVSCD  214



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 82/135 (61%), Gaps = 22/135 (16%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  407
            MP LVNY GDD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYRGDDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  46

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  47   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  102

Query  588  XVNGASNDVEMSPAD  632
             V   S+ VEM   D
Sbjct  103  VVASVSDHVEMVSCD  117



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  407
            M  + N+SGD+ F  G +L  +  +  L LSLGH  DVY P  KR+RIT P +  E Q+K
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTEKQKK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
             PSI+ LPDECLFE+FRR+S G+ERS+ ACVSKRWLML+SS+R  E   SK
Sbjct  61   LPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDETVVSK  111



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +    DL 
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICMTPEAVDLE  120

Query  579  I  581
            I
Sbjct  121  I  121



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  407
            M  + N+SGDD F  G +L  +  +  L LSLGH  DVY P  KR+R+T P +  E Q+K
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTEKQKK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
             PSI+ LPDECLFE+ RR+S G+ERS+ ACVSKRWLML+SS+R  E   SK
Sbjct  61   LPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIRGYETVVSK  111



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 12/121 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------  389
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+       
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  390  -VEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
              E Q+++P SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+   K+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAYKN  120

Query  564  H  566
            +
Sbjct  121  N  121



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKT  115



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 84/139 (60%), Gaps = 15/139 (11%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITG----PFVVE  395
            MPTLVNYSGDD+   G S C    DLG + + G    + Y    KRARI       F+  
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINALDAFEFLGR  60

Query  396  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
             Q++KP+I+ LPDECLFE+FR LS G+ERSS A VSKRWLMLMSS+  +EI +S    + 
Sbjct  61   EQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEIHKSDKMIEG  120

Query  576  SIADXVNGASNDVEMSPAD  632
            S       AS  VEM+  D
Sbjct  121  S-------ASGYVEMASVD  132



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 12/121 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  410
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+ +  EK+
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  411  P---------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
                      SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+S++R SE+   K+
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEMAAHKN  120

Query  564  H  566
            +
Sbjct  121  N  121



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  398
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRS  115



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = +3

Query  306  DLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ----EKKPSIEALPDECLFEIFRRLSG  470
            D GL++S+G   DVYCP RKR+RIT P++        EK+PSI+ LPDECLFEI RRL G
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  471  GRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG-----ASNDVEMSPAD  632
            G+ERSS A VSKRWLML+SS+R +EI   KS Q L+ +  ++        +D+EM  A+
Sbjct  62   GQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLNESSKLDKELTIPVPDDIEMISAE  120



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  398
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRS  115



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 74/111 (67%), Gaps = 8/111 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  404
            MP LVNYSGDDDF    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDDFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  557
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E +RS
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE-YRS  108



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 87/147 (59%), Gaps = 18/147 (12%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQEK-  407
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PFV +  EK 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  408  --KP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--  560
              KP     SI+ LPDECLFEI RRL G RERS++ACVSKRWLML+SS+R SEI  +K  
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEIAANKKN  120

Query  561  --SHQDL---SIADXVNGASNDVEMSP  626
              S+ DL    + D  +  S D E  P
Sbjct  121  GSSNGDLLKNPLPDLNDAVSTDEEEEP  147



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 73/112 (65%), Gaps = 7/112 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  404
            MP LVNYSGDD+F    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDEFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E   SK
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYGSSK  110



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 90/155 (58%), Gaps = 22/155 (14%)
 Frame = +3

Query  177  FAAKSNLFCSLFGGFF*KETAMPTLVNY------------SGDDDFLAGSSLCS--ADLG  314
            F    +LF +LFGGF   E     L  +             G DDF  G S+     +  
Sbjct  15   FFLVGSLFFALFGGFLGGEQCRFDLPGFFELYLCQSSFLSVGSDDFCPGGSIYPNPKESS  74

Query  315  LMLSLGH-ADVYCPSRKRARITGPFVV---EVQEKKPSIEALPDECLFEIFRRLSGGRER  482
              LSLGH  DVY P RK++RI+ PFV      ++KKPSI+ LPDECLFEIFRRL GG+ER
Sbjct  75   HFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDVLPDECLFEIFRRLPGGQER  134

Query  483  SSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            S+ ACVSKRWL L+S++R  EI    + Q L++ D
Sbjct  135  SACACVSKRWLTLVSNIRKDEI----TTQALNLKD  165



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  407
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  588  XVNG  599
             V+G
Sbjct  121  EVSG  124



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  407
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  588  XVNG  599
             V+G
Sbjct  121  EVSG  124



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  407
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  588  XVNG  599
             V+G
Sbjct  121  EVSG  124



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKT  115



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKT  115



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 84/127 (66%), Gaps = 7/127 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  401
            M  L+ ++G+DDF  G S+ +   +  L LS G HADV+   RKR+RI+GPFV      +
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  402  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSKRWL L+S++   E   + ++  L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDEFCSNTTNLLLN  120

Query  579  IADXVNG  599
              D V G
Sbjct  121  PQDEVTG  127



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 23/135 (17%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  407
            MP LVNY  DD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYR-DDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  45

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  46   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  101

