BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS106G11

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    351   5e-114   Solanum tuberosum [potatoes]
gb|EYU32062.1|  hypothetical protein MIMGU_mgv1a003954mg                346   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        348   3e-113   Nicotiana tomentosiformis
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        348   6e-113   Nicotiana sylvestris
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        345   7e-112   Solanum lycopersicum
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        340   1e-109   Sesamum indicum [beniseed]
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             324   9e-104   Prunus persica
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        324   1e-103   
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        323   2e-103   Prunus mume [ume]
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        323   3e-103   
emb|CDP08881.1|  unnamed protein product                                317   5e-101   Coffea canephora [robusta coffee]
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        316   2e-100   Sesamum indicum [beniseed]
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15        314   7e-100   Fragaria vesca subsp. vesca
ref|XP_004155808.1|  PREDICTED: probable methyltransferase PMT15-...    312   4e-99    
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        312   4e-99    Pyrus x bretschneideri [bai li]
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        310   9e-99    
emb|CDP05238.1|  unnamed protein product                                311   1e-98    Coffea canephora [robusta coffee]
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        311   1e-98    Nicotiana sylvestris
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    310   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    310   2e-98    Nicotiana sylvestris
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        310   2e-98    Cucumis melo [Oriental melon]
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        310   2e-98    
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    310   2e-98    Nicotiana sylvestris
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15        309   4e-98    Vitis vinifera
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        310   6e-98    Nicotiana tomentosiformis
gb|KDP22318.1|  hypothetical protein JCGZ_26149                         308   2e-97    Jatropha curcas
gb|KDP28686.1|  hypothetical protein JCGZ_14457                         306   4e-97    Jatropha curcas
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        307   5e-97    Fragaria vesca subsp. vesca
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    307   6e-97    Vitis vinifera
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             307   7e-97    Populus trichocarpa [western balsam poplar]
ref|XP_003551650.1|  PREDICTED: probable methyltransferase PMT16-...    304   7e-97    Glycine max [soybeans]
gb|KJB09868.1|  hypothetical protein B456_001G171500                    304   1e-96    Gossypium raimondii
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             305   2e-96    Citrus clementina [clementine]
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    305   3e-96    Citrus sinensis [apfelsine]
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             304   3e-96    Phaseolus vulgaris [French bean]
gb|KDO86014.1|  hypothetical protein CISIN_1g006633mg                   301   5e-96    Citrus sinensis [apfelsine]
ref|XP_002510829.1|  ATP binding protein, putative                      304   6e-96    Ricinus communis
gb|KJB09867.1|  hypothetical protein B456_001G171500                    303   1e-95    Gossypium raimondii
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    303   1e-95    Solanum tuberosum [potatoes]
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        303   1e-95    Populus euphratica
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    302   2e-95    Glycine max [soybeans]
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        303   2e-95    Populus euphratica
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        303   2e-95    Nicotiana tomentosiformis
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        302   3e-95    Sesamum indicum [beniseed]
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15        302   3e-95    Eucalyptus grandis [rose gum]
gb|ACN78962.1|  methyltransferase                                       305   5e-95    Glycine max [soybeans]
ref|XP_004133882.1|  PREDICTED: probable methyltransferase PMT15-...    301   5e-95    
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        302   5e-95    Solanum lycopersicum
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             301   5e-95    Citrus clementina [clementine]
ref|XP_002511797.1|  ATP binding protein, putative                      301   5e-95    Ricinus communis
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   301   5e-95    Citrus sinensis [apfelsine]
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                301   8e-95    Erythranthe guttata [common monkey flower]
gb|KEH18956.1|  methyltransferase                                       301   9e-95    Medicago truncatula
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             300   1e-94    
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    301   1e-94    Solanum tuberosum [potatoes]
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        301   1e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011023413.1|  PREDICTED: probable methyltransferase PMT15        298   7e-94    Populus euphratica
ref|XP_002301329.1|  dehydration-responsive family protein              297   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_006857883.1|  hypothetical protein AMTR_s00069p00110310          298   2e-93    Amborella trichopoda
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  297   2e-93    Medicago truncatula
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        296   2e-93    Tarenaya hassleriana [spider flower]
gb|EPS68701.1|  hypothetical protein M569_06064                         297   3e-93    Genlisea aurea
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    296   4e-93    Populus euphratica
ref|XP_010508116.1|  PREDICTED: probable methyltransferase PMT16        296   5e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010506552.1|  PREDICTED: probable methyltransferase PMT16        296   6e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        296   7e-93    Nelumbo nucifera [Indian lotus]
ref|XP_010518192.1|  PREDICTED: probable methyltransferase PMT16        296   7e-93    Camelina sativa [gold-of-pleasure]
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    295   9e-93    Populus euphratica
ref|XP_006293834.1|  hypothetical protein CARUB_v10022818mg             295   9e-93    Capsella rubella
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        295   1e-92    Phoenix dactylifera
ref|XP_002880195.1|  dehydration-responsive family protein              295   1e-92    
emb|CDY18904.1|  BnaC04g04460D                                          295   1e-92    Brassica napus [oilseed rape]
gb|KHG14191.1|  hypothetical protein F383_16741                         295   2e-92    Gossypium arboreum [tree cotton]
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    295   2e-92    
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     294   2e-92    Eucalyptus grandis [rose gum]
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        295   2e-92    Elaeis guineensis
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    295   2e-92    Solanum lycopersicum
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             294   3e-92    
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    294   3e-92    
ref|NP_182099.1|  putative methyltransferase PMT16                      294   3e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX74761.1|  BnaA05g05070D                                          294   4e-92    
ref|XP_006397756.1|  hypothetical protein EUTSA_v10001358mg             293   6e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        294   6e-92    Eucalyptus grandis [rose gum]
ref|XP_009143165.1|  PREDICTED: probable methyltransferase PMT16        293   7e-92    Brassica rapa
gb|KJB41226.1|  hypothetical protein B456_007G095700                    293   1e-91    Gossypium raimondii
ref|XP_009142361.1|  PREDICTED: probable methyltransferase PMT16        292   1e-91    Brassica rapa
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        292   2e-91    Phoenix dactylifera
ref|XP_003528883.1|  PREDICTED: probable methyltransferase PMT15-...    291   3e-91    Glycine max [soybeans]
gb|ABV72578.1|  dehydration-responsive family protein S51               291   3e-91    Brassica rapa
ref|XP_010055227.1|  PREDICTED: probable methyltransferase PMT15 ...    290   4e-91    Eucalyptus grandis [rose gum]
ref|XP_007051921.1|  S-adenosyl-L-methionine-dependent methyltran...    289   4e-91    
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...    291   5e-91    Cicer arietinum [garbanzo]
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        291   5e-91    Camelina sativa [gold-of-pleasure]
emb|CDY37061.1|  BnaA04g26390D                                          291   6e-91    Brassica napus [oilseed rape]
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        292   7e-91    Tarenaya hassleriana [spider flower]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        291   7e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    290   1e-90    Eucalyptus grandis [rose gum]
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        290   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        290   1e-90    Nicotiana tomentosiformis
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    289   2e-90    
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        290   2e-90    Elaeis guineensis
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    289   3e-90    Solanum tuberosum [potatoes]
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        289   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010091548.1|  putative methyltransferase PMT15                   289   4e-90    Morus notabilis
gb|KHG13750.1|  hypothetical protein F383_08462                         288   4e-90    Gossypium arboreum [tree cotton]
ref|XP_008439398.1|  PREDICTED: probable methyltransferase PMT15        288   5e-90    Cucumis melo [Oriental melon]
gb|KJB18858.1|  hypothetical protein B456_003G072700                    286   5e-90    Gossypium raimondii
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             288   8e-90    Capsella rubella
ref|XP_011016489.1|  PREDICTED: probable methyltransferase PMT17        279   8e-90    Populus euphratica
ref|XP_004228448.2|  PREDICTED: probable methyltransferase PMT15        288   1e-89    
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        288   1e-89    Nicotiana sylvestris
gb|KJB18848.1|  hypothetical protein B456_003G072700                    287   2e-89    Gossypium raimondii
gb|KFK37364.1|  hypothetical protein AALP_AA4G247100                    287   2e-89    Arabis alpina [alpine rockcress]
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        286   2e-89    Populus euphratica
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        287   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             286   2e-89    Phaseolus vulgaris [French bean]
gb|KEH21299.1|  methyltransferase PMT16, putative                       286   3e-89    Medicago truncatula
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    286   4e-89    
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    286   5e-89    Cicer arietinum [garbanzo]
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        285   5e-89    
gb|KJB18860.1|  hypothetical protein B456_003G072700                    286   6e-89    Gossypium raimondii
ref|XP_002875017.1|  dehydration-responsive family protein              285   8e-89    
ref|NP_191984.1|  putative methyltransferase PMT15                      285   9e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501748.1|  PREDICTED: probable methyltransferase PMT18        281   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        284   2e-88    Fragaria vesca subsp. vesca
gb|KEH17380.1|  methyltransferase PMT16, putative                       282   2e-88    Medicago truncatula
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    284   2e-88    Glycine max [soybeans]
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             284   2e-88    Eutrema salsugineum [saltwater cress]
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             284   3e-88    Prunus persica
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        284   3e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134966.1|  hypothetical protein PHAVU_010G090800g             283   6e-88    Phaseolus vulgaris [French bean]
ref|XP_004140852.1|  PREDICTED: probable methyltransferase PMT15-...    282   7e-88    Cucumis sativus [cucumbers]
gb|KJB24074.1|  hypothetical protein B456_004G127200                    282   8e-88    Gossypium raimondii
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15        282   9e-88    Tarenaya hassleriana [spider flower]
ref|XP_010692380.1|  PREDICTED: probable methyltransferase PMT15        282   1e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        282   1e-87    
emb|CBI34642.3|  unnamed protein product                                280   1e-87    Vitis vinifera
ref|XP_002317647.1|  dehydration-responsive family protein              282   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    282   2e-87    
gb|KEH17379.1|  methyltransferase PMT16, putative                       282   2e-87    Medicago truncatula
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    281   2e-87    
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    290   2e-87    
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        281   2e-87    Eucalyptus grandis [rose gum]
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        281   3e-87    Malus domestica [apple tree]
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        281   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg             281   3e-87    Capsella rubella
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        281   4e-87    Camelina sativa [gold-of-pleasure]
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    281   4e-87    Glycine max [soybeans]
ref|NP_564419.1|  putative methyltransferase PMT18                      281   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        280   5e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        280   5e-87    Populus euphratica
ref|XP_002891032.1|  dehydration-responsive family protein              280   6e-87    
emb|CDP12267.1|  unnamed protein product                                280   9e-87    Coffea canephora [robusta coffee]
gb|AAF97349.1|AC021045_6  Unknown Protein                               280   9e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KHN16709.1|  Putative methyltransferase PMT18                        279   9e-87    Glycine soja [wild soybean]
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18-...    280   1e-86    Cucumis sativus [cucumbers]
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                279   1e-86    Erythranthe guttata [common monkey flower]
ref|XP_004169220.1|  PREDICTED: probable methyltransferase PMT18-...    280   1e-86    
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    280   2e-86    Cicer arietinum [garbanzo]
ref|XP_002518966.1|  ATP binding protein, putative                      279   2e-86    Ricinus communis
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        279   2e-86    Zea mays [maize]
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    279   2e-86    Glycine max [soybeans]
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        279   2e-86    Cucumis melo [Oriental melon]
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        278   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    279   3e-86    Zea mays [maize]
emb|CDY27362.1|  BnaC04g50430D                                          285   4e-86    Brassica napus [oilseed rape]
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        278   4e-86    Brachypodium distachyon [annual false brome]
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        278   4e-86    Eucalyptus grandis [rose gum]
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        278   5e-86    Nicotiana sylvestris
ref|NP_001053603.1|  Os04g0570800                                       278   6e-86    
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        278   7e-86    
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  277   1e-85    Medicago truncatula
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        277   1e-85    
gb|KDP25187.1|  hypothetical protein JCGZ_20343                         276   2e-85    Jatropha curcas
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    276   2e-85    Cicer arietinum [garbanzo]
emb|CDX84046.1|  BnaC08g07230D                                          276   2e-85    
emb|CDY54063.1|  BnaA02g36490D                                          274   2e-85    Brassica napus [oilseed rape]
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    276   2e-85    Vitis vinifera
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        276   2e-85    Brassica rapa
ref|XP_006846537.1|  hypothetical protein AMTR_s00018p00198280          276   2e-85    
ref|NP_001065036.1|  Os10g0510400                                       276   3e-85    
ref|XP_009128495.1|  PREDICTED: probable methyltransferase PMT15        277   3e-85    
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    276   3e-85    
gb|EEC67295.1|  hypothetical protein OsI_34283                          276   3e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        275   4e-85    
emb|CDX99540.1|  BnaC09g24520D                                          273   5e-85    
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             275   5e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    275   5e-85    Oryza brachyantha
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        275   6e-85    Pyrus x bretschneideri [bai li]
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        275   6e-85    Pyrus x bretschneideri [bai li]
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        274   1e-84    
emb|CDY44966.1|  BnaA08g06660D                                          274   1e-84    Brassica napus [oilseed rape]
ref|NP_192782.1|  putative methyltransferase PMT17                      274   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        274   1e-84    Brassica rapa
emb|CDX99539.1|  BnaC09g24530D                                          274   2e-84    
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        274   2e-84    Sesamum indicum [beniseed]
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        274   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        273   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    273   3e-84    Setaria italica
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        273   4e-84    Brassica rapa
ref|XP_002874627.1|  dehydration-responsive family protein              273   4e-84    Arabidopsis lyrata subsp. lyrata
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             274   4e-84    
emb|CDX94256.1|  BnaC02g29160D                                          272   6e-84    
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             272   8e-84    Phaseolus vulgaris [French bean]
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             271   8e-84    Phaseolus vulgaris [French bean]
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             272   9e-84    Capsella rubella
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             271   1e-83    
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             271   2e-83    Prunus persica
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             271   2e-83    
ref|XP_010110846.1|  putative methyltransferase PMT18                   266   2e-83    
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549             271   2e-83    
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        271   2e-83    Brassica rapa
ref|XP_008791705.1|  PREDICTED: probable methyltransferase PMT17        269   2e-83    
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    271   3e-83    Arabis alpina [alpine rockcress]
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        271   3e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        270   4e-83    Elaeis guineensis
gb|KDO43765.1|  hypothetical protein CISIN_1g038698mg                   260   4e-83    Citrus sinensis [apfelsine]
gb|AFW63361.1|  hypothetical protein ZEAMMB73_276336                    262   4e-83    
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        270   6e-83    Pyrus x bretschneideri [bai li]
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        270   8e-83    Malus domestica [apple tree]
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              270   8e-83    
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        270   9e-83    Elaeis guineensis
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        269   1e-82    Phoenix dactylifera
gb|KJB18849.1|  hypothetical protein B456_003G072700                    266   1e-82    Gossypium raimondii
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    269   2e-82    Oryza brachyantha
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        269   2e-82    Malus domestica [apple tree]
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    269   2e-82    
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          269   2e-82    Sorghum bicolor [broomcorn]
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    268   2e-82    Oryza brachyantha
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    269   3e-82    Brachypodium distachyon [annual false brome]
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    268   5e-82    Setaria italica
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        268   5e-82    Prunus mume [ume]
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    268   5e-82    Setaria italica
ref|XP_009405347.1|  PREDICTED: probable methyltransferase PMT17 ...    265   7e-82    
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        266   1e-81    Solanum lycopersicum
gb|KHM99867.1|  Putative methyltransferase PMT18                        264   1e-81    Glycine soja [wild soybean]
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    266   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    266   1e-81    Setaria italica
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    266   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    265   2e-81    Glycine max [soybeans]
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    266   2e-81    Solanum tuberosum [potatoes]
gb|EEE61530.1|  hypothetical protein OsJ_15834                          263   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002298987.1|  dehydration-responsive family protein              263   2e-81    
emb|CDM86771.1|  unnamed protein product                                266   3e-81    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          265   3e-81    Sorghum bicolor [broomcorn]
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    265   3e-81    Citrus sinensis [apfelsine]
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   265   4e-81    Citrus sinensis [apfelsine]
ref|NP_001056546.2|  Os06g0103900                                       265   4e-81    
gb|EEC79826.1|  hypothetical protein OsI_21282                          265   4e-81    Oryza sativa Indica Group [Indian rice]
dbj|BAJ98046.1|  predicted protein                                      265   5e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN21029.1|  Putative methyltransferase PMT14                        263   5e-81    Glycine soja [wild soybean]
gb|ABR16934.1|  unknown                                                 265   6e-81    Picea sitchensis
ref|XP_011018634.1|  PREDICTED: probable methyltransferase PMT14 ...    261   9e-81    Populus euphratica
gb|KJB51712.1|  hypothetical protein B456_008G228900                    261   1e-80    Gossypium raimondii
gb|EPS57356.1|  hypothetical protein M569_17462                         252   1e-80    Genlisea aurea
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    263   1e-80    Glycine max [soybeans]
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        264   1e-80    Elaeis guineensis
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    263   1e-80    Phoenix dactylifera
ref|XP_010110495.1|  putative methyltransferase PMT14                   263   1e-80    Morus notabilis
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             263   2e-80    Selaginella moellendorffii
gb|EMT22301.1|  hypothetical protein F775_16518                         263   2e-80    
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    263   3e-80    Phoenix dactylifera
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             262   3e-80    
ref|XP_004953430.1|  PREDICTED: probable methyltransferase PMT16-...    263   4e-80    Setaria italica
ref|XP_008373611.1|  PREDICTED: probable methyltransferase PMT14        256   4e-80    
dbj|BAJ95401.1|  predicted protein                                      262   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87212.1|  predicted protein                                      262   5e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84848.1|  predicted protein                                      262   5e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC73773.1|  hypothetical protein OsI_08448                          263   5e-80    Oryza sativa Indica Group [Indian rice]
gb|KJB51709.1|  hypothetical protein B456_008G228900                    261   6e-80    Gossypium raimondii
ref|NP_001047721.1|  Os02g0675700                                       262   6e-80    
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        261   7e-80    Brachypodium distachyon [annual false brome]
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    261   8e-80    Populus euphratica
gb|KHG27439.1|  hypothetical protein F383_15139                         262   1e-79    Gossypium arboreum [tree cotton]
ref|XP_008677769.1|  PREDICTED: hypothetical protein isoform X1         262   1e-79    
dbj|BAK03905.1|  predicted protein                                      263   1e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    262   1e-79    Tarenaya hassleriana [spider flower]
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    262   1e-79    Tarenaya hassleriana [spider flower]
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             260   1e-79    Citrus clementina [clementine]
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             261   1e-79    
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        260   1e-79    
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    260   2e-79    
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        261   2e-79    
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    259   3e-79    
ref|XP_001778231.1|  predicted protein                                  259   3e-79    
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             259   3e-79    
gb|AAX94055.2|  dehydration-induced protein                             260   4e-79    
gb|KCW77891.1|  hypothetical protein EUGRSUZ_D02155                     258   4e-79    
ref|NP_001147806.1|  methyltransferase                                  259   4e-79    
gb|EYU33038.1|  hypothetical protein MIMGU_mgv1a004747mg                257   4e-79    
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    260   6e-79    
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    259   6e-79    
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    260   7e-79    
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    259   8e-79    
gb|EMS54302.1|  putative methyltransferase PMT17                        259   9e-79    
gb|KFK45055.1|  hypothetical protein AALP_AA1G338100                    258   2e-78    
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    260   2e-78    
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        258   2e-78    
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    260   2e-78    
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14-...    258   2e-78    
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        258   2e-78    
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          258   2e-78    
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        258   3e-78    
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                254   3e-78    
ref|XP_008362975.1|  PREDICTED: probable methyltransferase PMT14        255   3e-78    
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        257   4e-78    
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        257   4e-78    
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    256   5e-78    
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    256   5e-78    
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             257   5e-78    
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             257   5e-78    
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    256   5e-78    
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             256   6e-78    
gb|EMS62160.1|  putative methyltransferase PMT17                        258   7e-78    
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        256   7e-78    
emb|CDX78823.1|  BnaA01g08900D                                          256   7e-78    
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        256   8e-78    
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             255   1e-77    
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        255   2e-77    
gb|KGN56551.1|  ATP binding protein                                     244   2e-77    
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        255   2e-77    
ref|XP_001782639.1|  predicted protein                                  255   2e-77    
gb|ACA66248.1|  putative methyltransferase                              254   3e-77    
gb|ACB54686.1|  methyltransferase                                       254   4e-77    
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        254   4e-77    
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        254   5e-77    
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    253   7e-77    
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        253   8e-77    
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        254   9e-77    
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        253   9e-77    
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        253   1e-76    
emb|CDP12957.1|  unnamed protein product                                253   1e-76    
ref|XP_002868016.1|  dehydration-responsive family protein              253   2e-76    
dbj|BAH19630.1|  AT4G18030                                              252   2e-76    
ref|NP_193537.2|  putative methyltransferase PMT14                      252   3e-76    
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          261   3e-76    
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    253   3e-76    
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        251   7e-76    
ref|NP_001148962.1|  ankyrin protein kinase-like                        251   7e-76    
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    251   7e-76    
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        251   9e-76    
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        251   1e-75    
gb|ABR16582.1|  unknown                                                 251   1e-75    
ref|NP_001146334.1|  uncharacterized protein LOC100279910               243   1e-75    
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             249   4e-75    
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         249   5e-75    
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        249   5e-75    
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        248   7e-75    
ref|XP_001760613.1|  predicted protein                                  249   7e-75    
ref|NP_849711.1|  putative methyltransferase PMT2                       245   1e-74    
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         247   2e-74    
ref|XP_001779831.1|  predicted protein                                  248   2e-74    
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        247   2e-74    
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         247   2e-74    
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         247   3e-74    
gb|KDO76124.1|  hypothetical protein CISIN_1g0367251mg                  237   3e-74    
gb|ACJ85858.1|  unknown                                                 246   3e-74    
ref|XP_002528760.1|  ATP binding protein, putative                      246   3e-74    
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  246   4e-74    
dbj|BAH19504.1|  AT1G26850                                              246   5e-74    
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like    246   5e-74    
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             246   6e-74    
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         246   6e-74    
emb|CDY03207.1|  BnaC09g19490D                                          246   7e-74    
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         246   7e-74    
gb|EAY79581.1|  hypothetical protein OsI_34717                          245   7e-74    
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         246   7e-74    
gb|KJB60758.1|  hypothetical protein B456_009G324300                    240   8e-74    
emb|CDP00327.1|  unnamed protein product                                246   8e-74    
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         246   8e-74    
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         245   9e-74    
ref|XP_002893375.1|  dehydration-responsive family protein              245   9e-74    
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         245   9e-74    
gb|AAD14491.1|  Unknown protein                                         245   9e-74    
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    245   1e-73    
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         245   1e-73    
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             245   1e-73    
gb|KDP22915.1|  hypothetical protein JCGZ_01776                         245   1e-73    
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             245   1e-73    
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         244   1e-73    
emb|CAA17146.1|  putative protein                                       245   2e-73    
ref|NP_564265.1|  putative methyltransferase PMT2                       244   2e-73    
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         244   2e-73    
emb|CDY45006.1|  BnaCnng12360D                                          244   3e-73    
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    244   3e-73    
emb|CDY35169.1|  BnaA09g18060D                                          246   3e-73    
dbj|BAC24840.1|  dehydration-responsive protein-like                    244   3e-73    
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    244   3e-73    
emb|CDY46435.1|  BnaA08g19950D                                          244   3e-73    
ref|XP_006586024.1|  PREDICTED: probable methyltransferase PMT2-l...    242   3e-73    
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         244   3e-73    
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          243   4e-73    
ref|NP_001065447.2|  Os10g0569300                                       244   4e-73    
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    244   4e-73    
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         244   4e-73    
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    243   5e-73    
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             243   5e-73    
gb|KJB60755.1|  hypothetical protein B456_009G324300                    241   6e-73    
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             243   6e-73    
gb|EMT05545.1|  hypothetical protein F775_20122                         243   6e-73    
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         243   7e-73    
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         243   9e-73    
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    243   9e-73    
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72    
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72    
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    243   1e-72    
ref|NP_001280936.1|  uncharacterized protein LOC103402903               243   1e-72    
gb|KHN17371.1|  Putative methyltransferase PMT2                         243   1e-72    
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    243   1e-72    
gb|KJB60756.1|  hypothetical protein B456_009G324300                    241   1e-72    
ref|NP_001152470.1|  ankyrin protein kinase-like                        243   1e-72    
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72    
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72    
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630          243   1e-72    
emb|CDY40268.1|  BnaA07g09320D                                          242   1e-72    
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         242   1e-72    
gb|AAL86466.1|AC077693_5  hypothetical protein                          244   1e-72    
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         242   1e-72    
emb|CDY16198.1|  BnaA09g29320D                                          242   1e-72    
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    242   1e-72    
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         242   2e-72    
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    242   2e-72    
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          242   2e-72    
gb|KHN12213.1|  Putative methyltransferase PMT2                         241   3e-72    
gb|AER13154.1|  putative methyltransferase                              231   3e-72    
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    241   3e-72    
gb|KJB60757.1|  hypothetical protein B456_009G324300                    241   4e-72    
dbj|BAJ85549.1|  predicted protein                                      242   4e-72    
gb|KHG10506.1|  hypothetical protein F383_11349                         241   5e-72    
ref|NP_001050233.1|  Os03g0379100                                       241   5e-72    
gb|EMT27426.1|  hypothetical protein F775_29617                         241   6e-72    
ref|XP_010091504.1|  putative methyltransferase PMT2                    241   6e-72    
gb|EMS49438.1|  putative methyltransferase PMT2                         240   7e-72    
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  240   8e-72    
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    240   9e-72    
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    240   9e-72    
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         240   1e-71    
ref|NP_001063174.1|  Os09g0415700                                       240   1e-71    
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    240   1e-71    
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             239   1e-71    
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    239   1e-71    
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    239   2e-71    
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         239   2e-71    
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         239   2e-71    
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         239   2e-71    
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         239   2e-71    
gb|EPS59468.1|  hypothetical protein M569_15338                         239   2e-71    
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         239   2e-71    
gb|EAZ09099.1|  hypothetical protein OsI_31366                          239   2e-71    
gb|KJB80180.1|  hypothetical protein B456_013G084900                    239   2e-71    
gb|KHG23981.1|  hypothetical protein F383_09020                         239   2e-71    
gb|KJB08228.1|  hypothetical protein B456_001G071800                    239   3e-71    
ref|XP_006439601.1|  hypothetical protein CICLE_v10019341mg             238   3e-71    
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         239   4e-71    
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         238   4e-71    
ref|XP_010089758.1|  putative methyltransferase PMT2                    238   4e-71    
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         238   4e-71    
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         238   4e-71    
tpg|DAA45571.1|  TPA: hypothetical protein ZEAMMB73_269534              238   5e-71    
ref|XP_010551538.1|  PREDICTED: probable methyltransferase PMT2 i...    237   5e-71    
gb|KJB08229.1|  hypothetical protein B456_001G071800                    239   5e-71    
emb|CDP12320.1|  unnamed protein product                                243   5e-71    
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         238   5e-71    
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         238   6e-71    
gb|ABO92980.1|  putative methyltransferase                              238   6e-71    
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    238   6e-71    
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          238   7e-71    
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             238   7e-71    
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                238   8e-71    
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         238   8e-71    
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         238   9e-71    
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         238   1e-70    
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    237   1e-70    
ref|XP_008656343.1|  PREDICTED: probable methyltransferase PMT2         237   1e-70    
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         237   1e-70    
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         237   2e-70    
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         236   2e-70    
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         236   2e-70    
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    236   2e-70    
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    236   2e-70    
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         236   3e-70    
gb|AAT38682.2|  Methyltransferase family protein, putative              237   3e-70    
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             236   3e-70    
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    236   4e-70    
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    236   4e-70    
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    235   5e-70    
gb|EYU22422.1|  hypothetical protein MIMGU_mgv1a003056mg                233   6e-70    
gb|AAU90305.2|  Methyltransferase, putative                             237   7e-70    
gb|AAT39937.2|  Putative methyltransferase family protein               238   8e-70    
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    235   9e-70    
emb|CAH18000.1|  Ankyrin protein kinase-like                            235   1e-69    
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         234   1e-69    
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         234   2e-69    
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    234   2e-69    
gb|AAT38756.2|  Putative methyltransferase family protein               238   2e-69    
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             234   2e-69    
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         234   2e-69    
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         234   3e-69    
gb|AFW87980.1|  hypothetical protein ZEAMMB73_653302                    233   3e-69    
gb|EPS60507.1|  hypothetical protein M569_14296                         233   3e-69    



