BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS108G06

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            171   6e-46   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       170   1e-45   Nicotiana tomentosiformis
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       157   6e-41   Sesamum indicum [beniseed]
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   3e-40   Vitis vinifera
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     155   3e-40   Eucalyptus grandis [rose gum]
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      155   3e-40   Gossypium arboreum [tree cotton]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    155   3e-40   Eucalyptus grandis [rose gum]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   8e-40   Solanum tuberosum [potatoes]
gb|KJB65824.1|  hypothetical protein B456_010G114900                    153   9e-40   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                    153   1e-39   Gossypium raimondii
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       150   2e-38   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      144   2e-36   Gossypium arboreum [tree cotton]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    143   3e-36   Gossypium raimondii
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                141   3e-35   Erythranthe guttata [common monkey flower]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         140   4e-35   Jatropha curcas
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             140   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   1e-34   Nelumbo nucifera [Indian lotus]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     140   1e-34   Vitis vinifera
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   2e-34   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   2e-34   Populus euphratica
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             138   2e-34   Citrus clementina [clementine]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       138   3e-34   Populus euphratica
emb|CBI21043.3|  unnamed protein product                                137   4e-34   Vitis vinifera
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    137   7e-34   Glycine max [soybeans]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    137   8e-34   Gossypium raimondii
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  137   8e-34   Cucumis sativus [cucumbers]
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             136   2e-33   
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   Citrus sinensis [apfelsine]
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             134   5e-33   Phaseolus vulgaris [French bean]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            133   1e-32   Glycine soja [wild soybean]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    133   2e-32   
ref|XP_002515516.1|  grr1, plant, putative                              133   3e-32   Ricinus communis
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            133   3e-32   Sesamum indicum [beniseed]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   1e-31   
ref|XP_002308665.2|  grr1 family protein                                130   2e-31   
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       130   2e-31   Vitis vinifera
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   3e-31   
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   4e-31   Cucumis sativus [cucumbers]
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002524506.1|  grr1, plant, putative                              129   5e-31   Ricinus communis
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   1e-30   Cucumis melo [Oriental melon]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    128   1e-30   Glycine max [soybeans]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   2e-30   Fragaria vesca subsp. vesca
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   2e-30   Populus euphratica
ref|XP_003588766.1|  Ein3-binding f-box protein                         127   3e-30   Medicago truncatula
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       127   3e-30   
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       127   3e-30   
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             125   4e-30   Prunus persica
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   5e-30   
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   1e-29   Cicer arietinum [garbanzo]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         125   1e-29   Jatropha curcas
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    124   1e-29   Prunus mume [ume]
emb|CBI28209.3|  unnamed protein product                                124   2e-29   Vitis vinifera
gb|AFT92041.1|  EIN3 binding F-box 1                                    123   3e-29   Malus domestica [apple tree]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   3e-29   Populus euphratica
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    123   3e-29   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    123   3e-29   
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            123   7e-29   Cucumis melo [Oriental melon]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   7e-29   Pyrus x bretschneideri [bai li]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    123   8e-29   Gossypium raimondii
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   1e-28   
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             122   2e-28   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   2e-28   
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       121   3e-28   Cucumis sativus [cucumbers]
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   4e-28   
gb|KJB54023.1|  hypothetical protein B456_009G017100                    121   4e-28   Gossypium raimondii
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       119   6e-28   Glycine max [soybeans]
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      120   6e-28   Gossypium arboreum [tree cotton]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   7e-28   Glycine max [soybeans]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       120   9e-28   
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             118   1e-27   Phaseolus vulgaris [French bean]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            120   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    119   2e-27   
gb|KHN07078.1|  EIN3-binding F-box protein 1                            117   2e-27   Glycine soja [wild soybean]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             115   4e-27   Phaseolus vulgaris [French bean]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       117   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   1e-26   Eucalyptus grandis [rose gum]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             114   2e-26   Phaseolus vulgaris [French bean]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             116   2e-26   Capsella rubella
ref|XP_002880682.1|  ein3-binding F box protein 1                       116   2e-26   
ref|NP_565597.1|  EIN3-binding F-box protein 1                          116   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    113   3e-26   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    113   3e-26   
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   4e-26   Nicotiana tomentosiformis
gb|EPS63879.1|  f-box family protein                                    112   2e-25   Genlisea aurea
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   3e-25   Eucalyptus grandis [rose gum]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    112   4e-25   Arabis alpina [alpine rockcress]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   5e-25   Tarenaya hassleriana [spider flower]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     110   6e-25   Eucalyptus grandis [rose gum]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   9e-25   Sesamum indicum [beniseed]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                107   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       107   2e-24   Cicer arietinum [garbanzo]
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   4e-24   Solanum tuberosum [potatoes]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          110   5e-24   Amborella trichopoda
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   5e-24   Nicotiana sylvestris
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             109   7e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010086585.1|  hypothetical protein L484_002248                   107   7e-24   Morus notabilis
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             108   2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   2e-23   Solanum lycopersicum
gb|AES73649.2|  EIN3-binding F-box-like protein                         103   3e-23   Medicago truncatula
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       104   4e-23   Glycine max [soybeans]
ref|XP_003603398.1|  Ein3-binding f-box protein                         102   4e-23   
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             106   6e-23   Phaseolus vulgaris [French bean]
emb|CAN83761.1|  hypothetical protein VITISV_043743                     105   7e-23   Vitis vinifera
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   1e-22   Solanum tuberosum [potatoes]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       105   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             102   2e-22   
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       100   2e-22   Solanum lycopersicum
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             104   4e-22   Capsella rubella
gb|KJB07737.1|  hypothetical protein B456_001G042600                  99.8    5e-22   Gossypium raimondii
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     98.6    7e-22   Nicotiana tomentosiformis
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       101   2e-21   Brassica rapa
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     98.2    2e-21   
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            101   3e-21   Tarenaya hassleriana [spider flower]
emb|CDX76980.1|  BnaC04g37750D                                          101   3e-21   
emb|CDP10419.1|  unnamed protein product                              96.3    3e-21   Coffea canephora [robusta coffee]
gb|AFU61111.1|  F-box protein                                         96.3    3e-21   Capsicum annuum
emb|CDY19807.1|  BnaA09g04600D                                          100   4e-21   Brassica napus [oilseed rape]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   4e-21   Phoenix dactylifera
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     95.9    5e-21   Nicotiana sylvestris
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    96.3    5e-21   Gossypium arboreum [tree cotton]
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   9e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002874252.1|  ein3-binding F box protein 2                     99.4    2e-20   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           95.1    2e-20   
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 95.1    2e-20   Citrus sinensis [apfelsine]
gb|KEH32122.1|  EIN3-binding F-box-like protein                       93.6    4e-20   Medicago truncatula
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     98.2    6e-20   Phoenix dactylifera
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     98.2    7e-20   Elaeis guineensis
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.8    7e-20   Elaeis guineensis
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.3    9e-20   Fragaria vesca subsp. vesca
emb|CDX87090.1|  BnaC09g04050D                                        95.5    1e-19   
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES91540.2|  EIN3-binding F-box-like protein                       91.3    2e-19   Medicago truncatula
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.3    3e-19   
gb|KEH32121.1|  EIN3-binding F-box-like protein                       90.1    5e-19   Medicago truncatula
ref|XP_003609343.1|  Ein3-binding f-box protein                       89.4    7e-19   
ref|XP_003609344.1|  Ein3-binding f-box protein                       89.4    8e-19   
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          94.0    1e-18   Brassica rapa
emb|CDY35358.1|  BnaA04g14890D                                        94.0    1e-18   Brassica napus [oilseed rape]
gb|KJB07621.1|  hypothetical protein B456_001G033400                  93.2    3e-18   Gossypium raimondii
gb|ACB59221.1|  F-box protein                                         93.2    3e-18   Brassica oleracea
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.4    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.7    1e-17   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_197917.1|  EIN3-binding F-box protein 2                        90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25485.1|  unknown                                               89.0    6e-17   Picea sitchensis
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.6    9e-17   Cucumis sativus [cucumbers]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.6    1e-16   Cucumis melo [Oriental melon]
emb|CDX88173.1|  BnaA06g27640D                                        88.2    1e-16   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          88.2    1e-16   Brassica rapa
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     88.2    1e-16   Camelina sativa [gold-of-pleasure]
gb|AEK81539.1|  EIN3 binding F-box 1                                  87.8    2e-16   Dianthus caryophyllus [carnation]
dbj|BAH20224.1|  AT2G25490                                            87.0    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     87.0    3e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13515.1|  unnamed protein product                              80.9    1e-15   Coffea canephora [robusta coffee]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              84.7    2e-15   Erythranthe guttata [common monkey flower]
emb|CDX80503.1|  BnaC07g29410D                                        83.6    5e-15   
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     79.7    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237471.1|  grr1 protein                                     73.6    2e-14   
gb|EPS63568.1|  ein3-binding f-box protein 3                          81.6    2e-14   Genlisea aurea
gb|EMT19526.1|  hypothetical protein F775_07091                       68.6    3e-10   
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.4    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.0    1e-09   Tarenaya hassleriana [spider flower]
dbj|BAD15849.1|  putative F-box protein                               64.7    8e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88579.1|  predicted protein                                    64.7    9e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY84905.1|  hypothetical protein OsI_06273                        64.3    9e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     64.3    1e-08   Brachypodium distachyon [annual false brome]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          63.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     61.2    9e-08   Setaria italica
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  58.9    5e-07   
gb|EAZ01599.1|  hypothetical protein OsI_23635                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAD35544.1|  putative F-box protein Fbl2                          57.8    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147557.1|  LOC100281166                                     56.6    3e-06   Zea mays [maize]
ref|XP_009414462.1|  PREDICTED: EIN3-binding F-box protein 1-like     56.2    4e-06   
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        55.1    1e-05   
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     54.7    2e-05   Oryza brachyantha
ref|XP_004240647.1|  PREDICTED: pentatricopeptide repeat-containi...  53.9    2e-05   Solanum lycopersicum
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           43.1    3e-05   
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        50.1    5e-04   Sorghum bicolor [broomcorn]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  49.7    7e-04   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  49.7    7e-04   



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   171 bits (433),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 94/168 (56%), Positives = 111/168 (66%), Gaps = 5/168 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG + F PGG +YPS K+S  FLSL   VD YFPPCKR+RV  P++  E  + 
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTE--KQ  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            KK P+I+VLPDECLFEV RRV DGKERSACAC SKRWLMLLSS+R  E   +K    SE 
Sbjct  59   KKLPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIRGYETVVSKPSPSSET  118

Query  446  KEMS-DSGMKADIKSDKDGLVQSP--VAESKAAYQDAKDEGYLSRCLD  580
            +E S  S     + S K G V  P  V  +    QD + EG+LSRCLD
Sbjct  119  EERSIQSAPVKPVDSIKKGEVVDPNGVEVADIETQDIEGEGHLSRCLD  166



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   170 bits (430),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 93/168 (55%), Positives = 110/168 (65%), Gaps = 5/168 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG   F PG  +YPS K+S  FLSL   VD YFPPCKR+R+  P++  E  + 
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTE--KQ  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            KK P+I+VLPDECLFEVFRRV DGKERSACAC SKRWLMLLSS+R DE   +K    SE 
Sbjct  59   KKLPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDETVVSKPSPSSET  118

Query  446  KEMS-DSGMKADIKSDKDGLVQSP--VAESKAAYQDAKDEGYLSRCLD  580
            +E S  S     +   K G V  P  V  +    QD + EG+LSRCLD
Sbjct  119  EERSIRSAPIKPVDCIKKGEVVEPNGVEVADVETQDIEGEGHLSRCLD  166



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   157 bits (396),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 84/169 (50%), Positives = 111/169 (66%), Gaps = 7/169 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F+F G ++F PGG +Y + K++G FL L   VD YFPP KR+R+  P V   G+  
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVV-SGV-A  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            K++P+IE+LPDECLFEVFRR+  G ERSACAC SKRWLMLLSS+ RDEI +  +    EP
Sbjct  59   KQQPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEICTTVTTHFVEP  118

Query  446  KEMSDSGMKAD--IKSDKDGLVQSP--VAESKAAYQDAKDEGYLSRCLD  580
            +  S+S  KAD   +  + G    P  +      +Q+A   GYLSRCL+
Sbjct  119  ENRSES-QKADEFAQPKEKGEFDCPNGIKPEDEEFQEADSHGYLSRCLE  166



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   155 bits (391),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 82/168 (49%), Positives = 117/168 (70%), Gaps = 7/168 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI SNK+    +
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLK  120