Query  588  XVNGASNDVEMSPAD  632
             V   S+ VEM   D
Sbjct  102  VVASVSDHVEMVSCD  116



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 6/109 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVV---EVQ  401
            M  L ++SG D+F  G S+     +  L  SLGH  DVY P  KR+RI+ P V     V+
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            +K PSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL L+S++   EI
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEI  109



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 8/119 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ---  401
            M  L  ++GDDDF  G S+ +   +LGL LSLGH  DVY PSRKR+RI  PFV   +   
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  402  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
             +K+ SIE LPDECLFEIFRRL  G ERS+ A VSKRWL L+S++   E+   K+ Q L
Sbjct  61   KKKQASIEVLPDECLFEIFRRLP-GEERSACAGVSKRWLGLLSNLSRDELCSKKTTQLL  118



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 9/109 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA---DLGLMLSLGHADVYCPSRKRARITGPFVVE----V  398
            MPTLVNYSGDD+F +G S  S+   DLG +LS+G ++ Y PS KRARI+  F +      
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVG-SNAYPPS-KRARISSQFDIRGSSFE  58

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            QEKK SIE LP+ECLFEIFRRL GG+ER + A VSK+WLML+SS+R SE
Sbjct  59   QEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE  107



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 81/125 (65%), Gaps = 5/125 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQE  404
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  584
            K+ SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     
Sbjct  61   KEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQ  120

Query  585  DXVNG  599
            D V+G
Sbjct  121  DEVSG  125



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 81/126 (64%), Gaps = 12/126 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  401
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  402  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE-----IFRSKS  563
             K   SIE LPDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E     +  SK 
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHELKSEDVVASKE  120

Query  564  HQDLSI  581
             +D+ I
Sbjct  121  VEDIEI  126



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +3

Query  315  LMLSLG-HADVYCPSRKRARITGPFVVEVQ-EKKPSIEALPDECLFEIFRRLSGGRERSS  488
            L L LG H DVY   RKR+RI+ PFVV  + E++PSI+ LPDECLFE+FRRL GG+ERS+
Sbjct  27   LFLPLGNHVDVYFLPRKRSRISAPFVVSGEPEQQPSIDVLPDECLFEVFRRLPGGQERSA  86

Query  489  AACVSKRWLMLMSSVRNSEIFRSKSHQ  569
             ACVSKRWLMLMSS+   EI  SK+ Q
Sbjct  87   CACVSKRWLMLMSSIARDEICNSKTTQ  113



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  404
            MP LVNYSGDD+   G S C    +LG L  ++G + DVY P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRSIFEAIEREQYY  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            ++P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++   EI R+ S
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIERATS  113



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 5/113 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSL--GHADVYCPSRKRAR-ITGPFVVEVQE  404
            MP LVNYSGDD+   G S C +  +LG + S    + D+Y P  KR+R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSRSILEAIEGEQHY  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            ++P IE LPDECLFEIFRRL  G+ERS  ACVSKRWLMLMSS+   EI R+ S
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEIERTTS  113



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 87/143 (61%), Gaps = 11/143 (8%)
 Frame = +3

Query  219  FF*KETAMPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV  389
            FF +     +LV+   +DDF  G  + S   D  L LSLG H DVY PSRKR+RI+ PFV
Sbjct  43   FFKQYPCRRSLVSPVSNDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFV  102

Query  390  VEVQ----EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  557
               +    +KK SI+ LPDECLFEIFRRL    ERS++ACVSKRWLML+S++R  E+   
Sbjct  103  FSEERLQKKKKASIDVLPDECLFEIFRRLPA-EERSASACVSKRWLMLLSNIRQEELCSE  161

Query  558  KSHQDLSIADXV---NGASNDVE  617
            K+   L   D +    G   ++E
Sbjct  162  KTSASLKSEDDIAEEKGEDQEIE  184



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 83/134 (62%), Gaps = 11/134 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  ++ +SG DDF  G SL +   +    L LG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q++K SIE+LPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+   EI   K+    S
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEICVIKN----S  116

Query  579  IADXVNGASNDVEM  620
             A+ +    +DVE 
Sbjct  117  SAENIKKDGDDVEF  130



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-  407
            M  +V++SGD+ F   + L     +    LSLG H +VY   RKR+RIT PF+V  + K 
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGEPKQ  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            KPSIE LPDECLFE+FRRL GG+ERS+ A VSKRWLML+SS+   EI  +K
Sbjct  61   KPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEICTTK  111



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  407
            M  L  +SG DDF  G S+  +     +    + DVY P  KR R++ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQDVYFPPCKRCRVSSPFVFAGGKFEQK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +K+ Q
Sbjct  61   KPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEIDDNKTTQ  114



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  398
            M  ++ +SG DDF    S+ +   +    LSLG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            Q++K SIEALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  SEI  +K+
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEISVNKN  115



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  407
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQ  114



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  407
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQ  114



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  407
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  588  XVNGASND  611
             V+G +++
Sbjct  121  EVSGNNSE  128



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  407
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  587
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  588  XVNGASND  611
             V+G +++
Sbjct  121  EVSGNNSE  128



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 80/126 (63%), Gaps = 12/126 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  401
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  402  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-----FRSKS  563
             K   SIE LPDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+       SK 
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHELKSEDEVASKE  120