>ref|XP_006339462.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=636

 Score =   351 bits (900),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +S S++S+DF AHH A+DLV ++ +     +P C  ELSEYTPC+D++RSLKFDR ML Y
Sbjct  72   NSGSSISIDFTAHHTADDLVPLSSSASVNHYPSCNPELSEYTPCEDSKRSLKFDRNMLAY  131

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELLKCRIPAPFGY+ P RWP+SRDSVWYANVPHKHLTVEKAGQNWVRFKG+
Sbjct  132  RERHCPEKNELLKCRIPAPFGYKPPFRWPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGD  191

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RFTFPGGGTMFPRGADAYIDDIG+LI LKDGSIRTAIDTGCGVASWGAYLLSRDI P+SF
Sbjct  192  RFTFPGGGTMFPRGADAYIDDIGKLIKLKDGSIRTAIDTGCGVASWGAYLLSRDILPISF  251

Query  559  APKDTHEAQVQFALERXIP  615
            APKDTHEAQVQFALER +P
Sbjct  252  APKDTHEAQVQFALERGVP  270



>gb|EYU32062.1| hypothetical protein MIMGU_mgv1a003954mg [Erythranthe guttata]
Length=552

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +1

Query  10   NLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
             L +++SAV+LDF AHH AE LV ++ A  A +FPPC  + SEYTPCQ  ERSLKFDR M
Sbjct  70   TLPTNASAVTLDFTAHHTAELLVTLSPAARAAQFPPCDPKFSEYTPCQHVERSLKFDRDM  129

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L YRERHCP K ELLKCRIPAP GYR P RWPESRD VWYANVPHKHLTVEKAGQNWVRF
Sbjct  130  LMYRERHCPEKNELLKCRIPAPHGYRSPFRWPESRDVVWYANVPHKHLTVEKAGQNWVRF  189

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            +G+RF+FPGGGTMFPRGADAYIDDIG+LINL+DGSIRTAIDTGCGVASWGAYLLSR+I P
Sbjct  190  EGDRFSFPGGGTMFPRGADAYIDDIGKLINLEDGSIRTAIDTGCGVASWGAYLLSRNILP  249

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAPKDTHEAQVQFALER +P
Sbjct  250  ISFAPKDTHEAQVQFALERGVP  271



>ref|XP_009629797.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=636

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            ++  S++SL+F AHH A DLV ++ +     FP C  ELSEYTPC+D++RSLKFDR ML 
Sbjct  69   SNYGSSISLEFTAHHTATDLVPLSPSARVNHFPSCNPELSEYTPCEDSKRSLKFDRNMLI  128

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K ELLKCRIPAPFGY+ P RWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG
Sbjct  129  YRERHCPEKNELLKCRIPAPFGYKPPFRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  188

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RFTFPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I P+S
Sbjct  189  DRFTFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPIS  248

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAPKDTHEAQVQFALER +P
Sbjct  249  FAPKDTHEAQVQFALERGVP  268



>ref|XP_009804054.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=636

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            ++  S++SLDF AHH A DLV ++ +     FP C  ELSEYTPC+D++RSLKFDR ML 
Sbjct  69   SNYGSSISLDFTAHHTAADLVPLSPSARVNHFPSCNPELSEYTPCEDSKRSLKFDRNMLI  128

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K ELLKCRIPAPFGY+ P RWPESRDSVWYANVPHKHLTVEKAGQNWVRFK 
Sbjct  129  YRERHCPEKNELLKCRIPAPFGYKQPFRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKD  188

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RFTFPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I P+S
Sbjct  189  DRFTFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPIS  248

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAPKDTHEAQVQFALER +P
Sbjct  249  FAPKDTHEAQVQFALERGVP  268



>ref|XP_004229839.1| PREDICTED: probable methyltransferase PMT15 [Solanum lycopersicum]
Length=636

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +S S++ +DF AHH A++LV ++ +     +P C  ELSEYTPC+D++RSLKFDR ML Y
Sbjct  72   NSRSSIPIDFTAHHTADELVPLSSSARVNHYPSCNLELSEYTPCEDSKRSLKFDRSMLAY  131

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELLKCRIPAPFGY+ P RWP+SRDSVWYANVPHKHLTVEKAGQNWVRFKG+
Sbjct  132  RERHCPEKSELLKCRIPAPFGYKPPFRWPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGD  191

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RFTFPGGGTMFPRGADAYIDDIG+LI LKDGSIRTAIDTGCGVASWGAYLLSRDI P+SF
Sbjct  192  RFTFPGGGTMFPRGADAYIDDIGKLIKLKDGSIRTAIDTGCGVASWGAYLLSRDILPISF  251

Query  559  APKDTHEAQVQFALERXIP  615
            APKDTHEAQVQFALER +P
Sbjct  252  APKDTHEAQVQFALERGVP  270



>ref|XP_011091674.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=645

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS++  +L F  HH AE LV ++ +  A +FPPC  + SEYTPCQDT RSLKFDR ML Y
Sbjct  75   SSANTTTLHFNPHHTAEQLVPLSPSARALQFPPCDRKFSEYTPCQDTARSLKFDRDMLVY  134