Query  443  PKE--MSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            PKE  +S +  ++     K G   +P    +A   + + +GYLSRCL+
Sbjct  121  PKETLISRNTDESSEAKKKGGDEVTP----EAVDLEIESDGYLSRCLE  164



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   155 bits (391),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 17/166 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R DE+  NK+  P  
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPL-  119

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             K   + G   +I  D+   +              KD+GYL+R L+
Sbjct  120  -KREDNPGENEEISGDEPPAI--------------KDDGYLTRVLE  150



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 16/165 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG ++F PGG +YP+ K+S  F   +P  D YFPPCKR RV +P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFF--YPNQDVYFPPCKRCRVSSPFVFAGGKFE  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +KKP+IE+LPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI  NK+ Q S+ 
Sbjct  59   QKKPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEIDDNKTTQASDL  118

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  S         +DK G V S   +S     D + +GYLSR LD
Sbjct  119  EYES---------TDKKGGVSSEDVDS-----DVEGDGYLSRSLD  149



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   155 bits (391),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 17/166 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+FEF+G  +F PGG +YP+ K++  FLSL   VD YFP CKR+R+  P V + + L+
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KKK +I+VLPDECLFE+FRR+  G+ERSACAC SKRWLMLLS++R DE+  NK+  P  
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPL-  119

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             K   + G   +I  D+   +              KD+GYL+R L+
Sbjct  120  -KREDNPGENEEISGDEPPAI--------------KDDGYLTRVLE  150



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   154 bits (388),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 87/169 (51%), Positives = 111/169 (66%), Gaps = 7/169 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG + F+ GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTE--KK  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS---NKSIQP  436
            +K  +I+VLPDECLFEV RR+ DGKERSA AC SKRWLMLLSS+  DE      N S++ 
Sbjct  59   QKLSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDETVISDLNPSLE-  117

Query  437  SEPKEMSDSGMKADIKSDKDGLVQSPVAE-SKAAYQDAKDEGYLSRCLD  580
            +E + +  + +K      K  ++ S  AE + A  QD + EG+LSRCLD
Sbjct  118  TEERSIQTALVKPVDCVKKGEVLDSNGAEVADAESQDIEGEGHLSRCLD  166



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 108/165 (65%), Gaps = 16/165 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI  N++ Q S+ 
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDL  118

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  +         +DK G V S   +S     D + +GYLSR LD
Sbjct  119  EHEN---------TDKKGGVSSEDVDS-----DVEGDGYLSRSLD  149



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 108/165 (65%), Gaps = 16/165 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG ++F PGG +YP+ K+S  FL  +P  D YFPPCKR R+  P V   G   
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFL--YPNQDVYFPPCKRYRISAPFVFAGGKFE  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +KKP+IEVLPDECLFE+FRR+  G+ERS CAC SKRWL L+S++RRDEI  N++ Q S+ 
Sbjct  59   QKKPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDL  118

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  +         +DK G V S   +S     D + +GYLSR LD
Sbjct  119  EHEN---------TDKKGGVSSEDVDS-----DVEGDGYLSRSLD  149



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   150 bits (378),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 108/172 (63%), Gaps = 17/172 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG +    GG +YPS K+S  FLSL   VD YFPPCKR+RV  P V  E  + 
Sbjct  1    MSKVFNFSGDH----GGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSE--KK  54

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE-IFSNKSIQPSE  442
             K  +I+VLPDECLFEV RR+ DGK+RSA AC SKRWLMLLSS+R DE + SN    P+ 
Sbjct  55   HKLSSIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDETVISN----PNP  110

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAA------YQDAKDEGYLSRCLD  580
              E  +  ++  +    D + +  V +S AA       QD + EG+LSRCLD
Sbjct  111  SLETEERSIQTALVKSVDCVKKGEVVDSNAAEVAEAESQDIEGEGHLSRCLD  162



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   144 bits (363),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 80/165 (48%), Positives = 102/165 (62%), Gaps = 15/165 (9%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG ++F PGG MYP+ K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R DEI  NK+ Q  + 
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEISDNKTTQALDL  120

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               S         +DK G   S V +   A       GYLSR L+
Sbjct  121  NYES---------TDKKGGDVSDVEDEDVA------GGYLSRSLE  150



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 99/165 (60%), Gaps = 28/165 (17%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG + FFPGG +YP+ K+S  F SL   VD YFP  KR+R+  P+V       
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            KK P+IE+LPDECLFE+FRR+  G+ERS+CAC SKRWL L+S++ RDEI  N        
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEINDN--------  112

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                          +K G+V      SK   QD + +GYLSR L+
Sbjct  113  --------------NKGGVV------SKVEDQDVEGDGYLSRVLE  137



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   141 bits (355),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 83/172 (48%), Positives = 105/172 (61%), Gaps = 22/172 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS++ +FSG N F P   +Y + K+S  FLSL   V+ YF P KR+R+  P +     EP
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSG--EP  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            K+KP+IE+LPDECLFEVFRR+  G+ERSACA  SKRWLMLLSS+ +DEI + K     EP
Sbjct  59   KQKPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEICTTK----EEP  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDE-------GYLSRCLD  580
            K  SD   KAD  + K        AE K  + D  +E       GYLSR L+
Sbjct  115  KIGSDLP-KADDSTKK--------AEEKGEFIDLTEECQETDSHGYLSRSLE  157



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   140 bits (354),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            MSK+F F+G ++F PGGP+Y + K++   LSL   VD YFP  KR+R+  P V+  E  E
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ RDE+ S K+ Q   
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDELCSKKTTQLLN  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
             +    +G   D++ + DG +   +   KA
Sbjct  121  -ESAEKNGEAEDLEIEDDGYLSRSLEGKKA  149



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   140 bits (352),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS-NKS-IQP  436
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+ S N+S ++ 
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDELCSQNRSAVKN  120

Query  437  SEPK-EMSDSGMKAD  478
            +E K ++ D  ++ D
Sbjct  121  TEVKSKIEDEEIEGD  135



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   140 bits (352),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 75/171 (44%), Positives = 105/171 (61%), Gaps = 7/171 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V  C+  E
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL+LLSS+RR EI ++K+ Q ++
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEICTSKTTQSAK  120

Query  443  PK-----EMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            P+     +M D   K D K D   +       S     + + EG+L+RCL+
Sbjct  121  PEAGLVPDMGDESSKLD-KEDSLPVSNENGVASVDVDLELESEGHLTRCLE  170



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = +2

Query  110  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIE  286
            G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E K++ +I+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  287  VLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKE--MSD  460
            VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI SNK+    +PKE  +S 
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLKPKETLISR  228

Query  461  SGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  ++     K G   +P    +A   + + +GYLSRCL+
Sbjct  229  NTDESSEAKKKGGDEVTP----EAVDLEIESDGYLSRCLE  264



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS-NKS-IQP  436
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+ S N+S ++ 
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDELCSQNRSAVKN  120

Query  437  SEPK-EMSDSGMKAD  478
            +E K ++ D  ++ D
Sbjct  121  TEVKSKIEDEEIEGD  135



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            MS++FEF+G N+F PGGP+Y + K+   FLSL   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS-NKS-IQP  436
             KK+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL+LLSS+ RDE+ S N+S ++ 
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDELCSQNRSAVKN  120

Query  437  SEPK-EMSDSGMKAD  478
            +E K ++ D  ++ D
Sbjct  121  TEVKSKIEDEEIEGD  135



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 102/165 (62%), Gaps = 23/165 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +IEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++ RDEI   +S++P   
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEI---RSLKPEAE  117

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            K       K ++ SD             A   D + +GYLSR L+
Sbjct  118  K-------KVELVSD-------------AEDPDVERDGYLSRSLE  142



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 101/166 (61%), Gaps = 15/166 (9%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +E + GG  Y +S D G   S+ PRVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
               +P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR+E F N S    E
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNE-FCNSSAAAEE  119

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                   G  A +++D + +       S    ++ + +GYL+R L+
Sbjct  120  K------GTGAPVRNDVEMV-------SCEENREVESDGYLTRSLE  152



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            MSK+F+++G++ F PGG +Y + KDS  FLSL   VD YFPP KR+R+  P VV+ +  E
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
             K++ +I+VLPDECLFE+ RR+ +G+E+SACAC SKRWLMLLSS++RDEI
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEI  110



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   137 bits (345),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+  FSG ++F P G +Y + K++  FLSL P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ + EI  NK+     
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEISVNKNTTVEN  120

Query  443  PKEMSD  460
            P++  D
Sbjct  121  PEKEGD  126



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   137 bits (345),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 77/165 (47%), Positives = 101/165 (61%), Gaps = 15/165 (9%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F FSG ++F PGG +Y + K+S  FLSL   VD YFP  KR+R+  P V       
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +KKP+IEVLPDECLFE+FRR+  G+ERS+CAC SKRWL ++S++R +EI  NK+ Q  + 
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEISDNKTTQALDL  120

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               S         +DK G   S V +   A       GYLSR L+
Sbjct  121  NYES---------TDKKGGDVSEVEDEDVA------GGYLSRSLE  150



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   137 bits (344),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 73/150 (49%), Positives = 93/150 (62%), Gaps = 10/150 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K   +IE+LPDECLFE+FRR+ DGKERSACA  SKRWLMLLS++   E+ S   +   E
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHELKSEDEVASKE  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
             +         DI+ + DG +   +   KA
Sbjct  121  VE---------DIEIESDGYLSRSLEGKKA  141



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +E + GG +Y +S D G   S+  RVD Y P CKRAR+  P +    G E
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
              K+P+IEVLPDECLFE+FRRV +GKERS+CAC SK+WLMLLSS+RR+E  S+K+
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCSSKN  115



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 101/165 (61%), Gaps = 23/165 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+F  SG ++F PGGP+YP+ K+SG  L L P VD YF   KR+R+  P V  E    
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS++ RDEI   +S++P   
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEI---RSLKPESE  117

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            K       K ++ SD             A   D + +GYLSR L+
Sbjct  118  K-------KVELVSD-------------AEDPDVERDGYLSRSLE  142



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   134 bits (338),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 78/168 (46%), Positives = 100/168 (60%), Gaps = 30/168 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+  FSG ++F PGG +Y + K++  FL L P+VD YFPP KR+RV  P V   E  E
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI--FSNKSIQP  436
             K+K +IE LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ +DEI    N S + 
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEICVIKNSSAE-  119

Query  437  SEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                         +IK D D +             +   EGYLSR L+
Sbjct  120  -------------NIKKDGDDV-------------EFGGEGYLSRSLE  141



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+  FSG ++F P G +Y + K++  FL L P+VD YFPP KR+RV TP V   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
             K K ++E LPDECLFE+FRR+  G++RSACAC SKRWLMLLSS+ ++EI  NK+
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEICVNKN  115



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 72/150 (48%), Positives = 92/150 (61%), Gaps = 10/150 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+F FSG  +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++   E+ S   +   E
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHELKSEDVVASKE  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
             +         DI+ + DG +   +   KA
Sbjct  121  VE---------DIEIESDGYLSRSLEGKKA  141



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 105/166 (63%), Gaps = 19/166 (11%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            MSK+  F+G ++F PGG +Y + K+ G FLSL   VD YFP  KR+R+  P V + E  E
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KK+ +IEVLPDECLFE+FRR+  G+ERSACA  SKRWL LLS+L RDE+ S K+ Q   
Sbjct  61   KKKQASIEVLPDECLFEIFRRL-PGEERSACAGVSKRWLGLLSNLSRDELCSKKTTQ---  116

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               + D   K +++            +S+A  Q+ + +GYLSR L+
Sbjct  117  ---LLDESAKKNVE-----------VKSEAEDQEIEGDGYLSRSLE  148



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 104/171 (61%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS++F+F    +F PGG    + K S  FL L   VD YF P KR+R+  P V     EP
Sbjct  1    MSEVFDFKAVGKFCPGG-FLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSG--EP  57

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +++P+I+VLPDECLFEVFRR+  G+ERSACAC SKRWLML+SS+ RDEI ++K+ Q  EP
Sbjct  58   EQQPSIDVLPDECLFEVFRRLPGGQERSACACVSKRWLMLMSSIARDEICNSKTTQFVEP  117

Query  446  KEMS------DSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  S      DS    +  +D +G     +       Q+    GYLSRCL+
Sbjct  118  EIRSSPAVAHDSAKPKEKSNDMNG-----IKSEDEECQENDSHGYLSRCLE  163