Query  564  HQDLSI  581
             +D+ I
Sbjct  121  VEDIEI  126



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 7/119 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  398
            M  ++ ++G +DF +G S+  +  +  L LSLG H DVY P  KR+RI+ PFV       
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            Q+++ +IE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++  +E    KS  +L
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNERSSGKSQNNL  119



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDEL  110



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 76/120 (63%), Gaps = 11/120 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQE--  404
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PF+ +  E  
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  405  -KKP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  566
             +KP     SI+ LPDECLFEI R L G RERS++ACVSKRWLML+SS+R SEI  +K +
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEIAANKKN  120



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFV-VEVQEK  407
            M  + N+SGDD F  G ++  +  +  L LSLG H DVY P  KR+R+  PFV  E ++K
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKKQK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  557
              SI+ LPDECLFE+ RRLS G+ERS++ACVSKRWLML+SS+   E   S
Sbjct  61   LSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDETVIS  110



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 7/107 (7%)
 Frame = +3

Query  264  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQEKKPSIE  422
            G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      Q+++ SI+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  423  ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
             LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKT  215



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 69/111 (62%), Gaps = 15/111 (14%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  395
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  396  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI  104



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 7/127 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  401
            M  L+   G+DDF  G S+ +   +  L LSLG HADV+   RKR+RI+G FV      +
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  402  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSK WL L+S++   E   + +   L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDEFCSNTNDLSLN  120

Query  579  IADXVNG  599
              D V G
Sbjct  121  PQDEVTG  127



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 69/111 (62%), Gaps = 15/111 (14%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  395
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  396  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI  104



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  404
            MP LVNYSGDD+   G S C    +LG L  ++G + D+Y P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRSIFEAIEREQYY  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            + P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++   EI
Sbjct  61   QDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEI  108



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 10/111 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADL---GLMLSLG-HADVYCPSRKRARITGPFVVEVQ--  401
            M TLV YSGDD    G  L S+ L    L LSL  + DVYCP RKR+R+T PFV+     
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  402  --EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
              ++KPS++ LPDECLFEI RR++  R+RS+ ACVSK WLML S+++  E+
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEV  109



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +3

Query  261  SGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQEKKPSIEA  425
            +G DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++K+ SI  
Sbjct  12   AGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEVSINV  71

Query  426  LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D V+G
Sbjct  72   LPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQDEVSG  129



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 9/116 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFVVEVQEK-  407
            M  LVN  G+DD   G  L S  +   L L    + DVYCP RKR R+T P +    EK 
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  408  -----KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
                 + SI+ LP+ECLFEI RRL G +ERS++ACVSKRWLML+SS+R+SE+ + K
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSELAQKK  116



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  401
            M  L   SG DDF  G  +     + GL+L LG + D+Y  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  581
            +K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   EI   K   +  +
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEIRSLKPEAEKKV  120

Query  582  ADXVNGASNDVE  617
                +    DVE
Sbjct  121  ELVSDAEDPDVE  132



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQE  404
            M  +  +SGD+    G      +    LSLG   DVY P +KR+R++ PFV +     Q+
Sbjct  1    MSQVFGFSGDNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQK  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            +K SIE+LPDECLFEIFRRL  G ERS++ACVSKRWLML+S++  SEI  +KS
Sbjct  61   QKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEICSNKS  113



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRAR--ITGPF--VVEVQE  404
            MPTLV++ GD+DF         D  L LSL    +V CP RKR R  +T PF      QE
Sbjct  1    MPTLVSFRGDEDFGGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLRGNVTIPFRETKPKQE  60

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            +K  I  LPDECLFEIFR L   R+RS +ACVSKRWLML SS+R SEI RSK
Sbjct  61   QKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEIKRSK  112



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 84/134 (63%), Gaps = 11/134 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQ--E  404
            M  ++ +SG DDF    S+ +   +    L LG   DVY P RKR+R+  PFV + +  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  405  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            +KP  S+EALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  +EI  +K+    +
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEICVNKN----A  116

Query  579  IADXVNGASNDVEM  620
              + +    +DVE 
Sbjct  117  TVETIEKEGDDVEF  130



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 4/114 (4%)
 Frame = +3

Query  270  DDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDE  437
            DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK+ SI  LPDE
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDE  118

Query  438  CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            CLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D V+G
Sbjct  119  CLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSG  172



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 15/117 (13%)
 Frame = +3

Query  306  DLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEKKPSIEALPDECLFEIFRRLSGG  473
            DLG +LS+G   VY P  KRAR    F  E     Q +KPSIE LPDECLFEIFRRL GG
Sbjct  2    DLGCLLSIGS--VYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGG  59

Query  474  RERSSAACVSKRWLMLMSSVRNSEIFRS----KSHQDLSIADXVNGASNDVEMSPAD  632
            +ERSS ACVSK+WLML+SS+R  ++ +S    K  Q L + +     S+D EM+  +
Sbjct  60   KERSSCACVSKKWLMLLSSIRKVDLCKSPAADKVIQPLKLDN-----SDDTEMTTGE  111



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 76/116 (66%), Gaps = 12/116 (10%)
 Frame = +3

Query  270  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  428
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  61   EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  120

Query  429  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE-----IFRSKSHQDLSI  581
            PDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E     +  SK  +D+ I
Sbjct  121  PDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHELKSEDVVASKEVEDIEI  176