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELLKCR+PAP GY+ P RWPESRD VWYANVPHKHLTVEKAGQNWVRF+G+
Sbjct  135  RERHCPEKSELLKCRVPAPHGYKTPFRWPESRDVVWYANVPHKHLTVEKAGQNWVRFEGD  194

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF+FPGGGTMFPRGADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSRDI P+SF
Sbjct  195  RFSFPGGGTMFPRGADAYIDDIGKLINLGDGSIRTAIDTGCGVASWGAYLLSRDILPMSF  254

Query  559  APKDTHEAQVQFALERXIP  615
            APKDTHEAQVQFALER +P
Sbjct  255  APKDTHEAQVQFALERGVP  273



>ref|XP_007220534.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
 gb|EMJ21733.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
Length=632

 Score =   324 bits (830),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            ++ + LDF AHH AEDL     A      PPC A+LSEYTPCQD  RSLKFDR  L YRE
Sbjct  64   NTTIHLDFEAHHRAEDLPLPPAAARVAHLPPCDAKLSEYTPCQDVTRSLKFDRERLVYRE  123

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP KEELLKCRIPAP GY +P RWPESRDSVWYANVPHK LTVEK  QNWV ++G+RF
Sbjct  124  RHCPEKEELLKCRIPAPHGYTVPFRWPESRDSVWYANVPHKELTVEKKKQNWVHYEGDRF  183

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAYID+IG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI P+SFAP
Sbjct  184  RFPGGGTMFPRGADAYIDEIGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILPMSFAP  243

Query  565  KDTHEAQVQFALERXIP  615
            +DTHE QVQFALER +P
Sbjct  244  RDTHEGQVQFALERGVP  260



>ref|XP_009343539.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            +  + LDF AHH AEDL     A      PPC A+LSEYTPC+D  RSLKFDR+ L YRE
Sbjct  63   NKTIHLDFKAHHTAEDLPLPPAAARVDHLPPCNAKLSEYTPCEDLTRSLKFDRKRLVYRE  122

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP KEELLKCRIPAP GY +P+RWPESRDSVWYANVPHK LTVEK  QNWV + G+RF
Sbjct  123  RHCPEKEELLKCRIPAPHGYTVPLRWPESRDSVWYANVPHKELTVEKKKQNWVHYDGDRF  182

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAYIDDIG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP
Sbjct  183  RFPGGGTMFPRGADAYIDDIGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILTVSFAP  242

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  243  RDTHEAQVQFALERGVP  259



>ref|XP_008232735.1| PREDICTED: probable methyltransferase PMT15 [Prunus mume]
Length=632

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            + ++ + LDF AHH AEDL     A      PPC A+LSEYTPCQD  RSLKFDR  L Y
Sbjct  62   TRNTTIHLDFEAHHRAEDLPLPPAAARVSHLPPCDAKLSEYTPCQDVTRSLKFDRERLVY  121

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELLKCRIPAP GY++P +WPESRDSVWYANVPHK LTVEK  QNWV+++G+
Sbjct  122  RERHCPEKGELLKCRIPAPHGYKVPFQWPESRDSVWYANVPHKELTVEKKKQNWVQYEGD  181

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYID+IG+LINL+DGS+RTAIDTGCGVASWGAYLLSRDI P+SF
Sbjct  182  RFRFPGGGTMFPRGADAYIDEIGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDILPMSF  241

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  242  APRDTHEAQVQFALERGVP  260



>ref|XP_008375906.1| PREDICTED: probable methyltransferase PMT15 [Malus domestica]
Length=632

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            +  + LDF AHH AEDL     A      PPC A+LSEYTPC+D  RSLKFDR+ L YRE
Sbjct  63   NKTIHLDFKAHHTAEDLPLPPAAARVDHLPPCNAKLSEYTPCEDLTRSLKFDRKRLVYRE  122

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP KEELLKCRIPAP GY +P+RWPESRDSVWYANVPHK LTVEK  QNWV + G+RF
Sbjct  123  RHCPEKEELLKCRIPAPHGYTVPLRWPESRDSVWYANVPHKELTVEKKKQNWVHYDGDRF  182

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAYIDDIG+LINL DGS+RTAIDTGCGVASWGAYLLSRDI  +SFAP
Sbjct  183  RFPGGGTMFPRGADAYIDDIGKLINLGDGSVRTAIDTGCGVASWGAYLLSRDILTVSFAP  242

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  243  RDTHEAQVQFALERGVP  259



>emb|CDP08881.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            SS+V+LDF A H A+DLV ++ +   ++ PPCK E SEYTPC+D  RSLKFDR    YRE
Sbjct  73   SSSVTLDFTARHNADDLVPLSSSARVEQIPPCKPEFSEYTPCEDVNRSLKFDRDRNIYRE  132

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP K+ELLKCRIPAP GY+   RWP SRD VWYANVPHKHLTVEKA QNWV+FKG+RF
Sbjct  133  RHCPEKDELLKCRIPAPHGYKTSFRWPASRDMVWYANVPHKHLTVEKAKQNWVQFKGDRF  192

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGAD+YI DIG+ INLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP
Sbjct  193  KFPGGGTMFPRGADSYIADIGKFINLKDGSIRTAIDTGCGVASWGAYLLSRNILSVSFAP  252

Query  565  KDTHEAQVQFALERXIP  615
            +DTH AQVQFALER +P
Sbjct  253  RDTHVAQVQFALERGVP  269



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            +A  LDFA+HH+A+D      +P  K +PPC  + SEYTPC+D ERSLKFDR  L YRER
Sbjct  91   NAPKLDFASHHSADDGGVTTLSPAIKSYPPCDIKYSEYTPCEDQERSLKFDRDRLIYRER  150

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP K ELLKCR+PAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF 
Sbjct  151  HCPEKNELLKCRVPAPYGYKNPFQWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFR  210

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+
Sbjct  211  FPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPR  270

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  271  DTHEAQVQFALERGVP  286



>ref|XP_004306838.1| PREDICTED: probable methyltransferase PMT15 [Fragaria vesca subsp. 
vesca]
Length=627

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 165/212 (78%), Gaps = 8/212 (4%)
 Frame = +1

Query  4    TTNLTSSSS--------AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDT  159
            TT++TS+ S           LDFAAHH AEDL            PPC A L+EYTPC+D 
Sbjct  44   TTSVTSAISCPHLLPNITTHLDFAAHHRAEDLPLPPTTARVSHVPPCDARLAEYTPCEDA  103

Query  160  ERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTV  339
             RSLKF+R  L YRERHCP K ELLKCRIPAP GY++P RWPESR SVWYANVPHK LTV
Sbjct  104  TRSLKFERDRLVYRERHCPEKNELLKCRIPAPHGYQVPFRWPESRGSVWYANVPHKELTV  163

Query  340  EKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWG  519
            EK  QNWV ++G+RF FPGGGTMFP GADAYIDDIGRLINL+DGSIRTAIDTGCGVASWG
Sbjct  164  EKKNQNWVHYEGDRFRFPGGGTMFPNGADAYIDDIGRLINLRDGSIRTAIDTGCGVASWG  223

Query  520  AYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
             YLLSRDI  +SFAP+DTHEAQVQFALER IP
Sbjct  224  GYLLSRDILTVSFAPRDTHEAQVQFALERGIP  255



>ref|XP_004155808.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=635

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 166/204 (81%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            T   +++++ + LDFAAHH A DL  V Q      FPPC ++L EYTPC+D ERSLKFDR
Sbjct  59   TIENSTATTVIDLDFAAHHTAADL-PVVQKARRPNFPPCDSKLYEYTPCEDRERSLKFDR  117

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L YRERHCP   E+LKCR+PAP GY++P RWPESRD  W++NVPHK LTVEK  QNWV
Sbjct  118  DRLIYRERHCPEAGEILKCRVPAPAGYKVPFRWPESRDFAWFSNVPHKELTVEKKNQNWV  177

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            RF+ +RF FPGGGTMFPRGADAYIDDIG+LINL DGSIRTA+DTGCGVASWGAYLLSR+I
Sbjct  178  RFENDRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGCGVASWGAYLLSRNI  237

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+DTHEAQVQFALER +P
Sbjct  238  VTMSFAPRDTHEAQVQFALERGVP  261



>ref|XP_009349944.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH AEDL     A      P C A+ SEYTPC+D  RSLKFDR  L YRERHCP 
Sbjct  68   LDFNAHHRAEDLPLPPVAARVAHLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPD  127

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELLKCRIPAP GY++P RWPESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGG
Sbjct  128  KEELLKCRIPAPHGYKVPFRWPESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGG  187

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDIG+LINL++GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHE
Sbjct  188  GTMFPRGADAYIDDIGKLINLREGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHE  247

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  248  AQVQFALERGVP  259



>ref|XP_008383220.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=583

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH AEDL     A      P C A+ SEYTPC+D  RSLKFDR  L YRERHCP 
Sbjct  19   LDFNAHHRAEDLPXPPVAARVAHLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPD  78

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELLKCRIPAP GY +P RWPESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGG
Sbjct  79   KEELLKCRIPAPHGYTVPFRWPESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGG  138

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDIG+LINL+ GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHE
Sbjct  139  GTMFPRGADAYIDDIGKLINLRGGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHE  198

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  199  AQVQFALERGVP  210



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDL-VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +S++ +LDF++HH+A+D  +       AK +PPC  + SEYTPC+D +RSLKF R  L Y
Sbjct  87   TSNSKALDFSSHHSADDRGIGKVSGGSAKVYPPCDVKYSEYTPCEDPKRSLKFSRSRLIY  146

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCPAK ELLKCRIPAP+GYR P +WP SRD  WYANVPHK LTVEKA QNW+R++G+
Sbjct  147  RERHCPAKHELLKCRIPAPYGYRNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRYEGD  206

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SF
Sbjct  207  RFRFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSF  266

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  267  APRDTHEAQVQFALERGVP  285



>ref|XP_009770932.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=653

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF  HHAA+D  AVA     K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP 
Sbjct  95   LDFRTHHAADDGGAVAPDDAVKIYPPCDVKFSEYTPCEDQKRSLKFKRDRLIYRERHCPE  154

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGG
Sbjct  155  KNELLKCRIPAPYGYKNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGG  214

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHE
Sbjct  215  GTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHE  274

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  275  AQVQFALERGVP  286



>ref|XP_010255518.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            ++ V LDF+ H AAED + +      + FP C  + SEYTPC+DT+RSLKF+R  L YRE
Sbjct  77   TATVVLDFSTHQAAEDTITLPPPRGPRYFPACDVKYSEYTPCEDTKRSLKFERDRLIYRE  136

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP K ELLKCR+PAP+GY+ P  WPESRD  WYANVPHK LTVEKAGQNW+RF+G+RF
Sbjct  137  RHCPQKAELLKCRVPAPYGYKSPFTWPESRDFAWYANVPHKELTVEKAGQNWIRFEGDRF  196

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GADAYID+IG+LINL+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP
Sbjct  197  RFPGGGTMFPNGADAYIDEIGKLINLRDGSIRTAIDTGCGVASWGAYLLSRNILAISFAP  256

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  257  RDTHEAQVQFALERGVP  273



>ref|XP_009801989.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nicotiana 
sylvestris]
Length=647

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            T + TSS S   LDF  HH+ +D  AV      K +PPC  + SEYTPC+D ERSLKF+R
Sbjct  80   TNSPTSSKSTQKLDFTTHHSTDDGGAVTPDDSIKIYPPCDIKYSEYTPCEDPERSLKFNR  139

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L YRERHCP K ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+
Sbjct  140  NRLIYRERHCPEKNELLKCRIPAPYGYKNPFKWPISRDLAWYANVPHKELTVEKAVQNWI  199

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            R++G+RF FPGGGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I
Sbjct  200  RYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNI  259

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+D+HEAQVQFALER +P
Sbjct  260  IAISFAPRDSHEAQVQFALERGVP  283



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 165/200 (83%), Gaps = 1/200 (1%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            ++++S + LDFAAHH A DL  V Q      FPPC ++L EYTPC+D +RSLKFDR  L 
Sbjct  63   STATSVIDLDFAAHHTAADL-PVVQKARRPNFPPCDSKLYEYTPCEDRDRSLKFDRDRLI  121

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP   E+LKCR+PAP GY++P RWPESRD  W++NVPHK LTVEK  QNWVRF+ 
Sbjct  122  YRERHCPEAGEILKCRVPAPPGYKVPFRWPESRDFAWFSNVPHKELTVEKKNQNWVRFEN  181

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDIG+LINL DGSIRTA+DTGCGVASWGAYLLSR+I  +S
Sbjct  182  DRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGCGVASWGAYLLSRNIVTMS  241

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  242  FAPRDTHEAQVQFALERGVP  261



>ref|XP_008354467.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=628

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH AEDL     A      P C A+ SEYTPC+D  RSLKFDR  L YRERHCP 
Sbjct  64   LDFNAHHRAEDLPLPPVAARVAHLPACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPD  123

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELLKCRIPAP GY +P RWPESR+SVWYANVPHK LTVEK  QNWV ++G+RF FPGG
Sbjct  124  KEELLKCRIPAPHGYTVPFRWPESRESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGG  183

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDIG+LINL+ GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHE
Sbjct  184  GTMFPRGADAYIDDIGKLINLRGGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHE  243

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  244  AQVQFALERGVP  255



>ref|XP_009801988.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nicotiana 
sylvestris]
Length=648

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            T + TSS S   LDF  HH+ +D  AV      K +PPC  + SEYTPC+D ERSLKF+R
Sbjct  80   TNSPTSSKSTQKLDFTTHHSTDDGGAVTPDDSIKIYPPCDIKYSEYTPCEDPERSLKFNR  139

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L YRERHCP K ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+
Sbjct  140  NRLIYRERHCPEKNELLKCRIPAPYGYKNPFKWPISRDLAWYANVPHKELTVEKAVQNWI  199

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            R++G+RF FPGGGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I
Sbjct  200  RYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNI  259

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+D+HEAQVQFALER +P
Sbjct  260  IAISFAPRDSHEAQVQFALERGVP  283



>ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15 [Vitis vinifera]
 emb|CBI38771.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAK--EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
            +LDF  HH+A DL  +A   PA+   FP C   LSEYTPC+D +RSLKFDR ML YRERH
Sbjct  68   TLDFDTHHSAIDL-PIAPTSPARVNHFPACPTYLSEYTPCEDAQRSLKFDRVMLVYRERH  126

Query  211  CPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
            CP   E+LKCR+PAP GY  P RWPESRDSVW+ANVPHK LTVEKA QNWVRF+G+RF F
Sbjct  127  CPEPNEVLKCRVPAPNGYTTPFRWPESRDSVWFANVPHKELTVEKAVQNWVRFEGKRFRF  186

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMFPRGADAYID+IG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D
Sbjct  187  PGGGTMFPRGADAYIDEIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRD  246

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  247  THEAQVQFALERGVP  261



>ref|XP_009610423.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=651

 Score =   310 bits (793),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+ HHAA+D  AV      K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP 
Sbjct  93   LDFSTHHAADDGGAVTADDAVKIYPPCDFKYSEYTPCEDQKRSLKFKRDRLIYRERHCPE  152

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FPGG
Sbjct  153  KSELLKCRIPAPYGYKNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGG  212

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHE
Sbjct  213  GTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHE  272

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  273  AQVQFALERGVP  284



>gb|KDP22318.1| hypothetical protein JCGZ_26149 [Jatropha curcas]
Length=652

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            SLDF AHH A+D    A   P K +PPC    SEYTPC+D  RSL+F RR L YRERHCP
Sbjct  90   SLDFGAHHMADD--DGAATSPVKVYPPCNVNFSEYTPCEDARRSLRFSRRQLIYRERHCP  147

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             K+E +KCR+PAP+GY+ P  WP+SRD  WYANVPHKHLTVEKA QNW+R++G+RF FPG
Sbjct  148  EKDERIKCRVPAPYGYKNPFAWPKSRDLAWYANVPHKHLTVEKAVQNWIRYEGDRFRFPG  207

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH
Sbjct  208  GGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTH  267

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  268  EAQVQFALERGVP  280



>gb|KDP28686.1| hypothetical protein JCGZ_14457 [Jatropha curcas]
Length=628

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 164/194 (85%), Gaps = 4/194 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDL-VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            +LDF+AHH + D  V VA+       PPC  + SEYTPC+D ERSLKFDR+ L YRERHC
Sbjct  66   TLDFSAHHYSPDPPVTVARV---SHLPPCDPKYSEYTPCEDRERSLKFDRKKLVYRERHC  122

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P K ELLKCR+PAPFGYR+P RWP SR+ VWYA+VPHK LTVEK  QNWVRF+G+RF FP
Sbjct  123  PEKNELLKCRVPAPFGYRVPFRWPVSREYVWYADVPHKELTVEKKKQNWVRFEGDRFRFP  182