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 102/172 (59%), Gaps = 23/172 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGY-F  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q    
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQ----  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD-KESYRC  598
                        KS      Q  V+ +KA  Q+ +  GYLSR L+ KE  RC
Sbjct  115  ----------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLERKEGNRC  150



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 98/166 (59%), Gaps = 24/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KK+ +IE LPDECLFE+FRR+  G ER ACAC SKRWL LLS++ +DE+ S        
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDELCSQNE-----  115

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                          + K+  V+S V +     ++ + +GYLSR L+
Sbjct  116  -------------SAKKNTQVKSEVED-----EEIEGDGYLSRSLE  143



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 102/168 (61%), Gaps = 9/168 (5%)
 Frame = +2

Query  80   IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  256
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  257  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQP  436
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR EI   KS Q 
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQS  120

Query  437  SEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                   D  +   +  D    ++   AE +    D    GYL+RCL+
Sbjct  121  LNESSKLDKELTIPVPDD----IEMISAEDRELGSD----GYLTRCLE  160



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 70/150 (47%), Positives = 94/150 (63%), Gaps = 6/150 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  262
            MSK+  F+G  +F+ G  +Y S K++  FLSL   VD YFPP KR+R+  P V  E L E
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K++ TIEVLPDECLFE+FRR+  G+ERSACAC SKRWL LLS++  +E  S KS    +
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNERSSGKSQNNLD  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
            P    +     ++ S+ DG +   +   KA
Sbjct  121  PTCGGE-----EVSSEDDGFLSRSLEGKKA  145



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   129 bits (324),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 12/168 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G+PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+ EI  ++S   S+
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDE--GYLSRCLD  580
              E S+   +   +SD+  +V           +D +DE  G+L+RCL+
Sbjct  121  MVESSNVEQQ-KTESDEISVVNCD--------EDQEDESNGFLTRCLE  159


 Score = 32.3 bits (72),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  161  KKATDVRLAAIAVGT  175



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   129 bits (325),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 5/168 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  ++G  +F  GG +Y +  DS   LSL P VD Y PP KR+R+  P V   +  E
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS-  439
             KK+ +IEVLPDECLFE+FRR+  G+ERS CAC SKRWL LLSS+RR E++  ++ QP+ 
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVYGIETTQPAK  120

Query  440  -EPKEMSDSGMK-ADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCL  577
             E + +SD   + + +  ++   V S VA S     + + EGY +R L
Sbjct  121  HEGELVSDKTDEFSKLVKEEPASVSSDVA-SVGEDLEVESEGYFTRSL  167



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 98/166 (59%), Gaps = 22/166 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +EF+ GG +  +  D G + S+   VD Y PPCKRAR+ +P +      E
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I+VLPDECLFE+FRR+  GKERSACAC SKRWL LLSS+RR E+ + + +    
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAELCNERIVPGCN  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              EM+ S        D++G ++S              +GYL+R L+
Sbjct  121  DVEMASS-------CDENGEIES--------------DGYLTRSLE  145



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   128 bits (321),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 69/169 (41%), Positives = 96/169 (57%), Gaps = 18/169 (11%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  + G +E++PGG  Y S  D  +FL     VD YF P KRAR+G PVV      E
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +  P+IE LPDECLFE+FR +H  +ERS+CA  SKRWLMLLS++R+ EI  ++S   S+
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  443  PKEMSDSGMKADI---KSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              E S+   +  I     D+D              Q+ +  G+L+RCL+
Sbjct  121  TVECSNVEQQKTISVVNCDED--------------QEDESNGFLTRCLE  155


 Score = 32.3 bits (72),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  157  KKATDVRLAAIAVGT  171



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLE  262
            MSK+F F+G+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++E +SN+S   +E
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETYSNES-TGNE  119

Query  443  PKEMSDSG  466
             +E+SD G
Sbjct  120  NQEISDEG  127



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+F F+G ++F PGG +Y + K++G FLSL  RVD Y+PP KR+R   P V   E  E
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
              K+ +I+VLP+ECLFE+F+R+  G+ERSACAC SK+WL LLS++ RDE F NK+   S
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDE-FCNKNTNLS  118



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            MSK+F F+G N+F PGGP+Y + K+   FLS+   VD YFP  KR+R+  P V  E   E
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
             KK+ +IEVLPDECLFE+FRR+  G ER ACAC SK WL LLS++ +DE+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDEL  110



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MS++F FSG N  F  G +Y + K++  FLSL P+VD Y+PP KR+RV  P V   E  E
Sbjct  1    MSQVFGFSGDN--FCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFE  58

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             K+K +IE LPDECLFE+FRR+  G+ERSA AC SKRWLMLLS++ + EI SNKS   ++
Sbjct  59   QKQKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEICSNKSTSSND  118

Query  443  PKEM  454
              +M
Sbjct  119  ENKM  122



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 22/157 (14%)
 Frame = +2

Query  113  HNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEV  289
            +++F PGGP+Y + KDS  FLSL   VD YFP  KR+R+  P V  E  L+ KKK +I+V
Sbjct  59   NDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDV  118

Query  290  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGM  469
            LPDECLFE+FRR+   +ERSA AC SKRWLMLLS++R++E+ S K+              
Sbjct  119  LPDECLFEIFRRL-PAEERSASACVSKRWLMLLSNIRQEELCSEKT--------------  163

Query  470  KADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             A +KS+ D      +AE K   Q+ + +GYLSR L+
Sbjct  164  SASLKSEDD------IAEEKGEDQEIETQGYLSRSLE  194



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 98/165 (59%), Gaps = 21/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE  59

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            KK+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q    
Sbjct  60   KKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQ----  115

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  116  ----------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  144



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 96/161 (60%), Gaps = 18/161 (11%)
 Frame = +2

Query  98   FEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKP  277
            F   G ++F PGG +YP+ K+S  FLSL   VD YFP  K++R+  P V       +KKP
Sbjct  52   FLSVGSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKP  111

Query  278  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMS  457
            +I+VLPDECLFE+FRR+  G+ERSACAC SKRWL L+S++R+DEI    + Q    K+ S
Sbjct  112  SIDVLPDECLFEIFRRLPGGQERSACACVSKRWLTLVSNIRKDEI----TTQALNLKDES  167

Query  458  DSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                   +  D+D              QD + +GYLSR L+
Sbjct  168  TDKKGGVVSEDED--------------QDVEGDGYLSRSLE  194



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   125 bits (315),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 99/166 (60%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MSK+  F+G+++F PGG +Y + K+   FLS     D +F P KR+R+  P V + EG E
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SKRWL LLS++ RDE  SN +     
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDEFCSNTTNLLLN  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            P++        ++  +KD              Q+ +  GYLSR L+
Sbjct  121  PQD--------EVTGNKD--------------QEVESCGYLSRSLE  144


 Score = 32.3 bits (72),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  146  KKATDVRLAAIAVGT  160



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 66/166 (40%), Positives = 98/166 (59%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              KKP+I+VLPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+ ++  N     S+
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRKVDLCKNPVADNSD  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              EM++         D+D               + +++G+L+RCL+
Sbjct  121  XTEMTN--------GDED--------------XEQENDGFLTRCLE  144



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            MS++F FSG N F P G +Y + K++  F SL  +VD YFPP KR+RV  P V   E   
Sbjct  1    MSQVFGFSGDN-FCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
             K+K +IE LPDECLFE+FRR+  G+ERS+CAC SKRWLMLLS++ + EI SNKS
Sbjct  60   QKQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEICSNKS  114



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 69/166 (42%), Positives = 98/166 (59%), Gaps = 19/166 (11%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +EF+ GG +  +S       S+   VD Y PPCKRAR  +P +      E
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFE  56

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I+VLPDECLFE+FRR+  GKERS+CAC SKRWL+LLSS++R EI  +K++    
Sbjct  57   QNKQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEICESKTLVADN  116

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               +S S     I SD++G ++S              +GYL+R L+
Sbjct  117  EVTVSVSNDVEMISSDENGKIES--------------DGYLTRSLE  148



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   124 bits (311),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 98/166 (59%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV-GTPVVACEGLE  262
            MSK+    G+++F PGG +Y + K+   FLSL    D +F P KR+R+ GT V + EG E
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             KK  +I+VLPDECLFE+F+R+  G+ERSACAC SK WL LLS++ RDE  SN +     
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDEFCSNTNDLSLN  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            P++        ++  +KD              Q+ +  GYLSR L+
Sbjct  121  PQD--------EVTGNKD--------------QEVESCGYLSRSLE  144


 Score = 32.3 bits (72),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  146  KKATDVRLAAIAVGT  160



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +2

Query  80   IPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-  256
            +PMS +  +SG ++F+PGG  Y +  DSG  +S+   +D Y PP KR+R+  P +  E  
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  257  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQ  433
            LE +K+P+I+VLPDECLFE+ RR+  G+ERS+CA  SKRWLMLLSS+RR EI   KS Q
Sbjct  61   LELEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQ  119



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   123 bits (309),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 22/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q    
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQ----  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  115  ----------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  143


 Score = 32.3 bits (72),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  145  KKATDVRLAAIAVGT  159



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+ TP +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI-FSN  421
              K+P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR E  +SN
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCYSN  114



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 22/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q    
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQ----  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  115  ----------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  143


 Score = 32.3 bits (72),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  145  KKATDVRLAAIAVGT  159



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 22/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q    
Sbjct  59   EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQ----  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  115  ----------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  143


 Score = 32.3 bits (72),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  145  KKATDVRLAAIAVGT  159



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   123 bits (308),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 66/166 (40%), Positives = 94/166 (57%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +   SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLMLLSS+R+ ++  +  +  S 
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRKVDLCKSPVVDNSN  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              EM        I  D+D              Q+ +++G+L+RCL+
Sbjct  121  DAEM--------ITGDED--------------QEQENDGFLTRCLE  144


 Score = 32.0 bits (71),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  146  KKATDIRLAAIAVGT  160



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   123 bits (309),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 4/120 (3%)
 Frame = +2

Query  86   MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  259
            M+KIF F+     +FFP  P+YP+ KD+  FLSL P VD Y+P  KR+RV  P V    +
Sbjct  1    MAKIFGFTLKESEDFFPA-PIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEI  59

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS-NKSIQP  436
              KK+ +IEVLPDECLFE+F+R+ D + RS CAC SKRWLMLLSS+  +E +S +++++P
Sbjct  60   LKKKEASIEVLPDECLFEIFKRLPDRETRSLCACVSKRWLMLLSSISGNEFYSASENLKP  119



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   122 bits (306),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC-EGLE  262
            M  +  + G ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              KKP+I+ LPDECLFE+FRR++ GKERS+CA  SK+WLMLLSS+R+ ++  N     S+
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRKVDLCKNPVADNSD  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              EM++         D+D              ++ +++G+L+RCL+
Sbjct  121  DTEMTN--------GDED--------------REQENDGFLTRCLE  144


 Score = 32.0 bits (71),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  146  KKATDIRLAAIAVGT  160



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 31/166 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL-E  262
            M  +  + G ++F+ GG  Y +S D G   S+  +VD Y+PP KRAR+  P V  E L E
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+ +I+VLPDECLFE+F+R+  G+ERS+CAC SK WLMLL S+R+ E  S+K++    
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGEYESSKAV----  116

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             KE +DS       SD                   +D+GYL+RCL+
Sbjct  117  -KENTDS------VSD-------------------EDDGYLTRCLE  136



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 10/139 (7%)
 Frame = +2

Query  119  EFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLEPKKKPTIEVLP  295
            +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E +E K   +IE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  296  DECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKA  475
            DECLFE+FRR+ DGKERSACA  SKRWLMLLS++   E+ S   +   E +         
Sbjct  63   DECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHELKSEDEVASKEVE---------  113

Query  476  DIKSDKDGLVQSPVAESKA  532
            DI+ + DG +   +   KA
Sbjct  114  DIEIESDGYLSRSLEGKKA  132



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACEGLE  262
            M  +  +SG +E + GG  Y +  D G   S+   VD Y P CKRAR+  P +    G E
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
               +P+IEVLPDECLFE+FRRV +GKERS+CA  SK+WLMLLSS+RR E F N +    E
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSE-FCNSNPVAEE  119

Query  443  PKEMS  457
             KE +
Sbjct  120  EKETA  124



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   120 bits (301),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 22/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++  DE  SN       P
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSN-------P  111

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              +S        KS      Q  V+ + +  Q+ ++ GYLSR L+
Sbjct  112  TNLS-------FKS------QDEVSGNNSEDQEVENCGYLSRSLE  143


 Score = 32.3 bits (72),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  145  KKATDVRLAAIAVGT  159