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSKRWL L+S++   E+
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDEL  110



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSK WL L+S++   E+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDEL  110



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE----VQ  401
            M  +  +SGD+   +GS   +  +     SLGH  D Y P +KR+R++ PFV +     Q
Sbjct  1    MSQVFGFSGDNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFTQ  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            ++K SIE+LPDECLFEIFRRL  G ERSS ACVSKRWLML+S++  SEI  +KS
Sbjct  61   KQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEICSNKS  114



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (58%), Gaps = 17/153 (11%)
 Frame = +3

Query  192  NLFCSLFGGFF*KET---AMPT----------LVNYSGDDDFLAGSSLCS-ADLGLMLSL  329
            +LF +LF GFF  +     +P           L +    DDF  G    +  + GL+LSL
Sbjct  20   SLFFALFRGFFGGKLCTFGLPEVFELHPCQSYLASPVSKDDFCPGGIYTNPKEAGLLLSL  79

Query  330  GH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACV  500
            GH ADV  P RKR+RI+ PF+      EK+ SI  LPDECLFEIF+R+ GG ERS+ ACV
Sbjct  80   GHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDECLFEIFKRIPGGEERSACACV  139

Query  501  SKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNG  599
            SKRWL ++S++   E   + ++Q     D V+G
Sbjct  140  SKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSG  172



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 75/127 (59%), Gaps = 20/127 (16%)
 Frame = +3

Query  240  MPTLVNYSGDDDF---LAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPF-------  386
            M  LVNY G DD      GSS         LS G + DVYCP RKRAR+  P        
Sbjct  1    MAALVNYGGGDDLCPLFPGSSR-------FLSPGRNVDVYCPPRKRARVIAPLGFSFRGR  53

Query  387  -VVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
              V  ++++P SI+ LPDECLFEI RRL G +ERSS ACVSKRWLML+ S+R+SE+    
Sbjct  54   EEVAAEKQQPRSIDTLPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSELAARM  113

Query  561  SHQDLSI  581
               D S+
Sbjct  114  KTTDESV  120



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 11/120 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFV------V  392
            M  LVN  G DD   G SL S  +   L L    + DVYC SRKR R+T P        V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  393  EVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSH  566
              ++++P SI++LPDECLFEI RRL G +ERS++A VSKRWLML+SS+R+SE+  R KSH
Sbjct  61   AYKKQQPRSIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSELGARKKSH  120



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 78/132 (59%), Gaps = 6/132 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  401
            M  L   SG DDF  G  +     + GL+L LG + DVY  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  581
            +K+ SIE LPDECLFEIFRRL GG ERS+ A VSKRWL L+S++   EI   K   +  +
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEIRSLKPESEKKV  120

Query  582  ADXVNGASNDVE  617
                +    DVE
Sbjct  121  ELVSDAEDPDVE  132



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  410
            M  + +++G++DF    ++     D  L+LSLG  ADVY P  KR+R+  P +    EKK
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKK  60

Query  411  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            P SI+ LPDECLFEIFRRLSG +ERS+ A VSK+WL L+SS+R  EI
Sbjct  61   PVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI  107



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 12/116 (10%)
 Frame = +3

Query  270  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  428
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  2    EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  61

Query  429  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-----FRSKSHQDLSI  581
            PDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+       SK  +D+ I
Sbjct  62   PDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHELKSEDEVASKEVEDIEI  117



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 13/136 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAG---SSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV---  398
            M  LV Y G+DD   G   S+L   D  L+LSLG  ADVY P  KR R+T P +      
Sbjct  1    MAALVKYGGNDDICPGPFYSNL--TDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEK  58

Query  399  ---QEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  566
               +EK+P SI+ LPDECLFEI RRL G +ERS++ACVSK WLML+SS+R+SE+      
Sbjct  59   VIDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSELAACNKA  118

Query  567  QDLSIADXVNGASNDV  614
             D S+ +     +NDV
Sbjct  119  CDESVKNPSLFLNNDV  134



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 79/134 (59%), Gaps = 9/134 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARIT------GPFVV  392
            M  LVN +G+DD   G  L S  +   L L      D YCP  KR RIT      G    
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  393  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  572
            + +++  SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+ S+R+SE+   K H++
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSELADRKKHRN  120

Query  573  LSIADXVNGASNDV  614
             S+   +   + DV
Sbjct  121  ESVKKPLPDLNKDV  134



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 74/112 (66%), Gaps = 11/112 (10%)
 Frame = +3

Query  264  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------VEVQEKKP  413
            G DD  +   L S   D   +LS+  + DV+ P RKR+RIT PF+        E Q+++P
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  414  -SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  566
             SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+   K +
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAHKKN  132



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  306  DLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  479
            D  L+LSLG  ADVY P  KR+R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  60

Query  480  RSSAACVSKRWLMLMSSVRNSEI  548
            RS+ A VSK+WL L+SS+R  EI
Sbjct  61   RSACAFVSKQWLTLVSSIRQKEI  83



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 11/114 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFV-VEVQEKKP  413
            M  +  +SGD+DF  G S+        LS G    VY P+RKR RI  P V +  ++K+ 
Sbjct  1    MSGIFRFSGDEDFFPGGSM-------HLSPGSCPGVYFPARKRLRIAAPSVQIGFEQKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  ++S QD+
Sbjct  54   SIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV--NESVQDV  105