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDIG+LINLKDGSIRTA+DTGCGVAS+GAYLLSR+I  +SFAP+DT
Sbjct  183  GGGTMFPRGADAYIDDIGKLINLKDGSIRTAVDTGCGVASFGAYLLSRNILTVSFAPRDT  242

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  243  HEAQVQFALERGVP  256



>ref|XP_004309222.1| PREDICTED: probable methyltransferase PMT16 [Fragaria vesca subsp. 
vesca]
Length=646

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            ++ + T + +  +LDF  HH     + ++   P K FPPC  + SEYTPC+D +RSLKF+
Sbjct  75   NSPDTTLTKNQQTLDFTTHHNPNYAINISNNTP-KTFPPCDVKYSEYTPCEDAKRSLKFE  133

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L YRERHCPAK+ELLKCR+PAP GYR    WP+SRD  WYANVPHK LT+EKA QNW
Sbjct  134  RERLIYRERHCPAKDELLKCRVPAPHGYRNTFTWPKSRDLAWYANVPHKELTIEKAVQNW  193

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            + ++G+RF FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSRD
Sbjct  194  IIYQGDRFKFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRD  253

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I P+SFAP+DTHEAQVQFALER +P
Sbjct  254  ILPISFAPRDTHEAQVQFALERGVP  278



>ref|XP_002279420.2| PREDICTED: probable methyltransferase PMT15 isoform X1 [Vitis 
vinifera]
 emb|CBI31829.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            + +S+DF+ HHAAED VA       K +P C  E SEYTPC+ T+R+LKF+R  L YRER
Sbjct  94   AQLSIDFSTHHAAEDGVATVPEEKVKSYPACGVEYSEYTPCEGTKRALKFERERLIYRER  153

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP K +LLKCRIPAP+GYR P  WP SRD  WYANVPHK LTVEKA QNW+ ++G+RF 
Sbjct  154  HCPEKGDLLKCRIPAPYGYRNPPAWPASRDVAWYANVPHKELTVEKAVQNWIIYEGDRFR  213

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+
Sbjct  214  FPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPR  273

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  274  DTHEAQVQFALERGVP  289



>ref|XP_002318832.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
 gb|EEE97052.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
Length=655

 Score =   307 bits (786),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF++HH A+DL         K +P C    SEYTPC+D +RSL+F R  L YRERHCP 
Sbjct  95   LDFSSHHKADDL-DFTLTSEVKSYPSCNVNFSEYTPCEDAKRSLRFKRHQLIYRERHCPE  153

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+LKCRIPAP GY+ P +WP SRD  WY NVPHKHLTVEKAGQNW+RF G+RF FPGG
Sbjct  154  KHEILKCRIPAPHGYKNPFKWPASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGG  213

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHE
Sbjct  214  GTMFPNGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHE  273

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  274  AQVQFALERGVP  285



>ref|XP_003551650.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=561

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = +1

Query  64   AEDLVAVAQAPPAKEF--PPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLK  237
            A +L  V  A  +++F  PPC A LSEYTPC+D +RSLKF R  L YRERHCP +EELL+
Sbjct  12   AVELEVVIGAGASRDFHAPPCAASLSEYTPCEDVQRSLKFPRENLIYRERHCPTEEELLR  71

Query  238  CRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPR  417
            CR+PAPFGYR+P+RWPESRD+ W+ANVPHK LTVEK  QNWVRF+G+RF FPGGGTMFPR
Sbjct  72   CRVPAPFGYRVPLRWPESRDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPR  131

Query  418  GADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFA  597
            GADAYIDDIG+LI+LKDGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+DTHEAQVQFA
Sbjct  132  GADAYIDDIGKLIDLKDGSIRTALDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFA  191

Query  598  LERXIP  615
            LER +P
Sbjct  192  LERGVP  197



>gb|KJB09868.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=564

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            S     LDF  HH   D   V    P   FPPC    SEYTPC+D  RSLKFDR ML YR
Sbjct  65   SLHTAQLDFMPHHLPHDPTPVTARVP--HFPPCNISFSEYTPCEDARRSLKFDRDMLIYR  122

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            +RHCPAK ELLKCRIPAP+GY++P RWPESR+  W+ANVPHK LTVEK  QNWV+ +GE+
Sbjct  123  QRHCPAKNELLKCRIPAPYGYKVPFRWPESREFAWFANVPHKELTVEKKAQNWVKVEGEK  182

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGA AYIDDI +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFA
Sbjct  183  FRFPGGGTMFPRGAGAYIDDIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFA  242

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  243  PRDTHEAQVQFALERGVP  260



>ref|XP_006421866.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
 gb|ESR35106.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
Length=626

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            ++DF AHH A    A +     K +P C    SEYTPCQD +RSLKF RR L YRERHCP
Sbjct  70   TIDFTAHHVA----ATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLIYRERHCP  125

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
            AK ELLKCR+PAP+GYR P  WP SRD VWYANVPHK LTVEKA QNW+R++G+RF FPG
Sbjct  126  AKSELLKCRVPAPYGYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEGDRFRFPG  185

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH
Sbjct  186  GGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTH  245

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  246  EAQVQFALERGVP  258



>ref|XP_006490342.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|KDO60066.1| hypothetical protein CISIN_1g006905mg [Citrus sinensis]
Length=626

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            ++DF AHH A    A +     K +P C    SEYTPCQD +RSLKF RR L YRERHCP
Sbjct  70   TIDFTAHHVA----ATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLIYRERHCP  125

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
            AK ELLKCR+PAP+GYR P  WP SRD VWYANVPHK LTVEKA QNW+R++G+RF FPG
Sbjct  126  AKSELLKCRVPAPYGYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEGDRFRFPG  185

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTH
Sbjct  186  GGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTH  245

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  246  EAQVQFALERGVP  258



>ref|XP_007139952.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
 gb|AER13155.1| putative methyltransferase [Phaseolus vulgaris]
 gb|ESW11946.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
Length=634

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 164/203 (81%), Gaps = 3/203 (1%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            +N  S+ S  +LDF++ H + D     +   A   PPC A L+EYTPC+D  RSLKF R 
Sbjct  69   SNFLSTISNSTLDFSSTHFSPD---PEEGTRAFHAPPCDATLAEYTPCEDVNRSLKFPRE  125

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCP + E L+CRIPAPFGYR+P+RWPESRD+ W+ANVPHK LTVEK  QNWVR
Sbjct  126  DLIYRERHCPVEAEALRCRIPAPFGYRVPLRWPESRDAAWFANVPHKELTVEKKNQNWVR  185

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
            F+G+RF FPGGGTMFPRGA AYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSRDI 
Sbjct  186  FEGDRFRFPGGGTMFPRGASAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRDIL  245

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTHEAQVQFALER +P
Sbjct  246  AVSFAPRDTHEAQVQFALERGVP  268



>gb|KDO86014.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=544

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 160/202 (79%), Gaps = 10/202 (5%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
            +S+ ++LDF+AHH A D       PP        PPC  +  E  PC+DT RSLKFDR  
Sbjct  70   ASTNLNLDFSAHHQAPD------PPPTLARVTYIPPCDPKYVENVPCEDTHRSLKFDRDR  123

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L YRERHCP K ELLKCR+PAP GY +P RWPESR   WYANVPHK LTVEK  QNWVRF
Sbjct  124  LIYRERHCPEKTELLKCRVPAPHGYTVPFRWPESRQFAWYANVPHKELTVEKKNQNWVRF  183

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            +G+RF+FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYL+SR+I  
Sbjct  184  QGDRFSFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLMSRNILA  243

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAP+DTHEAQVQFALER +P
Sbjct  244  VSFAPRDTHEAQVQFALERGVP  265



>ref|XP_002510829.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51431.1| ATP binding protein, putative [Ricinus communis]
Length=649

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            TT   +      LDF  HH A+D   V  AP  K +PPC    SEYTPC+D  RSL+F+R
Sbjct  76   TTATNNKKQEEPLDFVPHHVAQD-GGVTVAPEVKIYPPCNVNFSEYTPCEDDNRSLRFNR  134

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
            R L YRERHCP   E +KCRIPAP+GY+ P  WP SR+  WYANVPHKHLTVEKA QNW+
Sbjct  135  RQLIYRERHCPETYEKIKCRIPAPYGYKNPFTWPASRNFAWYANVPHKHLTVEKAVQNWI  194

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            R++G+RF FPGGGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I
Sbjct  195  RYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNI  254

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+DTHEAQVQFALER +P
Sbjct  255  LTMSFAPRDTHEAQVQFALERGVP  278



>gb|KJB09867.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=628

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            S     LDF  HH   D   V    P   FPPC    SEYTPC+D  RSLKFDR ML YR
Sbjct  65   SLHTAQLDFMPHHLPHDPTPVTARVP--HFPPCNISFSEYTPCEDARRSLKFDRDMLIYR  122

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            +RHCPAK ELLKCRIPAP+GY++P RWPESR+  W+ANVPHK LTVEK  QNWV+ +GE+
Sbjct  123  QRHCPAKNELLKCRIPAPYGYKVPFRWPESREFAWFANVPHKELTVEKKAQNWVKVEGEK  182

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGA AYIDDI +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFA
Sbjct  183  FRFPGGGTMFPRGAGAYIDDIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFA  242

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  243  PRDTHEAQVQFALERGVP  260



>ref|XP_006340522.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=654

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 163/202 (81%), Gaps = 2/202 (1%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAP--PAKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
            +S ++   LDF  HH+A D  A   AP    K +P C  + SEYTPC+D ERSLKF+RR 
Sbjct  86   SSRTTTKKLDFTTHHSAADGGAAVTAPDDAIKIYPVCDIKYSEYTPCEDPERSLKFNRRR  145

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L YRERHCP K ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+R+
Sbjct  146  LIYRERHCPEKNELLKCRIPAPYGYKNPFKWPVSRDVAWYANVPHKELTVEKAVQNWIRY  205

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            +G++F FPGGGTMFP GADAYIDDI +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  
Sbjct  206  EGDKFRFPGGGTMFPNGADAYIDDIAKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIIA  265

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAP+D+HEAQVQFALER +P
Sbjct  266  MSFAPRDSHEAQVQFALERGVP  287



>ref|XP_011041603.1| PREDICTED: probable methyltransferase PMT16 [Populus euphratica]
Length=631

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 157/200 (79%), Gaps = 1/200 (1%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            T +    SLDFA HH+A DL  V      + +P C   LSEYTPC+D +RS KF R  L 
Sbjct  63   TVTKEGKSLDFATHHSAGDL-DVTSTSEVRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLI  121

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            Y ERHCP K+E+LKCRIPAP+GYR P  WP SRD  WY NVPHKHLTVEKA QNW+RF+ 
Sbjct  122  YEERHCPEKDEILKCRIPAPYGYRNPFTWPASRDYAWYNNVPHKHLTVEKAVQNWIRFEA  181

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFP GADAYIDDIGRLI+LKDGSIRTAIDTGCGVASWGAYLLSR++  +S
Sbjct  182  DRFRFPGGGTMFPNGADAYIDDIGRLIDLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMS  241

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+D HEAQVQFALER +P
Sbjct  242  FAPRDNHEAQVQFALERGVP  261



>ref|XP_003533625.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=622

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEF--PPCKAELSEYTPCQDTERSLKF  177
            T +    +S  +L+F+A H + D  A     PA++F  PPC   LSEYTPC+D +RSLKF
Sbjct  51   TAHSNCPNSIPTLNFSATHFSPDPQA-----PARDFYAPPCDPSLSEYTPCEDVQRSLKF  105

Query  178  DRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQN  357
             R  L YRERHCP  EELL+CR+PAPFGYR+P+RWPESRD+ W+ANVPHK LTVEK  QN
Sbjct  106  PRENLIYRERHCPPAEELLRCRVPAPFGYRVPLRWPESRDAAWFANVPHKELTVEKKNQN  165

Query  358  WVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSR  537
            WVRF+G++F FPGGGTMFPRGA AYIDDIG+LINL+DGSIRTA+DTGCGVASWGAYLLSR
Sbjct  166  WVRFEGDQFRFPGGGTMFPRGAGAYIDDIGKLINLEDGSIRTALDTGCGVASWGAYLLSR  225

Query  538  DIFPLSFAPKDTHEAQVQFALERXIP  615
            DI  +SFAP+DTHEAQVQFALER +P
Sbjct  226  DIIAVSFAPRDTHEAQVQFALERGVP  251



>ref|XP_011030063.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=655

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF++HH A+DL         K +P C    SEYTPC+D +RSL+F R  L  RERHCP 
Sbjct  95   LDFSSHHKADDL-DFTLTSEVKSYPSCNVNFSEYTPCEDAKRSLRFKRHQLICRERHCPE  153

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+LKCRIPAP GY+ P +WP SRD  WY NVPHKHLTVEKAGQNW+RF G+RF FPGG
Sbjct  154  KHEILKCRIPAPHGYKNPFKWPASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGG  213

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHE
Sbjct  214  GTMFPNGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHE  273

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  274  AQVQFALERGVP  285



>ref|XP_009626220.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=650

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF  HH+ +D   V      K +PPC  + SEYTPC+D ERSLKF+R  L YRERHCP 
Sbjct  95   LDFTTHHSTDDGGGVTPDDSIKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPE  154

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELLKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+R++G+RF FPGG
Sbjct  155  KKELLKCRIPAPYGYKNPFKWPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGG  214

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+HE
Sbjct  215  GTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHE  274

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  275  AQVQFALERGVP  286



>ref|XP_011101180.1| PREDICTED: probable methyltransferase PMT16 [Sesamum indicum]
Length=645

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = +1

Query  19   SSSSAVSLDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S ++   LDFA HH AA D  A   A  +  +PPC  + SEYTPC+D +RSLKF R  L 
Sbjct  82   SPTATTKLDFATHHSAAVDEGAATLA--SSTYPPCSIKYSEYTPCEDQKRSLKFPRDRLI  139

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E L+CR+PAP+GY+ P +WP SRD VWYANVPHK LTVEKA QNW+RF+G
Sbjct  140  YRERHCPEKKERLRCRVPAPYGYKNPFKWPVSRDLVWYANVPHKELTVEKAVQNWIRFEG  199

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I P+S
Sbjct  200  DRFRFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPIS  259

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  260  FAPRDTHEAQVQFALERGVP  279



>ref|XP_010053660.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
 gb|KCW78011.1| hypothetical protein EUGRSUZ_D02245 [Eucalyptus grandis]
Length=650

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 157/195 (81%), Gaps = 1/195 (1%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAK-EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
            V LDF AHH AEDL+    A      FPPC  + SEYTPC+D +RSL+FDR  L YRERH
Sbjct  88   VVLDFEAHHRAEDLIPTEAATAQDLHFPPCDPKFSEYTPCEDVQRSLRFDRERLVYRERH  147

Query  211  CPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
            CP K E LKCRIPAP GYR+P  WPESRD  W+ANVPHK LTVEK  QNWVRF+G+RF F
Sbjct  148  CPEKRERLKCRIPAPHGYRLPFPWPESRDKAWFANVPHKELTVEKKKQNWVRFEGDRFIF  207

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMF  GADAYIDDIG++I+L+ GSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+D
Sbjct  208  PGGGTMFSNGADAYIDDIGKMIDLRGGSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRD  267

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  268  THEAQVQFALERGVP  282



>gb|ACN78962.1| methyltransferase [Glycine max]
Length=759

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 167/199 (84%), Gaps = 8/199 (4%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEF--PPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +S  +L+F+A H   D  A      +++F  PPC A LSEYTPC+D +RSLKF R  L Y
Sbjct  66   NSNPTLNFSATHFPPDPDA------SRDFHAPPCAASLSEYTPCEDVQRSLKFPRENLIY  119

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP +EELL+CR+PAPFGYR+P+RWPESRD+ W+ANVPHK LTVEK  QNWVRF+G+
Sbjct  120  RERHCPTEEELLRCRVPAPFGYRVPLRWPESRDAAWFANVPHKELTVEKKNQNWVRFEGD  179

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDIG+LI+LKDGSIRTA+DTGCGVASWGAYLLSRDI  +SF
Sbjct  180  RFRFPGGGTMFPRGADAYIDDIGKLIDLKDGSIRTALDTGCGVASWGAYLLSRDILAVSF  239

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  240  APRDTHEAQVQFALERGVP  258



>ref|XP_004133882.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=640

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 165/209 (79%), Gaps = 6/209 (3%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            T   +++++ + LDFAAHH A DL  V Q      FPPC ++L EYTPC+D ERSLKFDR
Sbjct  59   TIENSTATTVIDLDFAAHHTAADL-PVVQKARRPNFPPCDSKLYEYTPCEDRERSLKFDR  117

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L YRERHCP   E+LKCR+PAP GY++P RWPESRD  W++NVPHK LTVEK  QNWV
Sbjct  118  DRLIYRERHCPEAGEILKCRVPAPAGYKVPFRWPESRDFAWFSNVPHKELTVEKKNQNWV  177