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   120 bits (300),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 22/165 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  FSG ++F PGG +Y + K++G FLSL    D  FPP KR+R+  P V   G   
Sbjct  1    MSKLLGFSGKDDFCPGG-IYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGG-RF  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I+VLPDECLFE+F+R+  G+ERSACAC S+RWL +LS++  DE  SN       P
Sbjct  59   EKEVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSN-------P  111

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              +S        KS      Q  V+ + +  Q+ ++ GYLSR L+
Sbjct  112  TNLS-------FKS------QDEVSGNNSEDQEVENCGYLSRSLE  143


 Score = 32.3 bits (72),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  145  KKATDVRLAAIAVGT  159



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   121 bits (304),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = +2

Query  86   MSKIFEFS--GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGL  259
            M+KIF F+     +FFPG P+YP+ KD+  FLSL  +VD Y+P  KR+RV  P V   G 
Sbjct  1    MAKIFGFTLTESEDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVP-SGE  59

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF-SNKSIQP  436
              KK+ +IEVLPDECLFE+F+R+ + + RS CAC SKRWLMLLSS+  +E + ++++++P
Sbjct  60   ILKKEASIEVLPDECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFYGASENLKP  119



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   120 bits (300),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 64/166 (39%), Positives = 94/166 (57%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG ++F+PGG  Y +  D G  LS+   VD Y PP KRAR+ +   +     E
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K P+I VLPDECLFE+FRR+  GKERS+CA  SK+WLML+SS+ + ++     +  S+
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSIWKVDLCKIPVVDNSD  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              EM        I  D+D              Q+ +++G+L+RCL+
Sbjct  121  DAEM--------ITGDED--------------QEQENDGFLTRCLE  144


 Score = 32.0 bits (71),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  146  KKATDIRLAAIAVGT  160



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   121 bits (303),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+ E  S+K +    
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSKVV----  116

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                     K ++ S+  G V+  ++E        +D+GYL+RCL+
Sbjct  117  ---------KENVGSNS-GDVEMILSE--------EDDGYLTRCLE  144



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   119 bits (297),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 30/166 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPR--SIFEAIEREQ  58

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              + P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ +DEI    S+  + 
Sbjct  59   YYQDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIEGTTSVAET-  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        + SD++              QD  D+GYL+RCLD
Sbjct  118  ------------VSSDEN--------------QDIDDDGYLTRCLD  137


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   120 bits (302),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG ++F+ GG  Y +S D G   S+  +VD Y PP KR R+  P    E  +E
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I+VLPDECL E+F+R+  GKERS+CAC SK WLMLL+S+R+ E  S+K +    
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSKVV----  116

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                     K +  S+  G V+  ++E        +D+GYL+RCL+
Sbjct  117  ---------KENFGSNS-GDVEMILSE--------EDDGYLTRCLE  144



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   118 bits (296),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 95/166 (57%), Gaps = 30/166 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGS-FLSLHPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +E +PGG   P+  + G  + ++   +D Y+PP KR R  +   A E  +
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPR--SIFEAIEREQ  58

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              ++P IEVLPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ +DEI    S+  + 
Sbjct  59   YYQEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIERATSVDET-  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        + SD++              QD +D+GYL+RCLD
Sbjct  118  ------------VSSDEN--------------QDIEDDGYLTRCLD  137


 Score = 32.3 bits (72),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 97/171 (57%), Gaps = 23/171 (13%)
 Frame = +2

Query  71   LPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC  250
            L  I +      SG ++F+ GG  Y +S D G   S+  +VD Y PP KRAR+  P +  
Sbjct  43   LLLITVILFIGISGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFG  102

Query  251  EG-LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
            E   E  K+P+I+VLP+ECLFE+F+R+  G+ERS+CAC SK WLMLL+S+R+ E  S+K 
Sbjct  103  ETEFEQNKQPSIDVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSEYESSKV  162

Query  428  IQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +     KE +D                  V+E        +D+GYL+RCL+
Sbjct  163  V-----KENTD-----------------LVSEDVEMISSDEDDGYLTRCLE  191



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 68/161 (42%), Positives = 94/161 (58%), Gaps = 21/161 (13%)
 Frame = +2

Query  98   FEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKP  277
            +  +G ++F PGG +Y + K++G  LSL    D  FPP KR+R+  P +   G   KK+ 
Sbjct  9    YWLAGKDDFCPGG-IYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEV  67

Query  278  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMS  457
            +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RDE  SN + Q        
Sbjct  68   SINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQ--------  119

Query  458  DSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                    KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  120  ------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  148


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  150  KKATDVRLAAIAVGT  164



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 30/166 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLS-LHPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +E +PGG   PS  + G   S +   +D Y+PP KR+R  + + A EG +
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR--SILEAIEGEQ  58

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              ++P IEVLPDECLFE+FRR+  GKERS CAC SKRWLML+SS+ +DEI    S   + 
Sbjct  59   HYQEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEIERTTSAAET-  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        +  D++              QD + +GYL+RCLD
Sbjct  118  ------------VSPDEN--------------QDIECDGYLTRCLD  137


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLH--PRVDGYFPPCKRARVGTPVV-ACEG  256
            MS+IF+FSG+ EF+ GG +Y + K++GSFLSL     VD YFP  KRAR+  P+V   E 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  257  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQP  436
            LE KK+ +++VLPDECL+E+ RR+   +ERS+CA  SKRWLMLLSS+   ++ +   +  
Sbjct  60   LEQKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSIPSADLCNKFEVVA  119

Query  437  SEPKEMSDSG  466
             E  E+   G
Sbjct  120  EEGDEIESDG  129



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 68/153 (44%), Positives = 88/153 (58%), Gaps = 17/153 (11%)
 Frame = +2

Query  77   PIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV-ACE  253
            P P+S         +F  GG +YP+ KDS  FLSL   VD YFPP KR+R+  P V   E
Sbjct  55   PFPVSS-------EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGE  107

Query  254  GLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQ  433
             +E K   +IE+LPDECLFE+FRR+  GKERSACA  SKRWLMLLS++   E+ S   + 
Sbjct  108  EVESKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHELKSEDVVA  167

Query  434  PSEPKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
              E +         DI+ + DG +   +   KA
Sbjct  168  SKEVE---------DIEIESDGYLSRSLEGKKA  191



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   117 bits (292),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = +2

Query  104  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGLEPKKKP-  277
            FSG+++F+ GGP+YP+ K+   FLSL  +VD Y P  KR+R   P  ++ E  E K+KP 
Sbjct  4    FSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQKPK  63

Query  278  -TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEM  454
             +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ + EI S  S   +E +E+
Sbjct  64   TSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGSTG-NENQEI  122

Query  455  SDSG  466
            SD G
Sbjct  123  SDEG  126


 Score = 32.3 bits (72),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  135  KKATDVRLAAIAVGT  149



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   115 bits (289),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 97/167 (58%), Gaps = 29/167 (17%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  259
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YFP  KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            EPK+K +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++E+ SN S   S
Sbjct  60   EPKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEVCSNGSTGDS  119

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                        ++  D D              Q   +EGYLSR L+
Sbjct  120  ------------NVGGDDD--------------QGFSNEGYLSRSLE  140


 Score = 32.3 bits (72),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  142  KKATDVRLAAIAVGT  156



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   117 bits (294),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P       E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFE-  59

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            KK  + +VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+     + PS  
Sbjct  60   KKPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL----DVVPSNT  115

Query  446  KE  451
             E
Sbjct  116  SE  117



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   115 bits (288),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 92/166 (55%), Gaps = 13/166 (8%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             ++  +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI         E
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  120

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             +EM         K+   G VQ    +     +   ++GYL+RCL+
Sbjct  121  DEEM---------KTSSSGDVQMVSCDVSGGLE---EDGYLTRCLE  154


 Score = 31.6 bits (70),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAA+AVGT
Sbjct  156  KKATDVRLAAVAVGT  170



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   114 bits (284),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 64/167 (38%), Positives = 96/167 (57%), Gaps = 21/167 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTP-VVACEGL  259
            M  +  +SG +E +PG     +  D G   +L   V+GY+  P KRAR+  P +     L
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
               +KP IEVLP+ECLFE+FRR+  GKERS+C+C SKRWLML+S + + EI+ ++++  +
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIYKSENL--T  118

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            E     D  M +    D+D +++              D+GYLSRCL+
Sbjct  119  EGSASCDVEMAS---VDEDLVIE--------------DDGYLSRCLE  148


 Score = 32.3 bits (72),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  150  KKATDVRLAAIAVGT  164



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
             K+ +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E+
Sbjct  60   -KQVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL  107



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   116 bits (291),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V       
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  266  KKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE--IFSNKS  427
            +KKP +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E  + SNK+
Sbjct  58   EKKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKELDVTSNKT  114



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 4/116 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G N+F+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V   G E 
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVF-SGFE-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE--IFSNKS  427
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L+SS+R+ E  + SNK+
Sbjct  59   KKPVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKELDVPSNKT  114



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+IF F+G N+F+  G +YP+ KD+   LSL    D YFPP KR+RV  P +     E 
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIF-SAFE-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL L+SS+R+ EI
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI  107



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   113 bits (282),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 71/178 (40%), Positives = 98/178 (55%), Gaps = 29/178 (16%)
 Frame = +2

Query  47   FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  226
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  227  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRD  406
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RD
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRD  153

Query  407  EIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            E  SN + Q                KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  154  EFSSNTTNQ--------------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  191


 Score = 32.3 bits (72),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  193  KKATDVRLAAIAVGT  207



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   113 bits (282),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 71/178 (40%), Positives = 98/178 (55%), Gaps = 29/178 (16%)
 Frame = +2

Query  47   FRI*PAPDLPPIPMSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRAR  226
            F + P       P+SK       ++F PGG +Y + K++G  LSL    D  FPP KR+R
Sbjct  43   FELHPCQSYLASPVSK-------DDFCPGG-IYTNPKEAGLLLSLGHHADVLFPPRKRSR  94

Query  227  VGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRD  406
            +  P +   G   +K+ +I VLPDECLFE+F+R+  G+ERSACAC SKRWL +LS++ RD
Sbjct  95   ISAPFIFSGGYF-EKEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRD  153

Query  407  EIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            E  SN + Q                KS      Q  V+ +KA  Q+ +  GYLSR L+
Sbjct  154  EFSSNTTNQ--------------SFKS------QDEVSGNKAEDQEVEGCGYLSRSLE  191


 Score = 32.3 bits (72),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  193  KKATDVRLAAIAVGT  207



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   113 bits (283),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 25/166 (15%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  K+AR+  P V     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKKARISGPFVV---EE  53

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K P+IE+LPDECLFE+FRR+  G+ERSA AC SKRWLML S++R  EI S+  I  + 
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEIQSHTDISVAN  113

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              + SD  M   + +D+D  V+               +GYL+RCL+
Sbjct  114  NGDSSDGKM---VSADEDVEVEC--------------DGYLTRCLE  142


 Score = 32.0 bits (71),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  144  KKATDIRLAAIAVGT  158



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   112 bits (280),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 95/168 (57%), Gaps = 10/168 (6%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MSK+  + G  E    G ++P S  S +F       + Y    KR R+  P VA  G E 
Sbjct  14   MSKVLGYGGVCEH-QAGMLFPRSDYSDTFFPFGNHFESYSLQRKRCRISAPFVA--GREV  70

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            K  P+IE+LPDECLFE+FRR+H  KE+S CAC SKRWLMLLSS+R+DE ++ +S+   EP
Sbjct  71   KLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKRWLMLLSSIRKDESYTTESVGHLEP  130

Query  446  KEMSDSGMKADIK---SDKDGL-VQSPVAESKAAYQDAKDEGYLSRCL  577
             E+  +   AD      +K G+   S V E +    D    G+LSR L
Sbjct  131  -EIGFNSNVADYSPTVGEKYGVDCSSSVEEPEVGENDC--HGFLSRYL  175


 Score = 30.8 bits (68),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLA+IA+GT
Sbjct  178  KKATDVRLASIAIGT  192



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G NEF+  G +YP+ KD+   LSL   VD YFPP KR+RV  P V     E 
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEE-  59

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K  +I+VLPDECLFE+FRR+   +ERS+CA  SK WL L+SS+R+ E+     + PS  
Sbjct  60   -KPVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL----DVVPSNK  114

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGY  562
             E  D   +  +    DG   + V  +  A   A   G 
Sbjct  115  SEDGDDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGL  153



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   110 bits (275),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 16/166 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI         E
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             +EM  S    D++     +V S V+         + +GYL+RCL+
Sbjct  118  DEEMKTSS-SVDVE-----MVSSDVS------GGLEGDGYLTRCLE  151