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = +3

Query  270  DDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQEKKPSIEALPD  434
            +DF  G+ +     D  L LSLG   DVY P RKR+R++ PFV   E+ +K+ SIE LPD
Sbjct  13   EDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEILKKEASIEVLPD  72

Query  435  ECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF  551
            ECLFEIF+RL     RS  ACVSKRWLML+SS+  +E +
Sbjct  73   ECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFY  111



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEKKP  413
            M  L  +SGD+DF  G SL        LS G   DVY P+ KR+RI  P +    ++ + 
Sbjct  1    MSGLFRFSGDEDFFPGGSL-------YLSPGSQIDVYYPAHKRSRIAAPAIFSGFEQNQV  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            SI+ LPDECLFEIFR L  G+ERS+ ACVSKRWL L+S++R  E+
Sbjct  54   SIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEV  98



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 4/114 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSL-GHADVYCPSRKRARITGPFVV-EVQEKKP  413
            M  + N+SGD       S    +  L LSL  H DVY P  KR+R+  PFV  E + K  
Sbjct  1    MSKVFNFSGDHGGTVYPS--PKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKKHKLS  58

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SI+ LPDECLFE+ RRLS G++RS++ACVSKRWLML+SS+R  E   S  +  L
Sbjct  59   SIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDETVISNPNPSL  112



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 11/124 (9%)
 Frame = +3

Query  249  LVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV------EVQ  401
            ++ +SG+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +      + Q
Sbjct  1    MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  402  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI--FRSKSHQDL  575
            + K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  +++ 
Sbjct  61   KPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGSTGNENQ  120

Query  576  SIAD  587
             I+D
Sbjct  121  EISD  124



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KP  413
            M  L  +SGD+ +  G S+C       LS G +  VY P+RKR+RI+ P +    E+ + 
Sbjct  1    MSGLFRFSGDEGYFPGGSMC-------LSPGSNIGVYYPARKRSRISAPSLFSGFERNQA  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            SIE LPDECLFEIFRRL  G+ERS  ACVSK+WL L+S++R  E   SK
Sbjct  54   SIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREEASGSK  102



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +3

Query  306  DLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQEKKPSIEALPDECLFEIFRRLSGG  473
            D  L LSLG H DVY P RKR+R++ P+V     +++K+ SIE LPDECLFEIF+RL   
Sbjct  26   DTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEILKKKEASIEVLPDECLFEIFKRLPDR  85

Query  474  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADXVNGASNDV  614
              RS  ACVSKRWLML+SS+  +E + +  +    I    N   N +
Sbjct  86   ETRSLCACVSKRWLMLLSSISGNEFYSASENLKPKIVVTENLEDNQI  132



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  398
            M  L  ++G DDF  G S+     + G  LSLG   D+Y P  KR+R + PFV       
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  566
            Q K+ SI+ LP+ECLFEIF+RL GG ERS+ ACVSK+WL L+S++   E     ++
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDEFCNKNTN  116



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 10/114 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  413
            M  +  +SGD+DF  G S       + LS G    VY P+RKR RI  P V    +EK+ 
Sbjct  1    MSGIFRFSGDEDFFLGGS------SMYLSPGSCPGVYFPARKRLRIAAPSVFSGFEEKQT  54

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SI+ LPDECLFEI RRL  G ERS+ ACVSK WL L+SS+  SE+  ++S QD+
Sbjct  55   SIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV--NESVQDV  106



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = +3

Query  333  HADVYCPSRKRARITGPFVVEVQEKK-PSIEALPDECLFEIFRRLSGGRERSSAACVSKR  509
            H + Y   RKR RI+ PFV   + K  PSIE LPDECLFEIFRRL G +E+S  ACVSKR
Sbjct  47   HFESYSLQRKRCRISAPFVAGREVKLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKR  106

Query  510  WLMLMSSVRNSEIFRSKSHQDLSIADXVNGASNDVEMSPA  629
            WLML+SS+R  E + ++S   L      N  SN  + SP 
Sbjct  107  WLMLLSSIRKDESYTTESVGHLEPEIGFN--SNVADYSPT  144



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  410
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    E+K
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  411  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            P SI+ LPDECLFEIFRRL G +ERSS A VSK WL L+SS+R  E+
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL  107



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 64/107 (60%), Gaps = 22/107 (21%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEK  407
            MPTL+NYSG D+     S                 + PS KRARI  PFV+      QEK
Sbjct  1    MPTLINYSGKDELYNERS-----------------FYPSCKRARINAPFVLWGQESEQEK  43

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            + SI  LPDECLFEIFR L  G+ERS+ ACVSK WL L+SS+R +E+
Sbjct  44   RSSINVLPDECLFEIFRHLP-GQERSNCACVSKHWLTLLSSIRRAEM  89



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  410
            M  + +++G++DF    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGFEKK  60

Query  411  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKEL  107



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  404
            M  + +++G+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +  E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  405  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            +KP  SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E + ++S
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETYSNES  115



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 12/113 (11%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG---HADVYCPSRKRARITGPFV-----  389
            M  + ++SG+++F  G S+ S   + G  LSLG   H DVY P+ KRARI+ P V     
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  390  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            +E Q+K+ S++ LPDECL+EI RRL G +ERSS A VSKRWLML+SS+ ++++
Sbjct  60   LE-QKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSIPSADL  111