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCG-----VASWGAYL  528
            RF+ +RF FPGGGTMFPRGADAYIDDIG+LINL DGSIRTA+DTG G     VASWGAYL
Sbjct  178  RFENDRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGWGGRNGYVASWGAYL  237

Query  529  LSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            LSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  238  LSRNIVTMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_004234366.1| PREDICTED: probable methyltransferase PMT16 [Solanum lycopersicum]
Length=650

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAP--PAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            LDF  HH+A D    A  P    K +PPC  + SEYTPC+D  RSLK++R  L YRERHC
Sbjct  93   LDFTTHHSAGDGAGGAVVPDDTVKIYPPCDVKYSEYTPCEDPTRSLKYNRDRLIYRERHC  152

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P K E LKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FP
Sbjct  153  PEKSEFLKCRIPAPYGYKNPFKWPMSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFP  212

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DT
Sbjct  213  GGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDT  272

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  273  HEAQVQFALERGVP  286



>ref|XP_006445150.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 ref|XP_006491016.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|ESR58390.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 gb|KDO86013.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=636

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 160/202 (79%), Gaps = 10/202 (5%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
            +S+ ++LDF+AHH A D       PP        PPC  +  E  PC+DT RSLKFDR  
Sbjct  70   ASTNLNLDFSAHHQAPD------PPPTLARVTYIPPCDPKYVENVPCEDTHRSLKFDRDR  123

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L YRERHCP K ELLKCR+PAP GY +P RWPESR   WYANVPHK LTVEK  QNWVRF
Sbjct  124  LIYRERHCPEKTELLKCRVPAPHGYTVPFRWPESRQFAWYANVPHKELTVEKKNQNWVRF  183

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            +G+RF+FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYL+SR+I  
Sbjct  184  QGDRFSFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLMSRNILA  243

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAP+DTHEAQVQFALER +P
Sbjct  244  VSFAPRDTHEAQVQFALERGVP  265



>ref|XP_002511797.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50466.1| ATP binding protein, putative [Ricinus communis]
Length=627

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 160/199 (80%), Gaps = 12/199 (6%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAK-----EFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
             +LDF  HH   D       PP K       PPC  ELSEYTPC+D +RSL+FDR  L Y
Sbjct  62   TTLDFDPHHQLPD-------PPLKAARVLHLPPCDPELSEYTPCEDRQRSLQFDRDRLVY  114

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELLKCR+PAPFGYR+P RWP SR+  W+ANVPHK LTVEK  QNWVRF+G+
Sbjct  115  RERHCPEKKELLKCRVPAPFGYRVPFRWPVSREYGWFANVPHKELTVEKKNQNWVRFEGD  174

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVAS+GAYLLSR+I  +SF
Sbjct  175  RFRFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASFGAYLLSRNILTMSF  234

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  235  APRDTHEAQVQFALERGVP  253



>gb|KDO86012.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=637

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 160/202 (79%), Gaps = 10/202 (5%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
            +S+ ++LDF+AHH A D       PP        PPC  +  E  PC+DT RSLKFDR  
Sbjct  70   ASTNLNLDFSAHHQAPD------PPPTLARVTYIPPCDPKYVENVPCEDTHRSLKFDRDR  123

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L YRERHCP K ELLKCR+PAP GY +P RWPESR   WYANVPHK LTVEK  QNWVRF
Sbjct  124  LIYRERHCPEKTELLKCRVPAPHGYTVPFRWPESRQFAWYANVPHKELTVEKKNQNWVRF  183

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            +G+RF+FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYL+SR+I  
Sbjct  184  QGDRFSFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLMSRNILA  243

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAP+DTHEAQVQFALER +P
Sbjct  244  VSFAPRDTHEAQVQFALERGVP  265



>gb|EYU19524.1| hypothetical protein MIMGU_mgv1a002864mg [Erythranthe guttata]
Length=629

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP-  216
            LDFA HH+A D  A       K +PPC  + SEYTPC+D +RSLKF R  L YRERHCP 
Sbjct  79   LDFATHHSASDGGAAV-----KPYPPCSGKYSEYTPCEDPKRSLKFPRDKLIYRERHCPE  133

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             K+ELLKCR+PAP GY+ P +WP SRD VWYANVPHK LTVEKA QNW+RF+G+RF FPG
Sbjct  134  KKKELLKCRVPAPHGYKNPFKWPASRDLVWYANVPHKELTVEKAVQNWIRFEGDRFRFPG  193

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYL+SR+I P+SFAP+DTH
Sbjct  194  GGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLMSRNILPISFAPRDTH  253

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  254  EAQVQFALERGVP  266



>gb|KEH18956.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   301 bits (770),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 160/207 (77%), Gaps = 12/207 (6%)
 Frame = +1

Query  10   NLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAK-----EFPPCKAELSEYTPCQDTERSLK  174
            N  S+ +  SLDF A H   D       PP K       PPC+  L EYTPC+D +RSL+
Sbjct  74   NNNSAITTPSLDFTATHHLPD-------PPLKTARVSHLPPCEPSLYEYTPCEDQKRSLR  126

Query  175  FDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQ  354
            F R+ L YRERHCP  EE L+CRIPAPFGYR+P+RWPESRD  WYANVPHK LTVEK  Q
Sbjct  127  FSRKKLIYRERHCPLPEETLRCRIPAPFGYRLPLRWPESRDGAWYANVPHKELTVEKKNQ  186

Query  355  NWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLS  534
            NWVRF G RF FPGGGTMFPRGA+AY+DDIG+LINLKDGSIRTAIDTGCGVASWGAYLLS
Sbjct  187  NWVRFNGNRFRFPGGGTMFPRGANAYVDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLS  246

Query  535  RDIFPLSFAPKDTHEAQVQFALERXIP  615
            R+I  +S AP+DTHEAQVQFALER +P
Sbjct  247  RNILTVSVAPRDTHEAQVQFALERGVP  273



>ref|XP_002321888.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
 gb|EEF06015.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
Length=631

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            T +    SLDFA HH+A DL  V      + +P C   LSEYTPC+D +RS KF R  L 
Sbjct  63   TVTEEGKSLDFATHHSAGDL-DVTLTSEVRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLI  121

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            Y ERHCP K ELLKCRIPAP+GYR P  WP SRD  WY NVPHKHLTVEKA QNW+RF+G
Sbjct  122  YEERHCPEKGELLKCRIPAPYGYRNPFTWPASRDYAWYNNVPHKHLTVEKAVQNWIRFEG  181

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFP GADAYIDDIGRLI+L DGSIRTAIDTGCGVASWG YLLSR++  +S
Sbjct  182  DRFRFPGGGTMFPNGADAYIDDIGRLIDLNDGSIRTAIDTGCGVASWGGYLLSRNVLTMS  241

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+D HEAQVQFALER +P
Sbjct  242  FAPRDNHEAQVQFALERGVP  261



>ref|XP_006353348.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=647

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAP--PAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            LDF  HH+A D    A  P    K +PPC  + SEYTPC+D  RSLK++R  L YRERHC
Sbjct  90   LDFTTHHSAGDGDGGAVVPDDTVKIYPPCDVKYSEYTPCEDPARSLKYNRDRLIYRERHC  149

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P K E LKCRIPAP+GY+ P +WP SRD  WYANVPHK LTVEKA QNW+RF+G+RF FP
Sbjct  150  PEKSEFLKCRIPAPYGYKNPFKWPMSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFP  209

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DT
Sbjct  210  GGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDT  269

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  270  HEAQVQFALERGVP  283



>ref|XP_010693483.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=642

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +S+ +  LDF AHH A+   + + +   + +PPC    SEYTPC+D  RS+KF R  L Y
Sbjct  73   NSTHSSPLDFMAHHTADHEPSTSDSSLNRVYPPCDITYSEYTPCEDRRRSVKFTRDRLIY  132

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELLKCR+PAPFGY+ P +WP SRD VWY NVPHKHLTVEKA QNW+RF+G+
Sbjct  133  RERHCPKKWELLKCRVPAPFGYKSPFKWPVSRDYVWYDNVPHKHLTVEKAVQNWIRFEGD  192

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFP GA AYID+IG+LINL DGSIRTAIDTGCGVASWGAYLLSR+I  +SF
Sbjct  193  RFKFPGGGTMFPNGAGAYIDEIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIVAMSF  252

Query  559  APKDTHEAQVQFALERXIP  615
            APKDTHEAQVQFALER +P
Sbjct  253  APKDTHEAQVQFALERGVP  271



>ref|XP_011023413.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=623

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 162/201 (81%), Gaps = 6/201 (3%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKE--FPPCKAELSEYTPCQDTERSLKFDRRML  192
            ++ S  +LDF AH  A+D     + P A+E  FPPC+ + SEYTPC+D ERS++FDR  +
Sbjct  63   TNHSTTTLDFGAHRFAQD----PKPPVAREHHFPPCEPKYSEYTPCEDAERSVRFDRNRV  118

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
             YRERHCP   E+LKCR+P P+GY++P  WPESRD  WYANVPHK LTVEK  QNWVR +
Sbjct  119  IYRERHCPESHEILKCRVPPPYGYKVPFSWPESRDWAWYANVPHKDLTVEKKNQNWVRVE  178

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
            GER  FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +
Sbjct  179  GERLRFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTV  238

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTH +QVQFALER +P
Sbjct  239  SFAPRDTHVSQVQFALERGVP  259



>ref|XP_002301329.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE80602.1| dehydration-responsive family protein [Populus trichocarpa]
Length=622

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 162/201 (81%), Gaps = 6/201 (3%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKE--FPPCKAELSEYTPCQDTERSLKFDRRML  192
            ++ S  +LDFAA H A+D     + P A+E  FPPC  + SEYTPC+D +RSL+FDR  L
Sbjct  62   TNHSTTTLDFAARHFAQD----PKPPVAREHHFPPCDPKYSEYTPCEDVDRSLRFDRDRL  117

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
             YRERHCP   E+LKCR+P P+GY++P  WPESR+  WYANVPHK LTVEK  QNWVR +
Sbjct  118  VYRERHCPESHEILKCRVPPPYGYKMPFSWPESRELAWYANVPHKDLTVEKKNQNWVRVE  177

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
            GER  FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +
Sbjct  178  GERLRFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTV  237

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTH +QVQFALER +P
Sbjct  238  SFAPRDTHVSQVQFALERGVP  258



>ref|XP_006857883.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
 gb|ERN19350.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
Length=639

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = +1

Query  10   NLTSSSSAVSLDFAAHHAAE-DLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            NLT S   V LDF  HH AE D  + A A  A+ FPPC+  LSEYTPC+D +RSLKF+R+
Sbjct  61   NLTES---VILDFERHHMAEPDSESDAAAAKARLFPPCEPRLSEYTPCEDRDRSLKFERQ  117

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCP K ELLKCRIPAPFGY+ P  WP+SRD  W+ NVPH+ L+VEKA QNW+R
Sbjct  118  RLIYRERHCPEKGELLKCRIPAPFGYKRPFPWPQSRDFAWFNNVPHRELSVEKAVQNWIR  177

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +GERF FPGGGTMFPRGADAYIDDI +L+ L++GSIRTAIDTGCGVASWGAYL+SRDI 
Sbjct  178  VEGERFRFPGGGTMFPRGADAYIDDIEKLVPLRNGSIRTAIDTGCGVASWGAYLMSRDIL  237

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTHEAQVQFALER +P
Sbjct  238  AMSFAPRDTHEAQVQFALERGVP  260



>ref|XP_003623835.1| hypothetical protein MTR_7g076170 [Medicago truncatula]
 gb|ABN08826.1| Generic methyltransferase [Medicago truncatula]
 gb|AES80053.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+AHH   D    ++       P C   LSEYTPC+DT+RSLKF R  L YRERHCP 
Sbjct  80   LDFSAHHNVPDPPETSER--VTHAPVCDVALSEYTPCEDTQRSLKFPRENLIYRERHCPE  137

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEE+L+CRIPAP+GYR+P RWPESRD  WYANVPHK LT+EK  QNWV F+G+RF FPGG
Sbjct  138  KEEVLRCRIPAPYGYRVPPRWPESRDWAWYANVPHKELTIEKKNQNWVHFEGDRFRFPGG  197

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGA AYIDDIG+LINLKDGS+RTA+DTGCGVASWGAYLL RDI  +SFAP+DTHE
Sbjct  198  GTMFPRGAGAYIDDIGKLINLKDGSVRTALDTGCGVASWGAYLLPRDILAVSFAPRDTHE  257

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  258  AQVQFALERGVP  269



>ref|XP_010559094.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=620

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 10/196 (5%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPP--AKE--FPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            LDFAAHH AED       PP  A+E  FP C  +LSEYTPC+D +RSLKF R  L+YRER
Sbjct  68   LDFAAHHTAED------PPPTAAREVTFPACDVKLSEYTPCEDQKRSLKFPRERLEYRER  121

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP ++E+L+CRIPAP+GY++P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF 
Sbjct  122  HCPERDEVLRCRIPAPYGYKMPFRWPESRDVSWFANVPHTELTVEKKDQNWVRYENDRFW  181

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+
Sbjct  182  FPGGGTMFPRGADAYIDDIGRLIDLTDGSIRTAIDTGCGVASFGAYLLSRNIITMSFAPR  241

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  242  DTHEAQVQFALERGVP  257



>gb|EPS68701.1| hypothetical protein M569_06064, partial [Genlisea aurea]
Length=638

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            TT      +   LDF++HH+A D          K +P C  + SEYTPC+DT RSL+F R
Sbjct  69   TTEGNDQPTQQRLDFSSHHSAGDGGIELGVRARKSYPACDVKYSEYTPCEDTTRSLRFPR  128

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L YRERHCPA++E +KCRIPAP GY+ P RWP SRD  WYANVPHK LTVEKA QNW+
Sbjct  129  ERLIYRERHCPAEDERVKCRIPAPSGYKTPFRWPASRDLAWYANVPHKELTVEKAVQNWI  188

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            RF+G+RF FPGGGTMFP GADAYIDDIG+LINL DGSIRTAIDTGCGVASWGAYLLSRDI
Sbjct  189  RFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLSDGSIRTAIDTGCGVASWGAYLLSRDI  248

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+D+HEAQVQFALER +P
Sbjct  249  IAMSFAPRDSHEAQVQFALERGVP  272



>ref|XP_011035186.1| PREDICTED: probable methyltransferase PMT15 isoform X3 [Populus 
euphratica]
Length=628

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            +  +LDF AHH A D     Q   A   PPC  + SE+TPC+D ERSLKFDR  L YRER
Sbjct  65   NTATLDFEAHHFAPD--PPPQVARAHHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRER  122

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP   E+LKCR+PAP+GY++P RWPESR+  WYANVPHK LTVEK  QNWV  +GER  
Sbjct  123  HCPESHEILKCRVPAPYGYKVPFRWPESREFAWYANVPHKELTVEKKNQNWVHVEGERLR  182

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+
Sbjct  183  FPGGGTMFPRGADAYIDDIGQLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPR  242

Query  568  DTHEAQVQFALERXIP  615
            DTH +QVQFALER +P
Sbjct  243  DTHVSQVQFALERGVP  258



>ref|XP_010508116.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 162/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFD  180
             T  SS   LDF AHH  +D       PP KE    FP C AELSE+TPC+D +RSLKF 
Sbjct  57   FTKPSSTKDLDFDAHHNIQD------PPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFP  110

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNW
Sbjct  111  RERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNW  170

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGADAY+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  171  VRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRN  230

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  231  ITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_010506552.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   296 bits (757),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 162/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFD  180
             T  SS   LDF AHH  +D       PP KE    FP C AELSE+TPC+D +RSLKF 
Sbjct  57   FTKPSSTKDLDFDAHHNIQD------PPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFP  110

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNW
Sbjct  111  RERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNW  170

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGADAY+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  171  VRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRN  230

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  231  ITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_010278559.1| PREDICTED: probable methyltransferase PMT15 [Nelumbo nucifera]
Length=633

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+ HH AE  +    A   K FP C A+ SEYTPC+D  RSLKF+R  L YRERHCP 
Sbjct  70   LDFSTHHTAEGEITATPARGPKYFPACDAKYSEYTPCEDAVRSLKFERDRLIYRERHCPE  129

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K ELLKCR+PAP+GY+ P  WP SRD  WYANVPHK LTVEKA QNW+RF+ +RF FPGG
Sbjct  130  KAELLKCRVPAPYGYKNPFTWPTSRDFAWYANVPHKELTVEKAVQNWIRFQRDRFRFPGG  189

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GA AYIDDI +LINL+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHE
Sbjct  190  GTMFPHGAGAYIDDIDKLINLRDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHE  249

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  250  AQVQFALERGVP  261



>ref|XP_010518192.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 162/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKE----FPPCKAELSEYTPCQDTERSLKFD  180
             T  SS   LDF AHH  +D       PP KE    FP C AELSE+TPC+D +RSLKF 
Sbjct  57   FTKPSSTKDLDFDAHHNIQD------PPPVKETAVSFPSCGAELSEHTPCEDAKRSLKFP  110