 Score = 31.6 bits (70),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAA+AVGT
Sbjct  153  KKATDVRLAAVAVGT  167



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 58/122 (48%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+IF FSG N+F+  G  YP+ KD    LSL   VD YFPPCKR+RV  P       E 
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEE-  59

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K  +I+VLP+ECLFE+FRR+   +ER+ACA  S+ WL L++S+R+ E+     + PS  
Sbjct  60   -KPVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL----DVVPSSK  114

Query  446  KE  451
             E
Sbjct  115  TE  116



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   108 bits (271),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 94/167 (56%), Gaps = 31/167 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+IF F+G ++F P G +YP+ K++   LSL   VD YFPP K++RV  P+VA    E 
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLVA-RAFE-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRD--EIFSNKSIQPS  439
            ++  +I+VLPDECLFE+FRR+   +ER ACA  SKRWL LLSS+ +D  E+ SNK     
Sbjct  59   QEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWLNLLSSIHQDELEVISNKV----  114

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                             KDG      A       D +  GYLSR L+
Sbjct  115  -----------------KDG------ASKGDGEDDVESNGYLSRSLE  138


 Score = 32.3 bits (72),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  140  KKATDVRLAAIAVGT  154



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   110 bits (275),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 16/166 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            M  +  + G ++FF GG +  SS D     S+   +D Y+PP KRAR+  P  V+    E
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  57

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +   +I  LPDECLFE+FRR+  G+ERSACAC SK WL LLSS+RR+EI         E
Sbjct  58   GEHPSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             +EM  S    D++     +V S V+         + +GYL+RCL+
Sbjct  118  DEEMKTSS-SVDVE-----MVSSDVS------GGLEGDGYLTRCLE  151


 Score = 30.8 bits (68),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAA+AVGT
Sbjct  153  KKATDVRLAAVAVGT  167



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   108 bits (269),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 92/166 (55%), Gaps = 23/166 (14%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFP-GGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +    G ++F+  GG +   S DSG   S+   V+ Y PP KR+R+  P +    L 
Sbjct  1    MPALVNIRGDDDFYSEGGSL--CSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLF  58

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I+VLPDECLFE+FRR+  G+ERSA AC SKRWL +LSS+R  E F+   I   +
Sbjct  59   EDKRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSE-FNRSKIPQGQ  117

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            PK +S                   + ++    +D + +GYL+RC++
Sbjct  118  PKTIS-------------------IEKAVNNTEDIECDGYLTRCVE  144


 Score = 32.3 bits (72),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  146  KKATDVRLAAIAVGT  160



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   107 bits (268),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 93/165 (56%), Gaps = 28/165 (17%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS++F+FS  + F       P+SKDS    +L  RVD YF   KR+R+  P +A  G + 
Sbjct  1    MSEVFDFSDVHTF------CPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIA--GKKS  52

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            K + +IE LPDECLFE+ RR+  G+E +ACAC SKRWLMLLSS+++DE+ ++++ +   P
Sbjct  53   KMQSSIEALPDECLFEILRRLPRGRETNACACVSKRWLMLLSSMKKDEMCTSETTRFVGP  112

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
            +  S+                      K    D    GYLSRCL+
Sbjct  113  EIQSN--------------------PPKPKEDDDVSRGYLSRCLE  137


 Score = 32.3 bits (72),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   107 bits (268),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 64/167 (38%), Positives = 93/167 (56%), Gaps = 32/167 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +   SG +E +PGG M       G   ++   VD Y  P KRAR+  P      +E 
Sbjct  1    MPALVNSSGDDEMYPGGSM----DLGGCLYTISSNVDVYCSPTKRARISAPFTF-GAVEH  55

Query  266  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            K+  KP++E+LPDECLFE+FRR+  GKERS+CAC SKRWLML+S++ + EI         
Sbjct  56   KQDHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEI---------  106

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               E ++S ++  + SD++              +D + +GYLSRCL+
Sbjct  107  ---ERTNSSVEESVSSDEND-------------EDVEGDGYLSRCLE  137


 Score = 31.2 bits (69),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  139  RKATDVRLAAIAVGT  153



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   108 bits (271),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 91/165 (55%), Gaps = 25/165 (15%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P V     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLMLALG-HADIYCPVSKRARISGPFVV---EER  54

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K P+IEVLP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R  +I   +    S  
Sbjct  55   TKNPSIEVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI---RHTNLSAA  111

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               SD    A   +D+D  V+               +GYL+RCL+
Sbjct  112  NGASDDTKMA--SADEDLEVEC--------------DGYLTRCLE  140


 Score = 29.3 bits (64),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RL+A+AVGT
Sbjct  142  KKATDIRLSAMAVGT  156



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 22/166 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSS-KDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-L  259
            MS + ++SG +    GGP+Y S   DS  FLSL P +D Y PP KR+RV  P V  E   
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
              ++KP+++ LPDECLFE+ RRV+  ++RSACAC SK WLML S+++R E+ ++  +  S
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEVVADSKLTCS  118

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCL  577
                              D L       S    ++    GYLSR L
Sbjct  119  ------------------DALANQEDVASFEIEENGDSNGYLSRSL  146



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   106 bits (264),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 95/166 (57%), Gaps = 26/166 (16%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +EF+ GG +   S D G  LSL H +V  Y P  KRAR+  P +     E
Sbjct  1    MPTLVNYSGDDEFYSGGSL--CSADLGLMLSLGHAQV--YCPLRKRARISGPFII---EE  53

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K P+IE+LPDECLFE+FRR+  G++RSA AC SKRWLML S++R  EI  +  +  ++
Sbjct  54   RTKNPSIEILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI-CHTDLSVAD  112

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                SD+ M   + +D+D  V+               +GYL+RCL+
Sbjct  113  NGTSSDAKM---VSADEDVEVEC--------------DGYLTRCLE  141


 Score = 32.0 bits (71),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  143  KKATDIRLAAIAVGT  157



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   109 bits (272),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 79/118 (67%), Gaps = 4/118 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDG-YFPPCKRARVGTPVVACEGLE  262
            MS+IF F+G N+F+  G +YP+ K++   LSL   VD  Y+PPCKR+RV     +     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI---FSNKS  427
              K  +I+VLPDECLFE+FRR+   +ERSACA  SK WL L++S++++EI    SNK+
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEIGADLSNKT  118



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   107 bits (267),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 67/167 (40%), Positives = 88/167 (53%), Gaps = 30/167 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--L  259
            M  +  +SG +EF+ GG   P         S+   VD Y PP KRAR+  P  A EG   
Sbjct  1    MPTLVNYSGDDEFYSGGSCSP--------YSIASHVDLYCPPSKRARISAPF-ALEGSFF  51

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            E  +KP+I+VLPDECLFE+ R V  GKER + AC SKRWLML+SS+RR E+ S       
Sbjct  52   EQAEKPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEMPSKSE----  107

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               E+  SG    +  D+D  +               D+GYL+R L+
Sbjct  108  --NELVSSGDVEMVAFDQDQELNG-------------DDGYLTRSLE  139


 Score = 30.0 bits (66),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAI++GT
Sbjct  141  KKATDIRLAAISIGT  155



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   109 bits (272),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 2/109 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+IF  +G N F P G +YP+ K++   LSL   VD YFPPCKR RV  P      +  
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAF--SVFE  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            +   +I+VLPDECLFEVFRR+   +ERS CA  SKRWL LLS +R DE+
Sbjct  59   QDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWLNLLSGIRPDEL  107



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 75/119 (63%), Gaps = 13/119 (11%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +FFPGG M+ S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFRFSGDEDFFPGGSMHLSPGSC-------PGV--YFPARKRLRIAAPSVQI-GFE-  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
            +K+ +IEVLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+  N+S+Q  E
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV--NESVQDVE  106



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   107 bits (266),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 90/165 (55%), Gaps = 26/165 (16%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS +  +SG NEF+ GG +   S D G  L+L    D Y P  KRAR+  P +     E 
Sbjct  1    MSTLVNYSGDNEFYSGGSL--CSADLGLILALG-HADIYCPVSKRARISGPFIV---EER  54

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K P+IE+LP+ECLFE+FRR+  G+ERSA AC SKRWLMLLS++R  +I   +    S  
Sbjct  55   TKNPSIELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI---RHTNLSAA  111

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               SD    A   SD+D                 + +GYL+RCL+
Sbjct  112  NGASDDTKMA--SSDED---------------QVECDGYLTRCLE  139


 Score = 29.3 bits (64),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RL+A+AVGT
Sbjct  141  KKATDIRLSAMAVGT  155



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   103 bits (256),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 66/167 (40%), Positives = 89/167 (53%), Gaps = 31/167 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  259
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ ++EI SN S    
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEICSNAS----  116

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                   SG K     D D              Q+  DEGYLSR L+
Sbjct  117  -------SGNK-----DSDN-------------QEFGDEGYLSRSLE  138


 Score = 32.3 bits (72),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  140  KKATDVRLAAIAVGT  154



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   104 bits (260),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 71/169 (42%), Positives = 92/169 (54%), Gaps = 25/169 (15%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYF-PPCKRARVGTPVVACE--G  256
            M  +  +SG +E + GG    +  D G   +    VD Y+  P KRAR+   + A E  G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINA-LDAFEFLG  59

Query  257  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIF-SNKSIQ  433
             E  +KPTI+VLPDECLFEVFR +  GKERS+CA  SKRWLML+SS+ + EI  S+K I 
Sbjct  60   REQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEIHKSDKMI-  118

Query  434  PSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                 E S SG       D+D              Q  +D GYL+RCL+
Sbjct  119  -----EGSASGYVEMASVDED--------------QGIEDNGYLTRCLE  148


 Score = 30.4 bits (67),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKAT+VRLAAIAVGT
Sbjct  150  KKATNVRLAAIAVGT  164



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   102 bits (255),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 66/167 (40%), Positives = 89/167 (53%), Gaps = 31/167 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--VACEGL  259
            MSK+  F+G ++F  G  MY + K++  FLSL  +   Y P  KR+R   P      +  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            + K + +IE LPDECLFE+ RR+ +G++RS CA  SKRWL LLSS+ ++EI SN S    
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEICSNAS----  116

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                   SG K     D D              Q+  DEGYLSR L+
Sbjct  117  -------SGNK-----DSDN-------------QEFGDEGYLSRSLE  138


 Score = 32.3 bits (72),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  140  KKATDVRLAAIAVGT  154



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL-  259
            MS++F FSG+++F PGG +YP+ K+   FLSL   VD YF   KR+RV     +  E   
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
            E K++ +IE LPDECLFE+ RR+  G++RS CA  SKRWLMLLSS+ ++EI SN S
Sbjct  60   EQKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEICSNGS  115



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   105 bits (261),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 85/142 (60%), Gaps = 9/142 (6%)
 Frame = +2

Query  158  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHD  334
            DSG  +S+   +D Y PP KR+R+  P +  E  LE +K+P+I+VLPDECLFE+ RR+  
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  335  GKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSP  514
            G+ERS+CA  SKRWLMLLSS+RR EI   KS Q        D  +   +  D    ++  
Sbjct  62   GQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLNESSKLDKELTIPVPDD----IEMI  117

Query  515  VAESKAAYQDAKDEGYLSRCLD  580
             AE +    D    GYL+RCL+
Sbjct  118  SAEDRELGSD----GYLTRCLE  135


 Score = 29.3 bits (64),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+ LAAIAVGT
Sbjct  137  KKATDISLAAIAVGT  151



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   101 bits (251),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 90/165 (55%), Gaps = 28/165 (17%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSL-GHADVYCPPRKRARISGPFVV---EDR  54

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K P++E+LPDECLFE+ RR+  G+ER A AC SKRWL +LSS+R  EI  +KS      
Sbjct  55   SKDPSLEILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEICRSKSYN----  110

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              ++D+ M   I  D+D               + + +GYL+RC++
Sbjct  111  -NLNDAIM---ISKDED--------------LEVECDGYLTRCVE  137


 Score = 32.3 bits (72),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS +F FSG  +FFPGG +Y         LS   ++D Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEDFFPGGSLY---------LSPGSQIDVYYPAHKRSRIAAPAIF-SGFE-  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            + + +I+VLPDECLFE+FR +  G+ERSACAC SKRWL LLS++R +E+
Sbjct  50   QNQVSIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEV  98



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   102 bits (253),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 88/147 (60%), Gaps = 27/147 (18%)
 Frame = +2