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  410
            M  + +++G+++F    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSFEKK  60

Query  411  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  107



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV-QEK  407
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    +EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            + SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+
Sbjct  61   QVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  107



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  419
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  5    VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  60

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +I
Sbjct  61   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  103



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  419
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  56   VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  111

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +I
Sbjct  112  EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  154



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  413
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    +EK+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEEKQT  54

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  557
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+  S
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEVVES  102



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 11/114 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  413
            M  +  +SGD+DF  G S+        LS G    VY P+ KR RI  P V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSM-------YLSPGSCPGVYFPAHKRLRIAAPSVFSGFEQKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  +E+   +S QD+
Sbjct  54   SIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV--DESVQDV  105



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 10/114 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  413
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEQKQT  54

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QDL
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEVV--ESVQDL  106



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +3

Query  252  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  419
            +++ GD +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  1    MDFPGDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  56

Query  420  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +I
Sbjct  57   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI  99



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 17/136 (13%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  410
            MPTL+NY+GDD+F   S     D    L +      C  P+++ R  +  PF+ +  + K
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGD--DTK  55

Query  411  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVR------NSEIFR---SKS  563
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R      N  + R    K 
Sbjct  56   PSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRMEKTENNGYLTRHLEGKK  115

Query  564  HQDLSIADXVNGASND  611
              D+ +A    G +N+
Sbjct  116  ATDIRLAAIAIGINNN  131



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  300  SADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGG  473
            S D  L  +LG   D+Y   RKR+RI+ PF+   + K + SIEALPDECLFEI RRL  G
Sbjct  17   SKDSNLSFTLGSRVDMYFLQRKRSRISAPFIAGKKSKMQSSIEALPDECLFEILRRLPRG  76

Query  474  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            RE ++ ACVSKRWLML+SS++  E+  S++ +
Sbjct  77   RETNACACVSKRWLMLLSSMKKDEMCTSETTR  108



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 8/136 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVVEVQ----  401
            M  + ++SG+DDF  G  +     +  L LSLG +  Y P +KR+R++  F +  +    
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFPLQKRSRVSVSFDINREWFDE  60

Query  402  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
             ++K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E+  + S  D +
Sbjct  61   PKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEVCSNGSTGDSN  120

Query  579  I-ADXVNGASNDVEMS  623
            +  D   G SN+  +S
Sbjct  121  VGGDDDQGFSNEGYLS  136



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 10/114 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP-FVVEVQEKKP  413
            M  +  +SGD+D L G S+        LS G    VY P+RKR R+    F    +EK+ 
Sbjct  1    MSGIFRFSGDEDCLLGGSM-------YLSPGSCPGVYYPARKRLRVAATSFYSGFEEKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            SI+ LP+ECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  S S QD+
Sbjct  54   SIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEVNES-SVQDV  106



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (62%), Gaps = 9/104 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  413
            M  + ++SGD++F  G S+        LS G  + VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEEFFNGGSM-------YLSTGSCSGVYLPPRKRLRVAAPSLYSSFNQKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +3

Query  339  DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  518
            DVY P  KR+R T     + ++KKPSIE LPDECLFEIFR L GGRERSS ACVSKRWL+
Sbjct  2    DVYFPLSKRSR-TSASGEKFEQKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSKRWLI  60

Query  519  LMSS-----VRNSEIFRSKSHQDLSIADXVNGASNDVEMSPAD  632
            L+S+     +R++ I  + + +D S    V G  ++VE +  D
Sbjct  61   LVSNICKYEIRDNNIIHALNPKDESTNKKV-GIVSEVEHNDVD  102



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV-EVQEK  407
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P  V    EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFEK  60

Query  408  KP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            KP S + LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+
Sbjct  61   KPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  108



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 8/105 (8%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC---PSRKRARITGPFVVEVQEKK  410
            MPTL+NY+GDD+F   S     D    L +      C     R RA +  PF     +  
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPVSSRINVCFQPNKRVRANLKIPF--RRDDTN  55

Query  411  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R  E
Sbjct  56   PSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIRVEE  100



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLA-GSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQEKK  410
            M  + ++SG++DF   G +  +  D+ L+LSLG   D Y P  KR+R+  P      E+K
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEEK  60

Query  411  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            P SI+ LP+ECLFEIFRRLSG +ER++ A VS+ WL L++S+R SE+
Sbjct  61   PVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL  107



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query  306  DLGLMLSL-GHADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  479
            D  L+LSL    DVY P  KR R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  25   DASLLLSLISFGDVYFPPSKRQRVVLPTLFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  84

Query  480  RSSAACVSKRWLMLMSSVRNSEI  548
            RS+ A VSK+WL  +SS+R  EI
Sbjct  85   RSACAFVSKQWLTTVSSIRQKEI  107



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 8/132 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVV-----EV  398
            M  + ++SG+DDF  G  +     +  L LSLG +  Y   +KR+R++  F +     + 
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFSLQKRSRVSVSFDINREWFDE  60

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q+++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  D +
Sbjct  61   QKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEICSNGSTGDYN  120