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LT+EK  QNW
Sbjct  111  RERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKNQNW  170

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGADAY+DDIGRLI+L  GSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  171  VRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLLSRN  230

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  231  ITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_011035172.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Populus 
euphratica]
 ref|XP_011035179.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Populus 
euphratica]
Length=628

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            +  +LDF AHH A D     Q   A   PPC  + SE+TPC+D ERSLKFDR  L YRER
Sbjct  65   NTATLDFEAHHFAPD--PPPQVARAHHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRER  122

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP   E+LKCR+PAP+GY++P RWPESR+  WYANVPHK LTVEK  QNWV  +GER  
Sbjct  123  HCPEIHEILKCRVPAPYGYKVPFRWPESREFAWYANVPHKELTVEKKNQNWVHVEGERLR  182

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+
Sbjct  183  FPGGGTMFPRGADAYIDDIGQLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAPR  242

Query  568  DTHEAQVQFALERXIP  615
            DTH +QVQFALER +P
Sbjct  243  DTHVSQVQFALERGVP  258



>ref|XP_006293834.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
 gb|EOA26732.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
Length=631

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            SA  L+F AHH+ +D   V +   A  FP C  ELSE+TPC+D +RSLKF R  L+YR+R
Sbjct  62   SAKDLNFDAHHSIQDPPPVPET--AASFPSCAVELSEHTPCEDAKRSLKFPRERLEYRQR  119

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF 
Sbjct  120  HCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFW  179

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SFAP+
Sbjct  180  FPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPR  239

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  240  DTHEAQVQFALERGVP  255



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            D  N  SS++  +LDFA HHAA++  +   AP  ++FP C+A+ SEYTPC+D  RSLKF 
Sbjct  67   DNNNSPSSTAVTALDFANHHAADE--SAFAAPARRDFPACEAKYSEYTPCEDVARSLKFP  124

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L YRERHCP K E L+C IPAP GYR P  WPESR   W+ANVPHK LTVEKA QNW
Sbjct  125  RDRLIYRERHCPVKGEELRCLIPAPAGYRNPFPWPESRGVAWFANVPHKELTVEKAVQNW  184

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            +R  G++F FPGGGTMFP GADAYID+I RLINL+DGS+RTAIDTGCGVASWGAYLLSRD
Sbjct  185  IRVDGDKFRFPGGGTMFPNGADAYIDEIDRLINLRDGSVRTAIDTGCGVASWGAYLLSRD  244

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+HEAQVQFALER +P
Sbjct  245  ILTMSFAPRDSHEAQVQFALERGVP  269



>ref|XP_002880195.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56454.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 160/202 (79%), Gaps = 2/202 (1%)
 Frame = +1

Query  10   NLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRM  189
              T   S   LDF AHH  +D   V +   A  FP C AELSE+TPC+D +RSL F R  
Sbjct  56   QFTRPDSTKDLDFDAHHNIQDPPPVTET--AVNFPSCGAELSEHTPCEDAKRSLIFARER  113

Query  190  LKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRF  369
            L+YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR+
Sbjct  114  LEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRY  173

Query  370  KGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFP  549
            + +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  
Sbjct  174  ENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITT  233

Query  550  LSFAPKDTHEAQVQFALERXIP  615
            +SFAP+DTHEAQVQFALER +P
Sbjct  234  MSFAPRDTHEAQVQFALERGVP  255



>emb|CDY18904.1| BnaC04g04460D [Brassica napus]
Length=633

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 161/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFD  180
             + ++SA  LDF AHH   D       PP    A  FP C A LSE+TPC+D +RSLKF 
Sbjct  59   FSKTTSATDLDFNAHHNPHD------PPPSTVTAVSFPSCDAALSEHTPCEDAKRSLKFS  112

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNW
Sbjct  113  RERLEYRQRHCPEREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  172

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  173  VRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRN  232

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  233  ITTMSFAPRDTHEAQVQFALERGVP  257



>gb|KHG14191.1| hypothetical protein F383_16741 [Gossypium arboreum]
Length=629

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS     LDF  HH        ++   A +FPPC    SEYTPC+D +RSLKFDR ML Y
Sbjct  67   SSLKTTQLDFLPHHLPP--DPPSETARAAQFPPCDHSFSEYTPCEDVQRSLKFDRDMLIY  124

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELLKCRIPAP+GY++P RWP+ R+  W+ANVPHK LTVEK  QNW++ +G+
Sbjct  125  RERHCPEKDELLKCRIPAPYGYKVPFRWPQGREFAWFANVPHKELTVEKKNQNWIKVEGD  184

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFP GADAYIDDI +LINL+DGSIRTAIDTGCGVASWGAYLLSR+I  +SF
Sbjct  185  RFRFPGGGTMFPHGADAYIDDIDKLINLRDGSIRTAIDTGCGVASWGAYLLSRNILAMSF  244

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  245  APRDTHEAQVQFALERGVP  263



>ref|XP_010321993.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = +1

Query  40   LDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            LDF  HH AA D  A   A   K +P C  + SEYTPC+D ERSLKF+RR L YRERHCP
Sbjct  94   LDFTTHHSAAYDGAAPDDA--IKIYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCP  151

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             K E+LKCRIPAP+GY+ P +WP SRD VWYANVPHK LTVEKA QNW+R++G++F FPG
Sbjct  152  EKNEVLKCRIPAPYGYKNPFKWPVSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPG  211

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDI +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+H
Sbjct  212  GGTMFPNGADAYIDDIAKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSH  271

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  272  EAQVQFALERGVP  284



>gb|KCW46397.1| hypothetical protein EUGRSUZ_K00230 [Eucalyptus grandis]
Length=603

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH  +D          + +  C    SEYTPC+D +RSL+FDR  L YRERHCP 
Sbjct  48   LDFESHHRQDDTADAELDDRPRTYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPD  107

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E +KCR+PAP+GYRIP RWP SRD  WYANVPHK LTVEKA QNW++++G+RF FPGG
Sbjct  108  KTEKVKCRVPAPYGYRIPFRWPASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGG  167

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GA AYIDDIG LINLKDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHE
Sbjct  168  GTMFPHGASAYIDDIGELINLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHE  227

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  228  AQVQFALERGVP  239



>ref|XP_010933874.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=640

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            D +N  SS++  +LDFAAHHAA++  +    P  ++FP C A+ SEYTPC+D  RSLKF 
Sbjct  69   DNSNSPSSTTVTTLDFAAHHAADE--SAFDGPARRDFPACDAKYSEYTPCEDVARSLKFP  126

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L YRERHCPAK E L+C IPAP GY+ P  WPESR   W+ANVPHK LTVEKA QNW
Sbjct  127  RDRLIYRERHCPAKGEELRCLIPAPAGYQKPFPWPESRGVAWFANVPHKELTVEKAVQNW  186

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            +R  G++F FPGGGTMFP GADAYID+I RLINL+DGS+RTAIDTGCGVASWGAYLLSRD
Sbjct  187  IRVDGDKFRFPGGGTMFPNGADAYIDEIDRLINLRDGSVRTAIDTGCGVASWGAYLLSRD  246

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+HEAQVQFALER  P
Sbjct  247  ILTMSFAPRDSHEAQVQFALERGAP  271



>ref|XP_004240739.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Solanum 
lycopersicum]
Length=651

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = +1

Query  40   LDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            LDF  HH AA D  A   A   K +P C  + SEYTPC+D ERSLKF+RR L YRERHCP
Sbjct  94   LDFTTHHSAAYDGAAPDDA--IKIYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCP  151

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             K E+LKCRIPAP+GY+ P +WP SRD VWYANVPHK LTVEKA QNW+R++G++F FPG
Sbjct  152  EKNEVLKCRIPAPYGYKNPFKWPVSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPG  211

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDI +LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+D+H
Sbjct  212  GGTMFPNGADAYIDDIAKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSH  271

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  272  EAQVQFALERGVP  284



>ref|XP_002320758.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
 gb|EEE99073.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
Length=629

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 4/197 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDL-VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            +  +LDF AHH A D  + VA+A      PPC  + SE+TPC+D ERSLKFDR  L YRE
Sbjct  65   NTTTLDFEAHHFAPDPPLRVARA---HHLPPCDPKYSEHTPCEDVERSLKFDRDRLIYRE  121

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP   E+LKCR+PAP+GY++P RWPESR+  WYANVPHK LTVEK  QNWV  +G+R 
Sbjct  122  RHCPESHEILKCRVPAPYGYKVPFRWPESREFAWYANVPHKELTVEKKNQNWVHVEGKRL  181

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP
Sbjct  182  RFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILAVSFAP  241

Query  565  KDTHEAQVQFALERXIP  615
            +DTH +QVQFALER +P
Sbjct  242  RDTHVSQVQFALERGVP  258



>ref|XP_007038610.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=642

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+ HH A D    +  P  K +P C  + SEYTPC+D  RSLKF R  L YRERHCP 
Sbjct  83   LDFSTHHVA-DADEESLLPDVKTYPSCSVKYSEYTPCEDHIRSLKFKRDRLIYRERHCPE  141

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K ELLKCR+PAP+ Y+ P  WP+SRD  W+ANVPHK LTVEKAGQNW+R++G+RF FPGG
Sbjct  142  KGELLKCRVPAPYDYKNPFPWPKSRDLAWFANVPHKELTVEKAGQNWIRYEGKRFRFPGG  201

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHE
Sbjct  202  GTMFPHGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHE  261

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  262  AQVQFALERGVP  273



>ref|NP_182099.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
 sp|O80844.1|PMTG_ARATH RecName: Full=Probable methyltransferase PMT16 [Arabidopsis thaliana]
 gb|AAC28550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10597.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
Length=631

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 160/201 (80%), Gaps = 2/201 (1%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
             T  +S   LDF AHH  +D   V +   A  FP C A LSE+TPC+D +RSLKF R  L
Sbjct  57   FTRPNSTKDLDFDAHHNIQDPPPVTET--AVSFPSCAAALSEHTPCEDAKRSLKFSRERL  114

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
            +YR+RHCP +EE+LKCRIPAP+GY+ P RWP SRD  W+ANVPH  LTVEK  QNWVR++
Sbjct  115  EYRQRHCPEREEILKCRIPAPYGYKTPFRWPASRDVAWFANVPHTELTVEKKNQNWVRYE  174

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
             +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +
Sbjct  175  NDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTM  234

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  235  SFAPRDTHEAQVQFALERGVP  255



>emb|CDX74761.1| BnaA05g05070D [Brassica napus]
Length=632

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
             + ++S   LDF AHH   D      A  A  FP C A LSE+TPC+D +RSLKF R  L
Sbjct  58   FSKTTSTTDLDFNAHHNPHD--PPPSAVTAVSFPSCDAALSEHTPCEDAKRSLKFSRERL  115

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
            +YR+RHCP +EE LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++
Sbjct  116  EYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYE  175

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
             +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +
Sbjct  176  NDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTM  235

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  236  SFAPRDTHEAQVQFALERGVP  256



>ref|XP_006397756.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
 gb|ESQ39209.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
Length=632

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            +++S   LDF AHH   D   V +   A  FP C AELSE TPC+D +RSLKF R  L+Y
Sbjct  60   TTTSTRDLDFDAHHNPRDPPPVTET--AVNFPSCDAELSENTPCEDAKRSLKFPRERLEY  117

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            R+RHCP ++E LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +
Sbjct  118  RQRHCPERDETLKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYEND  177

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +SF
Sbjct  178  RFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSF  237

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  238  APRDTHEAQVQFALERGVP  256



>ref|XP_010035103.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
Length=643

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH  +D          + +  C    SEYTPC+D +RSL+FDR  L YRERHCP 
Sbjct  88   LDFESHHRQDDTADAELDDRPRTYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPD  147

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E +KCR+PAP+GYRIP RWP SRD  WYANVPHK LTVEKA QNW++++G+RF FPGG
Sbjct  148  KTEKVKCRVPAPYGYRIPFRWPASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGG  207

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GA AYIDDIG LINLKDGSIRTAIDTGCGVASWGAYLLSR++  +SFAP+DTHE
Sbjct  208  GTMFPHGASAYIDDIGELINLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHE  267

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  268  AQVQFALERGVP  279



>ref|XP_009143165.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   293 bits (750),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 160/205 (78%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFD  180
             + ++S   LDF AHH   D       PP    A  FP C A LSE+TPC+D +RSLKF 
Sbjct  58   FSKTTSTTDLDFNAHHNPHD------PPPSTVTAVSFPSCDAALSEHTPCEDAKRSLKFS  111

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNW
Sbjct  112  RERLEYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  171

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  172  VRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRN  231

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  232  ITTMSFAPRDTHEAQVQFALERGVP  256



>gb|KJB41226.1| hypothetical protein B456_007G095700 [Gossypium raimondii]
Length=629

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS     LDF  HH        ++   A +FPPC    SEYTPC+D +RSLKFDR ML Y
Sbjct  67   SSLKTTQLDFLPHHLPP--DPPSETTRAAQFPPCDPSFSEYTPCEDVQRSLKFDRDMLIY  124

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELLKCRIPAP+GY++P RWP+ R+  W+ANVPHK LTVEK  QNW++ +G+
Sbjct  125  RERHCPEKDELLKCRIPAPYGYKVPFRWPQGREFAWFANVPHKELTVEKKNQNWIKVEGD  184

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFP GADAYIDDI +LI+L+DGSIRTAIDTGCGVASWGAYLLSR+I  +SF
Sbjct  185  RFRFPGGGTMFPHGADAYIDDIDKLISLRDGSIRTAIDTGCGVASWGAYLLSRNILAMSF  244

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  245  APRDTHEAQVQFALERGVP  263



>ref|XP_009142361.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
             + + S   LDF AHH   D   V  A  A  FP C A+LSE+TPC+D +RSLKF R+ L
Sbjct  57   FSKTISTRDLDFNAHHNPHDPPPVKAA--AVSFPSCGAQLSEHTPCEDAKRSLKFPRKRL  114

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
            +YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++
Sbjct  115  EYRQRHCPEREEVLKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYE  174

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
             +RF FPGGGTMFP GADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +
Sbjct  175  NDRFWFPGGGTMFPSGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTM  234

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  235  SFAPRDTHEAQVQFALERGVP  255



>ref|XP_008799521.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=639

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            + N  SS++  +LDF  HHAA D+ AV   P  + FP C A+ SEYTPC+D +RSLKF R
Sbjct  68   SNNSPSSTAVTTLDFDTHHAA-DVSAVDALPARRGFPACDAKYSEYTPCEDVKRSLKFPR  126

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
              L +RERHCP K E L+C IPAP GYR P  WP SR+  W+ANVPHK LTVEKA QNW+
Sbjct  127  DRLIFRERHCPGKGEELRCLIPAPAGYRNPFPWPASREVAWFANVPHKELTVEKAVQNWI  186

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            R  G++F FPGGGTMFP GADAYIDDIGRLINL DGSIRTAIDTGCGVASWG+YLLSRDI
Sbjct  187  RVDGDKFRFPGGGTMFPNGADAYIDDIGRLINLHDGSIRTAIDTGCGVASWGSYLLSRDI  246

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +S AP+D+HEAQVQFALER +P
Sbjct  247  LTMSIAPRDSHEAQVQFALERGVP  270



>ref|XP_003528883.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=641

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 156/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLV-AVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            LDFAAHH   DL   VA+ P     PPC +  SE+TPC+D +RSL F R  L YRERHCP
Sbjct  81   LDFAAHHLLPDLPPTVARGP---YLPPCASPFSEHTPCEDQQRSLSFPRHRLAYRERHCP  137

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
            A EE L+CRIPAP+GYR P+RWP SRD+ WYAN PHK LTVEK GQNWVRF G RF FPG
Sbjct  138  APEERLRCRIPAPYGYRQPLRWPASRDAAWYANAPHKELTVEKKGQNWVRFDGNRFRFPG  197

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFPRGAD YI+DIG+LINL+DGS+RTAIDTGCGVAS+GAYLLSRDI  +SFAP+DTH
Sbjct  198  GGTMFPRGADQYINDIGKLINLRDGSVRTAIDTGCGVASFGAYLLSRDILTMSFAPRDTH  257

Query  577  EAQVQFALERXIP  615
             +QVQFALER IP
Sbjct  258  ISQVQFALERGIP  270



>gb|ABV72578.1| dehydration-responsive family protein S51 [Brassica rapa]
Length=632

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 158/201 (79%), Gaps = 2/201 (1%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
             + ++S   LDF AHH   D      A  A  FP C A LSE+TPC+D +RSLKF R  L
Sbjct  58   FSKTTSTTDLDFNAHHNPHD--PPPSAVTAVSFPSCDAALSEHTPCEDAKRSLKFSRERL  115

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
            +YR+RHCP +EE LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++
Sbjct  116  EYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYE  175

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
             +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDT CGVAS+GAYLLSR+I  +
Sbjct  176  NDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTSCGVASFGAYLLSRNITTM  235

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  236  SFAPRDTHEAQVQFALERGVP  256



>ref|XP_010055227.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Eucalyptus 
grandis]
Length=597

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP-  216
            LDFAAHH  +     + A     FPPC A  SEYTPC+D  RSL+F+R ML YRERHCP 
Sbjct  76   LDFAAHHYWDFRAPPSAAERGPRFPPCGANFSEYTPCEDVARSLRFEREMLVYRERHCPE  135

Query  217  --AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
              A  E L+CR+PAP+GYR P RWPESR + W+ANVPHK LTVEK  QNWV+F+G RF F
Sbjct  136  GGAGGERLRCRVPAPYGYRRPFRWPESRGTAWFANVPHKELTVEKRNQNWVKFEGNRFVF  195

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMFP+GAD YI+DIG++INL+DGSI+TA+DTGCGVASWGAYLLSR+I  +SFAP+D
Sbjct  196  PGGGTMFPKGADKYIEDIGKMINLRDGSIKTALDTGCGVASWGAYLLSRNILAMSFAPRD  255

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  256  THEAQVQFALERGVP  270



>ref|XP_007051921.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOX96078.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=548

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  288
             PPC    SEYTPC+D +RSLKFDR ML YRERHCP K ELLKCR+PAP+GY++P RWP 
Sbjct  95   LPPCDLSFSEYTPCEDVKRSLKFDRGMLVYRERHCPEKNELLKCRVPAPYGYKVPFRWPR  154

Query  289  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  468
            SR+  W+ANVPHK LTVEK  QNWV+ +GE F FPGGGTMFPRGADAYIDDI  LINLKD
Sbjct  155  SREFAWFANVPHKELTVEKKNQNWVKVEGELFRFPGGGTMFPRGADAYIDDIDELINLKD  214

Query  469  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            GSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  215  GSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHEAQVQFALERGVP  263



>ref|XP_004510859.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=644

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 159/204 (78%), Gaps = 10/204 (5%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAK----EFPPCKAELSEYTPCQDTERSLKFDR  183
            T+ SS+  +DFAA H       + ++PP +     FPPC   L EYTPC+D+ RS KF R
Sbjct  82   TAESSSDKIDFAAGHY------LHESPPTEARGPHFPPCDPSLYEYTPCEDSTRSSKFSR  135

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
                YRERHCPA +E+L+CRIPAP GYR+P+RWPESRDS WYANVPHK L+VEK  QNW+
Sbjct  136  NRQVYRERHCPAPKEILRCRIPAPLGYRLPLRWPESRDSTWYANVPHKELSVEKKKQNWI  195

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            R +G RF FPGGGT F RGA AYIDDIG+LINLKDGSIRTA+DTGCGVASWG YLLSR+I
Sbjct  196  RLEGNRFKFPGGGTTFRRGASAYIDDIGKLINLKDGSIRTAVDTGCGVASWGGYLLSRNI  255

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+DTHEAQVQFALER +P
Sbjct  256  LTVSFAPRDTHEAQVQFALERGVP  279



>ref|XP_010419631.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=630

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L+FAA H+A D  + A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP 
Sbjct  70   LNFAARHSAPDPPSTATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPE  129

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+L+CRIPAPFGY +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGG
Sbjct  130  KHEMLRCRIPAPFGYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGG  189

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  190  GTMFPRGADAYIDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  249

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  250  AQVQFALERGVP  261



>emb|CDY37061.1| BnaA04g26390D [Brassica napus]
Length=628

 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 161/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAK----EFPPCKAELSEYTPCQDTERSLKFD  180
             + + S   LDF AHH   D       PP K     FP C A+LSE+TPC+D +RSLKF 
Sbjct  57   FSKTISTRDLDFNAHHNPHD------PPPVKAVAVSFPSCGAKLSEHTPCEDAKRSLKFP  110

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R+ L+YR+RHCP +EE+LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNW
Sbjct  111  RKRLEYRQRHCPEREEVLKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  170

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFP GADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  171  VRYENDRFWFPGGGTMFPSGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRN  230

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  231  ITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_010523726.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=684

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 157/196 (80%), Gaps = 10/196 (5%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAK----EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            LDF AHH AED       PP       FP C  +LSEYTPC+D +RSL+F R  L+YRER
Sbjct  123  LDFTAHHTAED------PPPTAARDVTFPACGVKLSEYTPCEDQKRSLRFPRERLEYRER  176

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP ++E+L+CRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF 
Sbjct  177  HCPERDEVLRCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFW  236

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR +  +SFAP+
Sbjct  237  FPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRKVMTMSFAPR  296

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  297  DTHEAQVQFALERGVP  312



>ref|XP_010456248.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=644

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L+FAA H+A D  + A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP 
Sbjct  84   LNFAARHSAPDPPSTATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPE  143

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+L+CRIPAPFGY +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGG
Sbjct  144  KHEMLRCRIPAPFGYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGG  203

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  204  GTMFPRGADAYIDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  263

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  264  AQVQFALERGVP  275



>ref|XP_010055225.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71693.1| hypothetical protein EUGRSUZ_E00212 [Eucalyptus grandis]
Length=637

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP-  216
            LDFAAHH  +     + A     FPPC A  SEYTPC+D  RSL+F+R ML YRERHCP 
Sbjct  76   LDFAAHHYWDFRAPPSAAERGPRFPPCGANFSEYTPCEDVARSLRFEREMLVYRERHCPE  135

Query  217  --AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
              A  E L+CR+PAP+GYR P RWPESR + W+ANVPHK LTVEK  QNWV+F+G RF F
Sbjct  136  GGAGGERLRCRVPAPYGYRRPFRWPESRGTAWFANVPHKELTVEKRNQNWVKFEGNRFVF  195

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMFP+GAD YI+DIG++INL+DGSI+TA+DTGCGVASWGAYLLSR+I  +SFAP+D
Sbjct  196  PGGGTMFPKGADKYIEDIGKMINLRDGSIKTALDTGCGVASWGAYLLSRNILAMSFAPRD  255

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  256  THEAQVQFALERGVP  270



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            +  A +LDFA HH A+   A A AP  +EFP C  + SEYTPC+D +RSL+FDR  L YR
Sbjct  72   TGRAAALDFAVHHGADQ--AAAGAPSVREFPACDIKYSEYTPCEDRDRSLRFDRDRLIYR  129

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP K ELLKC IPAP GYR P  WP SR++ W+ANVPHK LTVEKA QNW+   G++
Sbjct  130  ERHCPTKGELLKCLIPAPPGYRNPFPWPASRETAWFANVPHKELTVEKAVQNWIHVDGDK  189

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFP GADAYIDDI RLI+L DGSIRTA+DTGCGVASWGAYLLSR++  +SFA
Sbjct  190  FRFPGGGTMFPNGADAYIDDIDRLISLSDGSIRTAVDTGCGVASWGAYLLSRNVLTMSFA  249

Query  562  PKDTHEAQVQFALERXIP  615
            P+D+HEAQVQFALER +P
Sbjct  250  PRDSHEAQVQFALERGVP  267



>ref|XP_009609846.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=657

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+ +   ++   VA     K +P C  + SEYTPC+D +RSLKF R  L YRERHCP 
Sbjct  96   LDFSTNQGDDEGEGVAPDDSVKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPD  155

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K +LLKCRIPAP+GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGG
Sbjct  156  KSQLLKCRIPAPYGYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGG  215

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAY+DDI +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHE
Sbjct  216  GTMFPNGADAYVDDIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHE  275

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  276  AQVQFALERGVP  287



>ref|XP_007051920.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX96077.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=635

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  288
             PPC    SEYTPC+D +RSLKFDR ML YRERHCP K ELLKCR+PAP+GY++P RWP 
Sbjct  95   LPPCDLSFSEYTPCEDVKRSLKFDRGMLVYRERHCPEKNELLKCRVPAPYGYKVPFRWPR  154

Query  289  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  468
            SR+  W+ANVPHK LTVEK  QNWV+ +GE F FPGGGTMFPRGADAYIDDI  LINLKD
Sbjct  155  SREFAWFANVPHKELTVEKKNQNWVKVEGELFRFPGGGTMFPRGADAYIDDIDELINLKD  214

Query  469  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            GSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  215  GSIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHEAQVQFALERGVP  263



>ref|XP_010919241.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=637

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 1/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S++S  +LDF  HHAA+D  AV   P A+ FP C A+ SEYTPC+D +RS KF +  L +
Sbjct  71   SNNSPTTLDFGTHHAADD-SAVDALPAARGFPACDAKYSEYTPCEDVKRSFKFPQDRLIF  129

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K E L+C IPAP GYR P  WP SR+  W+ANVPHK LTVEKA QNW+R  G+
Sbjct  130  RERHCPQKGEELRCMIPAPAGYRNPFPWPASREVAWFANVPHKELTVEKAVQNWIRVDGD  189

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            +F FPGGGTMFP GADAYIDDIGRLINL+DGSIRTAIDTGCGVASWG YLLSRDI  +S 
Sbjct  190  KFRFPGGGTMFPNGADAYIDDIGRLINLRDGSIRTAIDTGCGVASWGGYLLSRDILTMSI  249

Query  559  APKDTHEAQVQFALERXIP  615
            AP+D+HEAQVQFALER +P
Sbjct  250  APRDSHEAQVQFALERGVP  268



>ref|XP_006365768.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=637

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
            +TS+++AVS + ++    ++    A +   K +P C  + SEYTPC+D +RSLKF R  L
Sbjct  73   ITSATTAVSKNSSSGTQVDEEGEGAVSDDVKVYPSCDFKFSEYTPCEDPQRSLKFKRDRL  132

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
             YRERHCP K +LLKCR+PAP+GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +
Sbjct  133  IYRERHCPDKTQLLKCRVPAPYGYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKE  192

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
            G++F FPGGGTMFP GADAY+DDI +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +
Sbjct  193  GDKFRFPGGGTMFPNGADAYVDDIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAM  252

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  253  SFAPRDTHEAQVQFALERGVP  273



>ref|XP_010427380.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=633

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L+F+A H+A D    A A    +  PC  E SEYTPC+   RSL F R  L YRERHCP 
Sbjct  73   LNFSARHSAPDPPPTATAERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPE  132

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+L+CRIPAPFGY +P RWPESRD  W+ANVPH  LTVEK  QNWVR+  +RF FPGG
Sbjct  133  KHEMLRCRIPAPFGYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGG  192

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  193  GTMFPRGADAYIDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  252

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  253  AQVQFALERGVP  264



>ref|XP_010091548.1| putative methyltransferase PMT15 [Morus notabilis]
 gb|EXB44733.1| putative methyltransferase PMT15 [Morus notabilis]
Length=647

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAA----EDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            L    ++  LDF++HH A    +DL     A     FPPC AEL+EYTPC+D +RSL+FD
Sbjct  67   LLDRVNSTRLDFSSHHQAPDADDDLSPSDAAARGLYFPPCAAELAEYTPCEDVKRSLRFD  126

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L YRERHCP  EE+++CRIPAP GYRIP RWPESR   WYANVPHK LTVEK  QNW
Sbjct  127  RDRLIYRERHCPTPEEVMRCRIPAPSGYRIPFRWPESRGVAWYANVPHKELTVEKKNQNW  186

Query  361  VRFKGE--RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLS  534
            V +     R TFPGGGTMFP GADAYIDDIG+ I+L+ GSIRTAIDTGCGVASWGAYL+S
Sbjct  187  VHYDKNTGRLTFPGGGTMFPHGADAYIDDIGKFIDLQGGSIRTAIDTGCGVASWGAYLMS  246

Query  535  RDIFPLSFAPKDTHEAQVQFALERXIP  615
            RDI  +SFAP+D+HEAQVQFALER +P
Sbjct  247  RDILAMSFAPRDSHEAQVQFALERGVP  273



>gb|KHG13750.1| hypothetical protein F383_08462 [Gossypium arboreum]
Length=633

 Score =   288 bits (738),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S+ +LDFA+HH     V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRER
Sbjct  78   SSTNLDFASHHQ----VVLNSSKTVNQFPSCDMSFSEYTPCQDKVRGRKFDRNMLKYRER  133

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCPAKEELL+C IPAP  Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF 
Sbjct  134  HCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFR  193

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+
Sbjct  194  FPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPR  253

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  254  DTHEAQVQFALERGVP  269



>ref|XP_008439398.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=603

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +1

Query  100  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  279
            AK FP C    SEYTPC+DT RSLKF R  L YRERHCP KEE LKCRIPAP GYR P  
Sbjct  60   AKPFPACGLNYSEYTPCEDTHRSLKFSRDRLIYRERHCPEKEESLKCRIPAPPGYRNPFA  119

Query  280  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  459
            WP SRD  WY NVPHKHLTVEKA QNW+R++GE F FPGGGTMFP GADAYID+IG+LIN
Sbjct  120  WPVSRDLAWYVNVPHKHLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADAYIDNIGKLIN  179

Query  460  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            LKDGSIRTAIDTGCGV SWGAYLLSRDI  +SFAP+DTHEAQVQFALER +P
Sbjct  180  LKDGSIRTAIDTGCGVGSWGAYLLSRDIITMSFAPRDTHEAQVQFALERGVP  231



>gb|KJB18858.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=558

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S+ +LDFA+HH     V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRER
Sbjct  78   SSTNLDFASHHQ----VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRER  133

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCPAKEELL+C IPAP  Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF 
Sbjct  134  HCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFR  193

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+
Sbjct  194  FPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPR  253

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  254  DTHEAQVQFALERGVP  269



>ref|XP_006287263.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
 gb|EOA20161.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
Length=634

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
             +A  L+FAA H A D           + PPC  E SEYTPC+   RSL F R  L YRE
Sbjct  68   QAAPVLNFAARHTAPDPPQTELTERITQIPPCGVEFSEYTPCEFVNRSLSFPRERLIYRE  127

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP K E+L+CRIPAP+GY +P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF
Sbjct  128  RHCPEKHEMLRCRIPAPYGYTVPYRWPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRF  187

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAY+D+IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP
Sbjct  188  LFPGGGTMFPRGADAYLDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAP  247

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  248  RDTHEAQVQFALERGVP  264



>ref|XP_011016489.1| PREDICTED: probable methyltransferase PMT17, partial [Populus 
euphratica]
Length=345

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS SAV LDF +HH     +         E PPC    SEYTPCQD  R  KFDR MLKY
Sbjct  68   SSESAV-LDFNSHHQ----IQFNNTDSVNEIPPCDMSYSEYTPCQDPRRGRKFDRNMLKY  122

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+
Sbjct  123  RERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGD  182

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  183  RFRFPGGGTMFPRGADAYIDDISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIIAMSF  242

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQV FALER +P
Sbjct  243  APRDTHEAQVWFALERGVP  261



>ref|XP_004228448.2| PREDICTED: probable methyltransferase PMT15, partial [Solanum 
lycopersicum]
Length=637

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
            +TSS+S V   +    + ++    A +   K +PPC  + SEYTPC+D +RSLKF R  L
Sbjct  73   ITSSTSGV---YKNSSSGDEEGEGAVSDDVKLYPPCDFKYSEYTPCEDPQRSLKFKRDRL  129

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
             YRERHCP K +LLKCR+PAP+GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +
Sbjct  130  IYRERHCPDKTQLLKCRVPAPYGYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKE  189

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
            G++F FPGGGTMFP GADAY+DDI +LINLKDGSIRTAIDTGCGVASWGAYLLSRDI  +
Sbjct  190  GDKFRFPGGGTMFPNGADAYVDDIDKLINLKDGSIRTAIDTGCGVASWGAYLLSRDILAM  249

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQVQFALER +P
Sbjct  250  SFAPRDTHEAQVQFALERGVP  270



>ref|XP_009794887.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=657

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF+ +   ++   VA     K +P C  + SEYTPC+D +RSLKF R  L YRERHCP 
Sbjct  96   LDFSTNQGDDEGEGVAPDDSVKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPD  155

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K +LLKCRIPAP+GY+ P +WP+SRD  WYANVPHK LTVEKA QNW+R +G++F FPGG
Sbjct  156  KSQLLKCRIPAPYGYKKPFKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGG  215

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAY+DDI +L NLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+DTHE
Sbjct  216  GTMFPNGADAYVDDIDKLFNLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHE  275

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  276  AQVQFALERGVP  287



>gb|KJB18848.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18854.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18855.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18856.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18859.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=633

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S+ +LDFA+HH     V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRER
Sbjct  78   SSTNLDFASHHQ----VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRER  133

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCPAKEELL+C IPAP  Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF 
Sbjct  134  HCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFR  193

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+
Sbjct  194  FPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPR  253

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  254  DTHEAQVQFALERGVP  269



>gb|KFK37364.1| hypothetical protein AALP_AA4G247100 [Arabis alpina]
Length=628

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 157/200 (79%), Gaps = 10/200 (5%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPP----AKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S   LDF AHH       + + PP       FP C A LSE+TPC+D +RSLK+ R  L+
Sbjct  58   STKVLDFNAHHN------IQEPPPLIKTTVNFPSCDAVLSEHTPCEDAKRSLKYSRERLE  111