Query  158  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG--LEPKKKPTIEVLPDECLFEVFRRVH  331
            D G  LS+      Y+PP KRAR  +   A EG   E  +KP+IEVLPDECLFE+FRR+ 
Sbjct  2    DLGCLLSIGSV---YYPPSKRARKDSQF-AFEGSDFEQVRKPSIEVLPDECLFEIFRRLD  57

Query  332  DGKERSACACTSKRWLMLLSSLRRDEI----FSNKSIQPSEPKEMSDSGMKADIKSDKDG  499
             GKERS+CAC SK+WLMLLSS+R+ ++     ++K IQP +     D+ M      ++D 
Sbjct  58   GGKERSSCACVSKKWLMLLSSIRKVDLCKSPAADKVIQPLKLDNSDDTEMTT---GEED-  113

Query  500  LVQSPVAESKAAYQDAKDEGYLSRCLD  580
                         Q+ +++GYL+RCL+
Sbjct  114  -------------QELENDGYLTRCLE  127


 Score = 30.8 bits (68),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  129  KKATDIRLAAIAVGT  143



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   100 bits (249),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 90/165 (55%), Gaps = 28/165 (17%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  +SG +EF+ GG     S D G  LSL    D Y PP KRAR+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGSF--CSADLGLMLSL-GHADVYCPPRKRARISGPFVV---EDR  54

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K P++EVLPDECLFE+ RR+  G+ER A AC SKRWL +LSS++  EI  +KS      
Sbjct  55   SKDPSLEVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEICRSKSYN----  110

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              ++D+ M   I  D+D               + + +GYL+RC++
Sbjct  111  -NLNDAIM---ISKDED--------------LEVECDGYLTRCVE  137


 Score = 32.0 bits (71),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  139  KKATDIRLAAIAVGT  153



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 75/119 (63%), Gaps = 13/119 (11%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +FF GG MY S           P V  YFP  KR R+  P V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMYLSPGSC-------PGV--YFPAHKRLRIAAPSVF-SGFE-  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
            +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R+E+  ++S+Q  E
Sbjct  50   QKQTSIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV--DESVQDVE  106



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 99.8 bits (247),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 27/166 (16%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG +EFF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDEFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+ E  S+K +    
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYGSSKVV----  112

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             KE  DS                 V+ +       ++ GYL+RCL+
Sbjct  113  -KENIDS-----------------VSYAIETISSNENGGYLTRCLE  140


 Score = 31.6 bits (70),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAA+AVGT
Sbjct  142  KKATDVRLAAVAVGT  156



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 98.6 bits (244),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 86/169 (51%), Gaps = 37/169 (22%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  +SG +EF+ GGP   +              + Y PP KR R+  P V     + 
Sbjct  1    MPTLVNYSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISGPFVV---EDR  43

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
             K P++E+LPDECLFE+ RR+  G+ERSA AC SKRWLMLLSS+R  EI  +KS      
Sbjct  44   SKDPSLEILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEICRSKSQNNLSS  103

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDE----GYLSRCLD  580
             E        ++  D +        ++   Y+D   E    GYL+RC++
Sbjct  104  VE--------EVNGDSN--------DTTMIYKDEDLEVECDGYLTRCVE  136


 Score = 32.3 bits (72),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  138  KKATDVRLAAIAVGT  152



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   101 bits (252),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 75/135 (56%), Gaps = 16/135 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  EFF GG MY S+               Y PP KR RV  P +       
Sbjct  1    MSGIFSFSGDEEFFNGGSMYLSTGSCSGV---------YLPPRKRLRVAAPSLYSS--FN  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++     +N+S+Q  E 
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK-----ANESLQEVES  104

Query  446  KEMSDSGMKADIKSD  490
            +      ++ +  +D
Sbjct  105  EGFLSRSLEGNKATD  119


 Score = 27.7 bits (60),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
             KATD+RLAAI+VGT
Sbjct  115  NKATDLRLAAISVGT  129



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 98.2 bits (243),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 21/138 (15%)
 Frame = +2

Query  170  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  346
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  109  LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  168

Query  347  SACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAES  526
            S  AC SK+WLM+L+S+R+ EI  ++ ++      +SD      +  D+DG         
Sbjct  169  SFAACVSKKWLMMLTSIRKAEICKSEKLEKEVVASVSDH--VEMVSCDEDG---------  217

Query  527  KAAYQDAKDEGYLSRCLD  580
                     +GYL+RCLD
Sbjct  218  ---------DGYLTRCLD  226


 Score = 31.2 bits (69),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  228  KKATDLRLAAIAVGT  242



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 85/165 (52%), Gaps = 46/165 (28%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS +F FSG   +FPGG M          LS    +  Y+P  KR+R+  P +   G E 
Sbjct  1    MSGLFRFSGDEGYFPGGSMC---------LSPGSNIGVYYPARKRSRISAPSLF-SGFE-  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            + + +IEVLPDECLFE+FRR+  G+ERS CAC SK+WL LLS++RR+E            
Sbjct  50   RNQASIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREE------------  97

Query  446  KEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                                    + SK  +Q+ +DEG+LSR L+
Sbjct  98   -----------------------ASGSKDEFQEVEDEGHLSRSLE  119



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV          E 
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEE  57

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            +K  +I+VLPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  58   EKPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  106



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 96.3 bits (238),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 65/168 (39%), Positives = 88/168 (52%), Gaps = 22/168 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLE  262
            M  +  + G ++F+ G  +   S DSG  LS+    D Y PP KR+RV  P  V      
Sbjct  1    MPALVNYGGDDDFYTGRSI--CSADSGLVLSI---ADVYCPPRKRSRVSAPYAVDSRLFN  55

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS-  439
             ++ P+IE LPDECLFE+FRR+   +ERSA AC SKRWLMLLSS+R  E   + S Q   
Sbjct  56   KERNPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSEFCRSNSPQEQL  115

Query  440  EPKEMSDSGMKADIKS-DKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              KE+  +    ++ S D D  +Q                GYL+R L+
Sbjct  116  ATKEVKKTESDVEMNSADGDMEIQC--------------NGYLTRSLE  149


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  151  KKATDVRLAAIAVGT  165



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 96.3 bits (238),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 30/166 (18%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSL-HPRVDGYFPPCKRARVGTPVVACEGLE  262
            M  +  +SG +E + GG     S D G  LSL H  V  Y PP KR+R+  P V     +
Sbjct  1    MPALVNYSGDDELYSGGSF--CSADLGLMLSLGHAEV--YCPPRKRSRISGPFVV---ED  53

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K P+++ LPDECLFE+ RR+  G+ER A +C SKRWLMLLSS+R  EI  +KS     
Sbjct  54   RSKGPSLDDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEICRSKSYT---  110

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
               ++DS M   I  D+D               + + +GYL+RC++
Sbjct  111  --NLNDSTM---ISKDED--------------LEVECDGYLTRCVE  137


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   100 bits (249),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 75/135 (56%), Gaps = 16/135 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF F+G  EFF GG MY S                Y PP KR RV TP +       
Sbjct  1    MSGIFSFNGDEEFFNGGSMYLSPGSCSGV---------YLPPRKRLRVSTPSLYSS--FN  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++     +N+S+Q  E 
Sbjct  50   QKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK-----ANESLQEVES  104

Query  446  KEMSDSGMKADIKSD  490
            +      ++ +  +D
Sbjct  105  EGFLSRSLEGNKATD  119


 Score = 27.7 bits (60),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
             KATD+RLAAI+VGT
Sbjct  115  NKATDLRLAAISVGT  129



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P V   G + 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  266  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNK  424
             +KP     +I+VLPDECLFE+ RR+   +ERS  AC SKRWLMLLSS+R  EI +NK
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEIAANK  118



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 95.9 bits (237),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 61/167 (37%), Positives = 85/167 (51%), Gaps = 33/167 (20%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +   SG +EF+ GGP   +              + Y PP KR R+ +P V     + 
Sbjct  1    MPTLVNHSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISSPFVV---EDR  43

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQ--PS  439
             K P++E+LPDECLFE+ RR+  G+ERSA AC SK WLMLLSS+R  EI  +KS     S
Sbjct  44   SKDPSLEILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEICRSKSHNNLSS  103

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              +   +S     I  D+D  V+               +GYL+RC++
Sbjct  104  VEEVKGNSNDTTMISKDEDLEVEC--------------DGYLTRCVE  136


 Score = 32.3 bits (72),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  138  KKATDVRLAAIAVGT  152



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 96.3 bits (238),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 88/166 (53%), Gaps = 27/166 (16%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG-LE  262
            M  +  +SG ++FF    +  +S + G   S+  + D Y+PP KR R+  P +  E   E
Sbjct  1    MPALVNYSGDDDFF----IRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFE  56

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
              K+P+I  LP EC+FE+F+R+  G+ERS CAC SKRWL LLSS+R+ E  S+  +    
Sbjct  57   QNKQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYRSSNVV----  112

Query  443  PKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             KE  DS                 V+ +       ++ GYL+RCL+
Sbjct  113  -KENIDS-----------------VSYAIETISSNENGGYLTRCLE  140


 Score = 31.6 bits (70),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAA+AVGT
Sbjct  142  KKATDVRLAAVAVGT  156



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 64/171 (37%), Positives = 96/171 (56%), Gaps = 21/171 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  256
            M+ + ++ G+++  PG P Y +  DS   LSL  + D Y PPCKR RV  P++   G   
Sbjct  1    MAALVKYGGNDDICPG-PFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKV  59

Query  257  LEPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQ  433
            ++ +K+P +I+ LPDECLFE+ RR+   KERS  AC SK WLML+SS+R  E+ +     
Sbjct  60   IDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSELAACN---  116

Query  434  PSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLDKE  586
                K   +S     +  + D +V           Q++++ GYL+RCLD E
Sbjct  117  ----KACDESVKNPSLFLNNDVIVDE---------QESENNGYLTRCLDAE  154



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGS------CPGV--YFPARKRLRIAATSVF-SGFE-  50

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+   +S+Q  E
Sbjct  51   QKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEVV--ESVQDLE  107



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +FF GG M+  S  S       P V  YFP  KR R+    V   G E 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHNLSPGS------CPGV--YFPARKRLRIAATSVF-SGFE-  50

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
            +K+ +I+VLPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+   +S+Q  E
Sbjct  51   EKQTSIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEVV--ESVQDVE  107



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 74/120 (62%), Gaps = 14/120 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGP-MYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLE  262
            MS IF FSG  +FF GG  MY S           P V  YFP  KR R+  P V   G E
Sbjct  1    MSGIFRFSGDEDFFLGGSSMYLSPGSC-------PGV--YFPARKRLRIAAPSVF-SGFE  50

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +K+ +I+VLPDECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+  N+S+Q  E
Sbjct  51   -EKQTSIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV--NESVQDVE  107



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 21/138 (15%)
 Frame = +2

Query  170  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  346
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  12   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  71

Query  347  SACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAES  526
            S  AC SK+WLM+L+S+R+ EI  ++ ++      +SD      +  D+DG         
Sbjct  72   SFAACVSKKWLMMLTSIRKAEICKSEKLEKEVVASVSDH--VEMVSCDEDG---------  120

Query  527  KAAYQDAKDEGYLSRCLD  580
                     +GYL+RCLD
Sbjct  121  ---------DGYLTRCLD  129


 Score = 31.2 bits (69),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  131  KKATDLRLAAIAVGT  145



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 21/138 (15%)
 Frame = +2

Query  170  FLSLHPRVDGYFPPCKRARVGTPVVACEG-LEPKKKPTIEVLPDECLFEVFRRVHDGKER  346
              S+   VD Y PP KRAR+     + E   E + +P+I+VLPDECL+E+FRR+  GKER
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFRRLPSGKER  70

Query  347  SACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAES  526
            S  AC SK+WLM+L+S+R+ EI  ++ ++      +SD      +  D+DG         
Sbjct  71   SFAACVSKKWLMMLTSIRKAEICKSEKLEKEVVASVSDH--VEMVSCDEDG---------  119

Query  527  KAAYQDAKDEGYLSRCLD  580
                     +GYL+RCLD
Sbjct  120  ---------DGYLTRCLD  128


 Score = 31.2 bits (69),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD+RLAAIAVGT
Sbjct  130  KKATDLRLAAIAVGT  144



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 93.6 bits (231),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 62/162 (38%), Positives = 87/162 (54%), Gaps = 39/162 (24%)
 Frame = +2

Query  101  EFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--K  274
            +F G  E +PGG M     D+G    ++   D +  P KR R+  P  +   LE ++  K
Sbjct  2    DFPGDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEHEQDLK  53