Query  579  I-ADXVNGASND  611
            +  D   G SN+
Sbjct  121  VGGDDDQGFSNE  132



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 9/104 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPF-VVEVQEKKP  413
            M  + ++SGD+DF  G ++        LS G    VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEDFFNGGTM-------HLSPGSCPGVYLPPRKRLRVAAPSPYSAFNQKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (63%), Gaps = 9/104 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  413
            M  + +++GD++F  G S+        LS G  + VY P RKR R++ P       +K+ 
Sbjct  1    MSGIFSFNGDEEFFNGGSM-------YLSPGSCSGVYLPPRKRLRVSTPSLYSSFNQKQT  53

Query  414  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANE  97



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 9/103 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  407
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  408  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV  533
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 9/103 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  407
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  408  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV  533
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  342  VYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  518
            VY   RKR R+  PFV   + K  PSI+ALPDECLFEI RRL G  E+S+ ACVSKRWLM
Sbjct  1    VYSLQRKRCRVNAPFVASREFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLM  60

Query  519  LMSSVRNSEIFRSKSHQDL  575
            L+SS+   E + +++ ++ 
Sbjct  61   LLSSISRDESYTTEALREF  79



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 10/106 (9%)
 Frame = +3

Query  264  GDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKPSIEALPDE  437
            GD+DF  G S+ +      LS G    VY P+RKR RI    V    ++K+ SI+ LPDE
Sbjct  5    GDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEQKQTSIDVLPDE  58

Query  438  CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  575
            CLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QDL
Sbjct  59   CLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV--CESVQDL  102



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  336  ADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRW  512
             DVY P RK++R++ P V    E++P SI+ LPDECLFEIFRR+ G +ER + A VSKRW
Sbjct  36   VDVYFPPRKKSRVSAPLVARAFEQEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRW  95

Query  513  LMLMSSVRNSEI  548
            L L+SS+   E+
Sbjct  96   LNLLSSIHQDEL  107



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 65/108 (60%), Gaps = 11/108 (10%)
 Frame = +3

Query  258  YSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEKKPSIEA  425
            +SG+D+   G S   +      ++ H DVY P  KR R+  PFV+      Q  + SI  
Sbjct  8    FSGEDELYGGRSSNPS------AMSHVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINV  61

Query  426  LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            LPDEC+FE+FRRL   +ERS+ ACVSK+WL +++ +R SE+  + S Q
Sbjct  62   LPDECMFEVFRRLPP-QERSNCACVSKQWLTILTGIRRSEMSSTLSVQ  108



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 61/104 (59%), Gaps = 11/104 (11%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP----FVVEVQE  404
            M  +   SGDD+F  G         + LS G    VY P+RKR R+       F    +E
Sbjct  1    MSGIFRISGDDEFFTG-----GGSSMHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEE  55

Query  405  KKPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV  533
            K+ SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+
Sbjct  56   KQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSI  99



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 8/116 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  401
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  402  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI  + S
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEICSNAS  116



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 8/116 (7%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  401
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  402  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  563
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI  + S
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEICSNAS  116



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 72/141 (51%), Gaps = 34/141 (24%)
 Frame = +3

Query  240  MPTLVNYSGDDDFL-AGSSLCSADLGLMLSL---GHADVYCPSRKRARITGPFVVEVQEK  407
            MP L N  G  +F  A  S+C   L L  S     + DVY P  KRAR++        E 
Sbjct  1    MPALANCCGAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLS--------ES  52

Query  408  KP------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
            +P      SIE LPDECLFEI RRL G +ER  ++CVS+RWL +++ +R SE        
Sbjct  53   EPEATDRSSIEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIRLSEF-------  105

Query  570  DLSIADXVNGASNDVEMSPAD  632
                      A NDV+M P+D
Sbjct  106  ---------SACNDVDMVPSD  117



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  336  ADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRW  512
             D Y P  KR R++ P    V E+ P SI+ LPDECLFE+FRRL G +ERS  A VSKRW
Sbjct  36   VDAYFPPCKRTRVSAPTAFSVFEQDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRW  95

Query  513  LMLMSSVRNSEI  548
            L L+S +R  E+
Sbjct  96   LNLLSGIRPDEL  107



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 12/126 (10%)
 Frame = +3

Query  240  MPTLVNYSGDDDFL-AGSSLCSA--DLGLMLSLG-HADVYC-PSRKRARITGPFV-----  389
            MP L NY G  +   AG S+C    +LG +L  G +A VY  P  KRARI+   +     
Sbjct  1    MPALANYCGTGELHNAGGSICKTQLNLGKLLYTGDNAGVYYYPPNKRARISSSVLSVESE  60

Query  390  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  569
             EV E++ SIE LPDECLFEI RRL   +ER  + CVSKRWL +++S+R SE F + +  
Sbjct  61   TEVSEQQ-SIEILPDECLFEILRRLPRVKERCLSLCVSKRWLNVLTSMRLSE-FSACNDV  118

Query  570  DLSIAD  587
            D+ +++
Sbjct  119  DMVLSE  124



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP---FVVEVQE  404
            M  + +++G+ +F   GS+   A++   LSLG   D Y P  KR+R+      F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANI--FLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEEE  58

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            K  SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+
Sbjct  59   KPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  106