Query  275  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEM  454
            PTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I              
Sbjct  54   PTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI--------------  99

Query  455  SDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
             +SG++     D D              +DA+ +GYL+R L+
Sbjct  100  -ESGVETVSSDDSD--------------EDAEGDGYLTRRLE  126


 Score = 31.2 bits (69),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  128  RKATDVRLAAIAVGT  142



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  + ++ G ++  P GP++ +  DS   LSL P VD + PP KR+RV  P +   G   
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  266  KKKP-----TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNK  424
             +KP     +I+VLPDECLFE+ R +   +ERS  AC SKRWLMLLSS+R  EI +NK
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEIAANK  118



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 6/120 (5%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  253
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  254  GLEPKKKPT--IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
            G E +K+ +  I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLS++R  E+ ++K+
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEMAAHKN  120



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV----ACE  253
            M  +  + G ++    GP+  +  DS   LSL P VD + PP KR+RV  P +      +
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  254  GLEPKKKP--TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKS  427
            G E +K+   +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+ + K+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAYKN  120



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 91.3 bits (225),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 63/151 (42%), Positives = 86/151 (57%), Gaps = 12/151 (8%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSK-DSGSFLSLHPRVDGYFPPCKRARVGTPV-VACEGL  259
            M  +  +SG +EF+ GG  Y SS  D G  LS+       +PP KRAR+ +   +     
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVGSNA---YPPSKRARISSQFDIRGSSF  57

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            E +KK +IEVLP+ECLFE+FRR+H GKER  CA  SK+WLMLLSS+R  E    K I  S
Sbjct  58   EQEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE----KEIPKS  113

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKA  532
            +  EM+      + + + DG +   +   KA
Sbjct  114  DDTEMTTGD---EDQKETDGFLTRSLEGKKA  141


 Score = 32.3 bits (72),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  139  KKATDVRLAAIAVGT  153



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 95.5 bits (236),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 76/140 (54%), Gaps = 26/140 (19%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +FF GG M+ S           P V  Y PP KR RV  P        P
Sbjct  1    MSGIFSFSGDEDFFNGGTMHLSPGSC-------PGV--YLPPRKRLRVAAP-------SP  44

Query  266  -----KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSI  430
                 +K+ +IEVLPDECLFE+ RR+  GKERSACAC SK WL  L+S++     +N+S+
Sbjct  45   YSAFNQKQTSIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIK-----ANESV  99

Query  431  QPSEPKEMSDSGMKADIKSD  490
            Q  E +      ++ +  +D
Sbjct  100  QEVESEGFLSRSLEGNKATD  119


 Score = 27.7 bits (60),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
             KATD+RLAAI+VGT
Sbjct  115  NKATDLRLAAISVGT  129



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 20/170 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEG---  256
            M+ +    G+++  PGGP++ +  DS   LSL   VD Y PP KR RV  P++   G   
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  257  LEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQP  436
             + K + +I+ LP+ECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+   K    
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSELAQKKPSVE  120

Query  437  SEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLDKE  586
            S  K + D  +  D   D+                ++++ GYL+R LD E
Sbjct  121  SVKKPVPD--LNKDCALDE---------------HESENNGYLTRRLDAE  153



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 91.3 bits (225),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 56/128 (44%), Positives = 73/128 (57%), Gaps = 20/128 (16%)
 Frame = +2

Query  107  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK-----  271
            SG++E  PG   Y  S +          VD +  P KR R+  P     G  P+      
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTF--GPLPRALEHGQ  55

Query  272  --KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSN-KSIQPSE  442
              KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+DEI S  ++I   E
Sbjct  56   DLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEIDSGVETISSDE  115

Query  443  PKEMSDSG  466
             +E +  G
Sbjct  116  SEEDAKGG  123


 Score = 31.2 bits (69),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  133  RKATDVRLAAIAVGT  147



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = +2

Query  101  EFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVV---ACEGLEPKK  271
            +  G ++    GP+  +  DS   LS+   VD +FPP KR+R+  P +     +G E +K
Sbjct  18   KIVGTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQK  77

Query  272  KP--TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNK  424
            +   +I+VLPDECLFE+ RR+   KERS  AC SKRWLMLLSS+R  E+ ++K
Sbjct  78   QQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAHK  130



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 90.1 bits (222),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 63/167 (38%), Positives = 87/167 (52%), Gaps = 39/167 (23%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  1    MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  52

Query  266  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I         
Sbjct  53   EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI---------  103

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                  +SG++     D D              +DA+ +GYL+R L+
Sbjct  104  ------ESGVETVSSDDSD--------------EDAEGDGYLTRRLE  130


 Score = 31.2 bits (69),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  132  RKATDVRLAAIAVGT  146



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 89.4 bits (220),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 85/163 (52%), Gaps = 44/163 (27%)
 Frame = +2

Query  107  SGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC---EGLEPKK--  271
            SG++E  PG   Y  S +          VD +  P KR R+  P         LE  +  
Sbjct  8    SGNDELHPGCRGYTISSN----------VDVHCSPTKRTRISAPFTFGPLPRALEHGQDL  57

Query  272  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKE  451
            KP+IE LPDECLFE+FRR+  GKERS+ AC SKRWLML+SS+R+DEI             
Sbjct  58   KPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI-------------  104

Query  452  MSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
              DSG++  I SD+             + +DAK  G+L+R L+
Sbjct  105  --DSGVET-ISSDE-------------SEEDAKGGGWLTRRLE  131


 Score = 31.2 bits (69),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  133  RKATDVRLAAIAVGT  147



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 89.4 bits (220),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 63/167 (38%), Positives = 87/167 (52%), Gaps = 39/167 (23%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS     S   E +PGG M     D+G    ++   D +  P KR R+  P  +   LE 
Sbjct  52   MSGRVNQSSDVELYPGGSM-----DTGG--RVYAIGDVHCSPTKRPRISVPF-SFGALEH  103

Query  266  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPS  439
            ++  KPTIEVL DECLFE+FRR+  GKERS+ AC SKRWLML+SS+ +D+I         
Sbjct  104  EQDLKPTIEVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDDI---------  154

Query  440  EPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLD  580
                  +SG++     D D              +DA+ +GYL+R L+
Sbjct  155  ------ESGVETVSSDDSD--------------EDAEGDGYLTRRLE  181


 Score = 31.2 bits (69),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            +KATDVRLAAIAVGT
Sbjct  183  RKATDVRLAAIAVGT  197



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  259
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARV--GTPVVACEGL  259
            MS+I+ F+G +EF+  G    + K++  FLSL   VD Y+PPCKR+RV    P +     
Sbjct  1    MSQIYSFAGESEFYRRGS---NPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE  54

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            E +K  +I++LPDECLFE+FRR+   +ER+ACA  SK WL L++S+R+ E+
Sbjct  55   EEEKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL  105



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 93.2 bits (230),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 18/130 (14%)
 Frame = +2

Query  191  VDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSK  370
            +D YFP  KR+R      + E  E +KKP+IEVLPDECLFE+FR +  G+ERS+CAC SK
Sbjct  1    MDVYFPLSKRSRTSA---SGEKFE-QKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSK  56

Query  371  RWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAK  550
            RWL+L+S++ + EI  N  I    PK+ S         + K G+V      S+  + D  
Sbjct  57   RWLILVSNICKYEIRDNNIIHALNPKDES--------TNKKVGIV------SEVEHNDVD  102

Query  551  DEGYLSRCLD  580
             +GY +R L+
Sbjct  103  SDGYFTRNLE  112


 Score = 25.8 bits (55),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATD  LAAIAVGT
Sbjct  114  KKATDGGLAAIAVGT  128



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS+IF F+    F  G     + KD+   LSL    D YFPP KR RV  P +     E 
Sbjct  1    MSQIFSFAVKTIFTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLF-SAFE-  58

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            KK  +I+VLPDECLFE+FRR+   +ERSACA  SK+WL  +SS+R+ EI
Sbjct  59   KKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTTVSSIRQKEI  107



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 94/171 (55%), Gaps = 21/171 (12%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVAC--EGL  259
            M+ +   +G+++  PGGP++ +  DS   LSL    D Y PP KR R+ + +     +  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  260  EPKKKP-TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQ-  433
            + K++P +I+ LPDECLFE+ RR+   KERS  AC SKRWLMLL S+R  E+   K  + 
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSELADRKKHRN  120

Query  434  PSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLDKE  586
             S  K + D  +  D+  D+               Q++++ G+L+R LD E
Sbjct  121  ESVKKPLPD--LNKDVSEDE---------------QESENNGFLTRRLDAE  154



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 3/90 (3%)
 Frame = +2

Query  143  YPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFR  322
            YP+S+ S  FLS     +  FPP KR  V T   A +  E +  P+IE+L DECLF+VF+
Sbjct  6    YPTSRQSSLFLSRGQNRNVNFPPRKRICVTT---ASKNFEQRNHPSIEILLDECLFKVFK  62

Query  323  RVHDGKERSACACTSKRWLMLLSSLRRDEI  412
             +  GKERS CAC SKRWL LLSS+R+D+I
Sbjct  63   HLPSGKERSVCACVSKRWLTLLSSIRKDKI  92



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 91/177 (51%), Gaps = 36/177 (20%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV--------  241
            M+ +  + G ++  P   ++P S     FLS    VD Y PP KRARV  P+        
Sbjct  1    MAALVNYGGGDDLCP---LFPGSS---RFLSPGRNVDVYCPPRKRARVIAPLGFSFRGRE  54

Query  242  -VACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFS  418
             VA E  +P+   +I+ LPDECLFE+ RR+   KERS+CAC SKRWLMLL S+R  E+ +
Sbjct  55   EVAAEKQQPR---SIDTLPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSELAA  111

Query  419  N-KSIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLDKE  586
              K+   S    M D             L +   AE K    + ++ GYL+R LD E
Sbjct  112  RMKTTDESVKTRMPD-------------LSKGVCAEEK----ECENNGYLTRRLDAE  151



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 70/122 (57%), Gaps = 12/122 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            MS IF FSG  +   GG MY S           P V  Y+P  KR RV        G E 
Sbjct  1    MSGIFRFSGDEDCLLGGSMYLSPGSC-------PGV--YYPARKRLRVAATSFY-SGFE-  49

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +K+ +I+VLP+ECLFE+ RR+  G+ERSACAC SK WL LLSS+ R E+ +  S+Q  E 
Sbjct  50   EKQTSIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV-NESSVQDVEE  108

Query  446  KE  451
             E
Sbjct  109  GE  110



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  F G  +F  GGP +    D+  FLSL PR++   PP KR R G   +     +P
Sbjct  1    MPTLVSFRGDEDF--GGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLR-GNVTIPFRETKP  57

Query  266  KK--KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNK  424
            K+  K  I +LPDECLFE+FR +   ++RS  AC SKRWLML SS+RR EI  +K
Sbjct  58   KQEQKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEIKRSK  112



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 77/131 (59%), Gaps = 9/131 (7%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +     L  
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPISSRINVCFQPNKRFRTNLKI---PFLGD  52

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSI-QPSE  442
              KP+I+ LPDECLFE+F+R+ +GK +S+CAC SKRWLMLLSS+R ++  +N  + +  E
Sbjct  53   DTKPSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRMEKTENNGYLTRHLE  112

Query  443  PKEMSDSGMKA  475
             K+ +D  + A
Sbjct  113  GKKATDIRLAA  123



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 79/135 (59%), Gaps = 17/135 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEP  265
            M  +  ++G +EF P      S +D   FL +  R++  F P KR R    +       P
Sbjct  1    MPTLLNYTGDDEFHP-----TSMEDFPCFLPVSSRINVCFQPNKRVRANLKI-------P  48

Query  266  KKK----PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSI-  430
             ++    P+I+ LPDECLFE+F+R+++GK +S+CAC SKRWLMLLSS+R +E  +N  + 
Sbjct  49   FRRDDTNPSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIRVEETENNGYLT  108

Query  431  QPSEPKEMSDSGMKA  475
            +  E K+ +D  + A
Sbjct  109  RHLEGKKATDIRLAA  123



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRV--DGYFPPCKRARVGTPVVACEGL  259
            MS IF  SG +EFF GG         GS + L P      Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  260  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  406
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ RD
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRD  102



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRV--DGYFPPCKRARVGTPVVACEGL  259
            MS IF  SG +EFF GG         GS + L P      Y P  KR RV     +    
Sbjct  1    MSGIFRVSGDDEFFTGG--------GGSSMHLSPGSCPGVYLPARKRLRVTAAATSFYSS  52