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  578
            Q  +PS++ALPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+ ++ +    S
Sbjct  66   QPPQPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASELGQATAAAPPS  125

Query  579  IAD  587
            + D
Sbjct  126  LPD  128



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLAGSSLC----SADLGLMLSLGHADVYCPSRKRARI--TGPFVVEVQ  401
            M  + +++G++DF    ++      A+L L L+      Y P  KR+R+  T P +    
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  402  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            E KP SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L++S++ +EI
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEI  110



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+
Sbjct  62   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  111



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+
Sbjct  54   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  103



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 10/109 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  404
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  405  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 10/109 (9%)
 Frame = +3

Query  240  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  404
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  405  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+
Sbjct  61   QPPQPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSEL  110



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+
Sbjct  351  QPPQPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISEL  400



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 14/83 (17%)
 Frame = +3

Query  357  RKRARITG--PFVV------------EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAA  494
            RKRAR+T   P V             +   + PS++ALPDECLFEI RR+ G R R ++A
Sbjct  29   RKRARVTAVPPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASA  88

Query  495  CVSKRWLMLMSSVRNSEIFRSKS  563
            CVS+RWL L+  +R SEI R+++
Sbjct  89   CVSRRWLALLGGIRASEIKRAEA  111



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +3

Query  315  LMLSLGHA-DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSA  491
            L LS G   +V  P RKR  +T       Q   PSIE L DECLF++F+ L  G+ERS  
Sbjct  14   LFLSRGQNRNVNFPPRKRICVTTASKNFEQRNHPSIEILLDECLFKVFKHLPSGKERSVC  73

Query  492  ACVSKRWLMLMSSVRNSEI  548
            ACVSKRWL L+SS+R  +I
Sbjct  74   ACVSKRWLTLLSSIRKDKI  92



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI--FRSKSHQD  572
            + ++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  +++
Sbjct  104  RSQRTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGSTGNEN  163

Query  573  LSIAD  587
              I+D
Sbjct  164  QEISD  168



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            + ++PS++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE
Sbjct  41   RREEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASE  89



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR  554
            + PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKR  122



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  405  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR  554
            + PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKR  122



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  572
            Q + PS++ALPDECLFEI RR+ G   R +AACVS+RWL L+ S+R SE  ++ +  D
Sbjct  56   QRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSEFGQAAAAAD  111



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  408  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            +PS++A+PDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE
Sbjct  43   EPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  417  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  545
            ++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = +3

Query  354  SRKRARITG----PFVVEVQEK------------KPSIEALPDECLFEIFRRLSGGRERS  485
            SRKRAR+T      F   V+E+             PS++ALPDECLFEI RR+ G R R 
Sbjct  27   SRKRARVTAVPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARC  86

Query  486  SAACVSKRWLMLMSSVRNS  542
            ++  VS+RWL L+ +  +S
Sbjct  87   ASGAVSRRWLALLGAFGDS  105



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +3

Query  411  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADX  590
            PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ ++ +  D      
Sbjct  66   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAADTPSLPD  125

Query  591  VNG----ASNDVEMSPAD  632
            +N        D E SPAD
Sbjct  126  LNEEFVMEEEDKEESPAD  143



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +3

Query  351  PSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSS  530
            P++KR+R     + +    +  I  LPDEC++EIFR L   R+R   A VSK+WL + + 
Sbjct  55   PNKKRSRHQETSISDKISTQDLISYLPDECIWEIFRYLPSTRDRCCCAAVSKKWLAIQAK  114

Query  531  VRNSEIFRSK  560
            +R SE F+SK
Sbjct  115  MRISE-FKSK  123



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  411  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+
Sbjct  63   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  108



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  399  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI  548
            Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+
Sbjct  162  QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  211



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +3

Query  381  PFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  560
            P        K  I  LPDEC+ EIFR L   R+R S   VSKRWL L +++R SE+    
Sbjct  63   PVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMRISELKSDP  122

Query  561  SHQDLSIADXVNGA-SNDVEMS  623
              ++  I++ + G  +ND  ++
Sbjct  123  KSRNNKISECLQGKNANDTRLA  144



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 15/131 (11%)
 Frame = +1

Query  166  VVLILLQNLIFFALSLGVSSEKKQ---------PCLLLLITVVMMT-SLLGAHCALQIWA  315
            +++  L +L  FAL  G+S  ++Q          CL  LI+VV  T SL G +  +    
Sbjct  10   LIVFFLVDLAVFALGRGLSGLRRQLGFDQLCSATCLKCLISVVTRTFSLGGRYTQIPRSQ  69

Query  316  SCYLLVMRMFTAPLESGRGLPA--HLLL---KFRKRNHPSKLFLMNASLRSLDVCLGAVK  480
             C+  +  M+       RGL +  H+ L        + P K F MNASLRS  VC+G  +
Sbjct  70   ICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLSGSSPPLKFFQMNASLRSSGVCMGVQR  129

Query  481  GVPPLVFPSAG  513
             VP LV+ +AG
Sbjct  130  KVPVLVYLNAG  140



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  411  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVR  536
            PS++ALPD CLFEI RR+ GGR R ++ACVS+RWL L+ S+R
Sbjct  65   PSLDALPDGCLFEILRRVPGGRGRGASACVSRRWLALLGSIR  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500