Query  260  EPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  406
              +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ RD
Sbjct  53   FEEKQASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRD  102



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +2

Query  110  GHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEV  289
            G  +FF GG M+  S  S       P V  YFP  KR R+    V   G E +K+ +I+V
Sbjct  5    GDEDFFLGGSMHNLSPGS------CPGV--YFPARKRLRIAATSVF-SGFE-QKQTSIDV  54

Query  290  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            LPDECLFE+ RR+  GKERSACAC SK WL LL+S+ R+E+
Sbjct  55   LPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV  95



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = +2

Query  104  FSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KP  277
            FSG +E + G    PS+            VD Y PP KR RV  P V   G  P++  + 
Sbjct  8    FSGEDELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLW-GSNPEQNTRS  57

Query  278  TIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
            +I VLPDEC+FEVFRR+   +ERS CAC SK+WL +L+ +RR E+ S  S+Q S+
Sbjct  58   SINVLPDECMFEVFRRLPP-QERSNCACVSKQWLTILTGIRRSEMSSTLSVQSSD  111



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  158  DSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDG  337
            D+   LSL    D YFPP KR+RV  P +       KK  +I+VLPDECLFE+FRR+   
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSA--FEKKPVSIDVLPDECLFEIFRRLSGP  58

Query  338  KERSACACTSKRWLMLLSSLRRDEI  412
            +ERSACA  SK+WL L+SS+R+ EI
Sbjct  59   QERSACAFVSKQWLTLVSSIRQKEI  83



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 2/86 (2%)
 Frame = +2

Query  200  YFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  376
            ++P CKRAR+  P V+  +  E +K+ +I VLPDECLFE+FR +  G+ERS CAC SK W
Sbjct  19   FYPSCKRARINAPFVLWGQESEQEKRSSINVLPDECLFEIFRHL-PGQERSNCACVSKHW  77

Query  377  LMLLSSLRRDEIFSNKSIQPSEPKEM  454
            L LLSS+RR E+    ++  S+ KE+
Sbjct  78   LTLLSSIRRAEMCDIDTVMVSDDKEV  103



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 73/126 (58%), Gaps = 4/126 (3%)
 Frame = +3

Query  3    LSIFALCGGFFRLT-TFGFNPPRIFHQYPCLKSLNSVVTMSFSQGGLCTPVPRTRVPFCP  179
            L++FAL  G   L    GF+         CLK L SVVT +FS GG  T +PR+++ F P
Sbjct  18   LAVFALGRGLSGLRRQLGFDQ---LCSATCLKCLISVVTRTFSLGGRYTQIPRSQICFYP  74

Query  180  FILVWMGIFLLARGLESVPLLLHVKDLSRRRSLQLKSFQMNASLRYSDVFMMAKKEVPVL  359
              L+WM  F LARGL S+P +  V+      S  LK FQMNASLR S V M  +++VPVL
Sbjct  75   LDLMWMCFFHLARGLVSMPHMFLVEKSLSGSSPPLKFFQMNASLRSSGVCMGVQRKVPVL  134

Query  360  VRPSVG  377
            V  + G
Sbjct  135  VYLNAG  140



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +2

Query  152  SKDSGSFLSLHPRVDGYFPPCKRARVGTP-VVACEGLEPKKKPTIEVLPDECLFEVFRRV  328
            S DSG   S+    + Y PP KR+R+  P  +    L   K P+I+ LPDECLFE+F  +
Sbjct  21   SGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADDKTPSIDTLPDECLFEIFTHL  80

Query  329  HDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSE  442
             +G+ERS  AC SKRWL +LSS+R  E    K+ Q S+
Sbjct  81   SNGRERSTSACVSKRWLSVLSSVRCSEFHRIKTPQESD  118



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 64/112 (57%), Gaps = 15/112 (13%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRV--DGYFPPCKRARVGTPVVAC--E  253
            MS IF  SG +EFF GG         GS + L P      Y P  KR RV +        
Sbjct  1    MSGIFRISGDDEFFTGG---------GSSMHLSPGSCPGVYLPARKRLRVASAAATSFYS  51

Query  254  GLEPKKKPTIEVLPDECLFEVFRRV-HDGKERSACACTSKRWLMLLSSLRRD  406
              E +K+ +I+VLPDECLFE+ RR+   G+ERSACAC SK WL +LSS+ R+
Sbjct  52   SFE-EKQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIARN  102



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 79.7 bits (195),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 63/174 (36%), Positives = 90/174 (52%), Gaps = 26/174 (15%)
 Frame = +2

Query  86   MSKIFEFSGHNEFFPGGPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPV-------V  244
            M+ +    G ++   GG ++ +  DS   LSL   VD Y    KR RV  P+       V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  245  ACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNK  424
            A +  +P+   +I+ LPDECLFE+ RR+   KERS  A  SKRWLMLLSS+R  E+ + K
Sbjct  61   AYKKQQPR---SIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSELGARK  117

Query  425  SIQPSEPKEMSDSGMKADIKSDKDGLVQSPVAESKAAYQDAKDEGYLSRCLDKE  586
                   K   +SG K     +K+ L+           Q++++ GYL+R LD E
Sbjct  118  -------KSHVESGKKFLPDLNKNVLLDE---------QESENNGYLTRRLDAE  155


 Score = 26.2 bits (56),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 10/15 (67%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            ++ATD+RLA+IA+GT
Sbjct  155  EEATDIRLASIALGT  169



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 73.6 bits (179),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 4/115 (3%)
 Frame = +2

Query  131  GGPMYPSSKDSGSFLSLHPRVDGYFPPCK-RARVGTPVVACEGLEPKK--KPTIEVLPDE  301
            G P+YP+ K+  S   L  ++   F   +  A V   + A  GL   +  + +IE LPDE
Sbjct  57   GAPIYPNPKEHVSSCLLAVKLMFTFLFRRGLASVFHLISAENGLSRSRSQRTSIESLPDE  116

Query  302  CLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKEMSDSG  466
            CLFE+ RR+  G++RS CA  SKRWLMLLSS+ + EI S  S   +E +E+SD G
Sbjct  117  CLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYGSTG-NENQEISDEG  170


 Score = 32.3 bits (72),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  582  KKATDVRLAAIAVGT  626
            KKATDVRLAAIAVGT
Sbjct  179  KKATDVRLAAIAVGT  193



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +2

Query  215  KRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSS  394
            KR RV  P VA    E K  P+I+ LPDECLFE+ RR+    E+SACAC SKRWLMLLSS
Sbjct  7    KRCRVNAPFVASR--EFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLMLLSS  64

Query  395  LRRDEIFSNKSIQPSE  442
            + RDE ++ ++++  E
Sbjct  65   ISRDESYTTEALREFE  80



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 68.6 bits (166),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  272  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEPKE  451
            +P+++VLPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+    +  PS P  
Sbjct  354  QPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISELGHAAAAAPSLPDL  413

Query  452  MSDSGMKAD  478
              +  M+ D
Sbjct  414  NEEFVMEED  422


 Score = 23.5 bits (49),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +3

Query  585  KATDVRLAAIAV  620
            +ATDVRLAA+AV
Sbjct  440  EATDVRLAAMAV  451



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query  200  YFPPCKRARVGTPVVACEGL-EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  376
            Y+PP KRAR+ + V++ E   E  ++ +IE+LPDECLFE+ RR+   KER    C SKRW
Sbjct  41   YYPPNKRARISSSVLSVESETEVSEQQSIEILPDECLFEILRRLPRVKERCLSLCVSKRW  100

Query  377  LMLLSSLRRDE  409
            L +L+S+R  E
Sbjct  101  LNVLTSMRLSE  111



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 10/103 (10%)
 Frame = +2

Query  110  GHNEFFPG-GPMYPSSKDSGSFLSLHPRVDGYFPPCKRARVGTPVVACEGLEPKK--KPT  280
            G  EF    G +  +  + G    +   VD Y+PP KRAR+          EP+   + +
Sbjct  9    GAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLSES-------EPEATDRSS  61

Query  281  IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  409
            IE+LPDECLFE+ RR+   KER   +C S+RWL +L+ +R  E
Sbjct  62   IEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIRLSE  104



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R  E+
Sbjct  61   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  111



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQPSEP  445
            +P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+       PS P
Sbjct  64   QPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSELGHAALAAPSLP  121



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  260  EPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            + ++ P+++ LPDECLFEV RR+  G+ER A AC S+RWL LL S+R  E+
Sbjct  53   QQRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASEL  103



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  272  KPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSNKSIQP  436
            +P+++ LPDECLFEV RR+  G+ER+  AC S+RWL LL+S+R  E+    +  P
Sbjct  69   QPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASELGQATAAAP  123



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 47/97 (48%), Gaps = 14/97 (14%)
 Frame = +2

Query  164  GSFLSLHPRVDGYF--------------PPCKRARVGTPVVACEGLEPKKKPTIEVLPDE  301
            G  L L P     F              PPC  A V     A +  + ++ P+++ LPDE
Sbjct  10   GGLLVLEPAAASLFDGVRQRKRARVTAVPPCVYAAVAAAAAAAKKQKLRETPSLDALPDE  69

Query  302  CLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            CLFE+ RRV   + R A AC S+RWL LL  +R  EI
Sbjct  70   CLFEILRRVQGARARGASACVSRRWLALLGGIRASEI  106



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  409
            +++P+++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  42   REEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASE  89



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  409
            + +P+++ +PDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  41   RDEPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  269  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R  EI
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEI  120



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  269  KKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            + P+++ LPDECLFE+ RRV   + R A A  S+RWL LL  +R  EI
Sbjct  73   EAPSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEI  120



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  281  IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  409
            ++ LPDECLFEV RRV   + R A AC S+RWL LL+ +R  E
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>ref|XP_009414462.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  194  DGYFPPCKRARVGTPVVACEGLEPKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKR  373
            D +  P KR ++G+P           +  I+ LPDECL  +F  +   ++R  CA  S++
Sbjct  3    DSHRRPGKRRKIGSPAKESRDDRALCQDLIDDLPDECLLLIFSLLPAPRDRCRCAAVSRK  62

Query  374  WLMLLSSLRRDEIFSNKSIQPSEPKEMS  457
            WL L +S+RR E  +N  + P   +EMS
Sbjct  63   WLALQASMRRSEFGANAVLLPEARQEMS  90



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +2

Query  266  KKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDE  409
            ++ P+++ LPDECLFE+ RRV     R A AC S+RWL LL S+R  E
Sbjct  57   RQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSE  102



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 9/98 (9%)
 Frame = +2

Query  203  FPPCKRARVGTPVVACEGLEPKKK--PTIEVLPDECLFEVFRRVHDGKERSACACTSKRW  376
             PPC  A      V       K++  P+++ LPDECLFE+ RRV   + R A    S+RW
Sbjct  36   VPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARCASGAVSRRW  95

Query  377  LMLLS----SLRRDEIFSNKSIQPSEP-KEMSDSGMKA  475
            L LL     SLR      +  I+ S P + ++D+G+ A
Sbjct  96   LALLGAFGDSLRGH--LESLVIRGSHPTRGVTDAGLSA  131



>ref|XP_004240647.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like 
[Solanum lycopersicum]
Length=630

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  335  GKERSACACTSKRWLMLLSSLRRDEIFS  418
            G+ER ACAC SKRWLMLLSS+ RDE+F+
Sbjct  526  GQERRACACVSKRWLMLLSSIHRDEVFA  553



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 43.1 bits (100),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  290  LPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            +PDE L  +F  +   ++RS+CA   +RWLMLL+ + R E+
Sbjct  4    IPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPRQEL  44


 Score = 31.6 bits (70),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 3/36 (8%)
 Frame = +3

Query  519  LKARLHIKMPRMKVIFRGALIKKATDVRLAAIAVGT  626
            L+ + H  +  +     G   KKATDVRLAAIAVGT
Sbjct  74   LEKQPHWALGDLSRCLEG---KKATDVRLAAIAVGT  106



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +2

Query  260  EPKKKPT------IEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEIFSN  421
            EP +K T      I  LPDEC+ E+FR +   ++R +C   SKRWL L +++R  E+ S+
Sbjct  62   EPVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMRISELKSD  121



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  263  PKKKPTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            P   P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  62   PLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  111



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  275  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  63   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  108



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  275  PTIEVLPDECLFEVFRRVHDGKERSACACTSKRWLMLLSSLRRDEI  412
            P+++ LPDECLFE+ RRV  G+ R A AC S+RWL LL S+R  E+
Sbjct  166  PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASEL  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250