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YR+RHCP +EE LKCRIPAP+GY+ P +WPESRD  W+ANVPH  LTVEK  QNWVR++ 
Sbjct  112  YRQRHCPEREEALKCRIPAPYGYKTPFKWPESRDVAWFANVPHTELTVEKKNQNWVRYEN  171

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDIGRLI+L DGSIRTAIDTGCGVAS+GAYLLSR+I  +S
Sbjct  172  DRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMS  231

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  232  FAPRDTHEAQVQFALERGVP  251



>ref|XP_011038052.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
 ref|XP_011038053.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
Length=628

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V+LDF +HH ++    +       EFPPC    SEYTPCQDT+R  KFDR MLKYRERHC
Sbjct  75   VALDFDSHHRSQ----INNTTSVNEFPPCAMSFSEYTPCQDTQRGRKFDRNMLKYRERHC  130

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P K+ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FP
Sbjct  131  PTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFP  190

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  191  GGGTMFPRGADAYIDDISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIISMSFAPRDT  250

Query  574  HEAQVQFALERXIP  615
            HEAQV FALER +P
Sbjct  251  HEAQVWFALERGVP  264



>ref|XP_009384529.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=635

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
              A +LDFAAHHAA++  + A  P A+EF  C A+ SEYTPC+D +RSL+FDR  L YRE
Sbjct  71   GGAPTLDFAAHHAADE--SDAAIPAAREFTACDAKYSEYTPCEDRDRSLRFDRDRLIYRE  128

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP K ELLKC +PAP GYR P  WP SRD+ W+ANVPH  LTVEKA QNW+R   ++F
Sbjct  129  RHCPEKGELLKCLVPAPAGYRNPFPWPASRDAAWFANVPHNELTVEKAVQNWIRVDRDKF  188

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GADAYIDDI RLI L+DGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP
Sbjct  189  LFPGGGTMFPDGADAYIDDIDRLIPLRDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAP  248

Query  565  KDTHEAQVQFALERXIP  615
            +D+HEAQVQFALER +P
Sbjct  249  RDSHEAQVQFALERGVP  265



>ref|XP_007152322.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
 gb|ESW24316.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
Length=627

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S  S   LDF++HH A    ++  +     +PPC   LSEYTPC+D  RSL++ RR + Y
Sbjct  63   SPPSTSHLDFSSHHNAT-ATSLPLSTSTSRYPPCDVSLSEYTPCEDHARSLRYSRRRMVY  121

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K E LKCR+PAP GYR P  WP SRD  WYANVPH+ LTVEKA QNW+R++G+
Sbjct  122  RERHCPTKTEALKCRVPAPHGYRNPFPWPASRDVAWYANVPHRELTVEKAVQNWIRYQGD  181

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFP GAD YIDDIG+L++L+DGS+RTA+DTGCGVASWGAYLLSRDI  +S 
Sbjct  182  RFHFPGGGTMFPDGADKYIDDIGKLVSLRDGSVRTAVDTGCGVASWGAYLLSRDIIAVSI  241

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  242  APRDTHEAQVQFALERGVP  260



>gb|KEH21299.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=629

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDFA+HH+ E    ++ +   KEFPPC    SEYTPCQD  R  KFDR MLKYRERHCP 
Sbjct  79   LDFASHHSLE----ISTSGGIKEFPPCDMTYSEYTPCQDPARGRKFDRNMLKYRERHCPT  134

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGG
Sbjct  135  KEELLYCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGG  194

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHE
Sbjct  195  GTMFPRGADAYIDDINELIPLTTGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHE  254

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  255  AQVQFALERGVP  266



>ref|XP_003525323.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Glycine 
max]
 ref|XP_006580503.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Glycine 
max]
Length=623

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = +1

Query  31   AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
            A +L+F +HH     + V  +  A+EFPPC    SEYTPCQD  R  KFDR MLKYRERH
Sbjct  70   ATNLNFESHHQ----IDVNDSGGAQEFPPCDMSFSEYTPCQDPVRGRKFDRNMLKYRERH  125

Query  211  CPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
            CPAKEELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF F
Sbjct  126  CPAKEELLNCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRF  185

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+D
Sbjct  186  PGGGTMFPRGADAYIDDINELIPLTSGTIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRD  245

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  246  THEAQVQFALERGVP  260



>ref|XP_004503565.1| PREDICTED: probable methyltransferase PMT18-like [Cicer arietinum]
Length=624

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            ++  S+ +LDFA+HH+ E    +      +EFPPC    SEYTPCQD  R  KFDR MLK
Sbjct  66   SNKGSSSNLDFASHHSLE----INNQGGLQEFPPCDMTYSEYTPCQDPARGRKFDRNMLK  121

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP KEELL C +PAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G
Sbjct  122  YRERHCPTKEELLFCLVPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEG  181

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +S
Sbjct  182  DRFRFPGGGTMFPRGADAYIDDINELIPLTSGNIRTAIDTGCGVASWGAYLLKRDIIAMS  241

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  242  FAPRDTHEAQVQFALERGVP  261



>ref|XP_008234471.1| PREDICTED: probable methyltransferase PMT16, partial [Prunus 
mume]
Length=601

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVA-QAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            +LDF++HH      A + QA   K +PPC  + SEYTPC+D +RSLKFDR  L YRERHC
Sbjct  46   ALDFSSHHTPNLTAATSSQAVKPKAYPPCDFKFSEYTPCEDAKRSLKFDRDRLIYRERHC  105

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE--RFT  387
            P K ELLKCR+PAP GY+    WP SRD  WYANVPHK LTVEKA QNW+ ++G+  R  
Sbjct  106  PEKNELLKCRVPAPHGYKTVFSWPMSRDLAWYANVPHKELTVEKAVQNWIIYEGDRNRLR  165

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I  +SFAP+
Sbjct  166  FPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPR  225

Query  568  DTHEAQVQFALERXIP  615
            DTH +QVQFALER +P
Sbjct  226  DTHVSQVQFALERGVP  241



>gb|KJB18860.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=669

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S+ +LDFA+HH     V +  +    +FP C    SEYTPCQD  R  KFDR MLKYRER
Sbjct  78   SSTNLDFASHHQ----VVLNSSKTVSQFPSCDMLFSEYTPCQDKVRGRKFDRNMLKYRER  133

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCPAKEELL+C IPAP  Y+ P +WP+SRD  WY+N+PH+ L++EKA QNW++ +G RF 
Sbjct  134  HCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWYSNIPHRELSIEKAIQNWIQLEGNRFR  193

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAIDTGCGVAS+GAYLL+R+I  +SFAP+
Sbjct  194  FPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAIDTGCGVASFGAYLLNRNILTMSFAPR  253

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  254  DTHEAQVQFALERGVP  269



>ref|XP_002875017.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51276.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L+FAA H A D    A A    + P C  E SEYTPC+   RSL F R  L YRERHCP 
Sbjct  73   LNFAASHTAPDPPPTATAARVAQIPSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPK  132

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+L+CRIPAP+GY +  RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGG
Sbjct  133  KHEILRCRIPAPYGYTVSFRWPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGG  192

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINL+DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  193  GTMFPRGADAYIDEIGRLINLRDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  252

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  253  AQVQFALERGVP  264



>ref|NP_191984.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
 sp|Q9ZPH9.1|PMTF_ARATH RecName: Full=Probable methyltransferase PMT15 [Arabidopsis thaliana]
 gb|AAD17339.1| F15P23.1 gene product [Arabidopsis thaliana]
 emb|CAB80884.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81929.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
Length=633

 Score =   285 bits (729),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L+FA+ H A DL          + P C  E SEYTPC+   RSL F R  L YRERHCP 
Sbjct  73   LNFASRHTAPDLPPTITDARVVQIPSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPE  132

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+++CRIPAP+GY +P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGG
Sbjct  133  KHEIVRCRIPAPYGYSLPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGG  192

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINLKDGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  193  GTMFPRGADAYIDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  252

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  253  AQVQFALERGVP  264



>ref|XP_010501748.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=494

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  90   VGLDFESHHKLE-LKVTNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  146

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  147  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  206

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  207  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  266

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  267  HEAQVQFALERGVP  280



>ref|XP_004309496.1| PREDICTED: probable methyltransferase PMT18 [Fragaria vesca subsp. 
vesca]
 ref|XP_011470852.1| PREDICTED: probable methyltransferase PMT18 [Fragaria vesca subsp. 
vesca]
Length=629

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 155/203 (76%), Gaps = 4/203 (2%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            +N +S  + + LDF +HH  E    + ++   + FPPC    SEYTPCQDT R  KFDR+
Sbjct  69   SNASSGPAGLHLDFESHHQVE----INKSEAVQTFPPCSMVYSEYTPCQDTNRGRKFDRQ  124

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
            MLKYRERHCP KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++
Sbjct  125  MLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQ  184

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +G+RF FPGGGTMFPRGADAYIDDI +LI L +G IRTAIDTGCGVASWGAYLL RDI 
Sbjct  185  VEGDRFRFPGGGTMFPRGADAYIDDINKLIPLTNGHIRTAIDTGCGVASWGAYLLKRDIL  244

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTH AQVQFALER +P
Sbjct  245  TMSFAPRDTHAAQVQFALERGVP  267



>gb|KEH17380.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=534

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 153/192 (80%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH   +    +    + ++PPC   L++YTPC+D  RSLK+ R  + YRERHCP 
Sbjct  83   LDFFSHHNLTNPTTTSTTK-SSQYPPCTPSLTDYTPCEDHTRSLKYTRDKMIYRERHCPK  141

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+LKCR+PAP GY+ P  WP SRD  WYANVP++HLTVEKAGQNW+RF G++F FPGG
Sbjct  142  KHEILKCRVPAPNGYKNPFPWPTSRDMAWYANVPYRHLTVEKAGQNWIRFDGDKFRFPGG  201

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GAD YIDDIG+LI+L+DGS+RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHE
Sbjct  202  GTMFPNGADKYIDDIGKLIDLEDGSVRTAVDTGCGVASWGAYLLSRDILTVSIAPRDTHE  261

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  262  AQVQFALERGVP  273



>ref|XP_003533217.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=633

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            S+   LDF++HH + +L  +        +PPC   LSEYTPC+D  RSL++ RR + YRE
Sbjct  72   STTHHLDFSSHHNSTNLPPLTST--TLHYPPCHVSLSEYTPCEDHARSLQYSRRRMVYRE  129

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP   +LLKCR+PAP GYR P  WP SRD  WYANVPH+ LTVEKA QNW+R+ G+RF
Sbjct  130  RHCPTNSDLLKCRVPAPHGYRNPFPWPASRDVAWYANVPHRELTVEKAVQNWIRYDGDRF  189

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GAD YIDDI  L+NL+DG++RTA+DTGCGVASWGAYLLSRDI  +S AP
Sbjct  190  RFPGGGTMFPNGADKYIDDIADLVNLRDGTVRTAVDTGCGVASWGAYLLSRDIITVSIAP  249

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  250  RDTHEAQVQFALERGVP  266



>ref|XP_006396270.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
 gb|ESQ37723.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
Length=633

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L FA+ H + D           + P C  E SEYTPC+  +RSL F R  L YRERHCP 
Sbjct  68   LTFASRHTSPDPPPSDMTARVVKIPSCGVEFSEYTPCEFVKRSLSFPRERLIYRERHCPK  127

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEE+L+CRIPAP+GY++P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGG
Sbjct  128  KEEILRCRIPAPYGYKVPFRWPESRDKAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGG  187

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYID+IGRLINL+DGSIRTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  188  GTMFPRGADAYIDEIGRLINLRDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  247

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  248  AQVQFALERGVP  259



>ref|XP_007220207.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
 gb|EMJ21406.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
Length=640

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 160/203 (79%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKE--FPPCKAELSEYTPCQDTERSLKFDRRML  192
            +++++ +LDF++HH   +L A   +   K   +PPC  + SEYTPC+D +RSLKFDR  L
Sbjct  70   ATTTSTTLDFSSHHTP-NLTASTSSHSVKPEVYPPCDLKFSEYTPCEDAKRSLKFDRDRL  128

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
             YRERHCP K ELLKCR+PAP GY+    WP SRD  WYANVPHK LTVEKA QNW+ ++
Sbjct  129  IYRERHCPEKNELLKCRVPAPHGYKTVFSWPMSRDLAWYANVPHKELTVEKAVQNWIIYE  188

Query  373  GE--RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
            G+  R  FPGGGTMFP GADAYIDDIG+LINLKDGSIRTAIDTGCGVASWGAYLLSR+I 
Sbjct  189  GDRNRLRFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIL  248

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTH +QVQFALER +P
Sbjct  249  TMSFAPRDTHVSQVQFALERGVP  271



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 153/197 (78%), Gaps = 10/197 (5%)
 Frame = +1

Query  37   SLDFAAHHAAE----DLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            SLDF +HH  E    D +AV      KEFPPC    SEYTPCQD  R  KFDR MLKYRE
Sbjct  104  SLDFESHHKLEMNETDEIAV------KEFPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRE  157

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP+KEE+++C IP P  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF
Sbjct  158  RHCPSKEEMMQCLIPPPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRF  217

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFPRGADAYIDDI  LI L DG+IRTAIDTGCGVASWGAYLL RDI  +SFAP
Sbjct  218  RFPGGGTMFPRGADAYIDDINALIPLTDGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAP  277

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  278  RDTHEAQVQFALERGVP  294



>ref|XP_007134966.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
 gb|ESW06960.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
Length=640

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S   L+FAA H   D    A   P    PPC    SEYTPC+D  RSL+F R  L YRER
Sbjct  76   SLTHLEFAASHNIPDPPPTAARGP--HLPPCGWSFSEYTPCEDQNRSLQFPRARLAYRER  133

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCPA E++L+CRIPAP+GY+ P+RWP SRD+ W+AN PHK LTVEK GQNWVRF+G+RF 
Sbjct  134  HCPAAEDVLRCRIPAPYGYKQPLRWPASRDAAWFANAPHKELTVEKKGQNWVRFEGDRFR  193

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGAD YID++G+LINL+DGSIRTAIDTGCGVAS+GAYLLSRDI  +SFAP+
Sbjct  194  FPGGGTMFPRGADRYIDELGKLINLRDGSIRTAIDTGCGVASFGAYLLSRDILTVSFAPR  253

Query  568  DTHEAQVQFALERXIP  615
            DTH +QVQFALER +P
Sbjct  254  DTHISQVQFALERGVP  269



>ref|XP_004140852.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
 ref|XP_004157229.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT15-like 
[Cucumis sativus]
 gb|KGN57350.1| hypothetical protein Csa_3G180380 [Cucumis sativus]
Length=604

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +1

Query  100  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  279
            AK FP C    SEYTPC+DT+RSLKF R  L YRERHCP KEE LKCRIPAP GYR P  
Sbjct  61   AKPFPACGLVYSEYTPCEDTQRSLKFSRDRLIYRERHCPEKEEALKCRIPAPPGYRNPFA  120

Query  280  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  459
            WP SRD  WY NVPHK LTVEKA QNW+R++GE F FPGGGTMFP GADAYID+IG+LIN
Sbjct  121  WPVSRDLAWYVNVPHKDLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADAYIDNIGKLIN  180

Query  460  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            LKDGSIRTAIDTGCGV SWGAYLLSR I  +SFAP+DTHEAQVQFALER +P
Sbjct  181  LKDGSIRTAIDTGCGVGSWGAYLLSRGIITMSFAPRDTHEAQVQFALERGVP  232



>gb|KJB24074.1| hypothetical protein B456_004G127200 [Gossypium raimondii]
Length=620

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S+ S  +LDFA+HH     VA+  +    +FPPC    SEYTPCQD  R  KFDR M+KY
Sbjct  68   SNQSLTNLDFASHHQ----VALDSSKTISQFPPCDMAYSEYTPCQDKVRGRKFDRDMMKY  123

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+E+L C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+
Sbjct  124  RERHCPTKQEMLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGD  183

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDIG LI L DG+IRTA+DTGCGVAS+GAYLL R+I  +SF
Sbjct  184  RFRFPGGGTMFPRGADAYIDDIGELIPLTDGNIRTAVDTGCGVASFGAYLLKRNILTMSF  243

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  244  APRDTHEAQVQFALERGVP  262



>ref|XP_010540274.1| PREDICTED: probable methyltransferase PMT15 [Tarenaya hassleriana]
Length=630

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 153/206 (74%), Gaps = 8/206 (4%)
 Frame = +1

Query  22   SSSAVSLDFAAH---HAAEDLVAVAQAPPAK-----EFPPCKAELSEYTPCQDTERSLKF  177
            SS+     F  H   H   D    +  PP         P C AELSEYTPC+D  RSL F
Sbjct  58   SSTVACTTFQPHPPPHLVFDSQHTSPDPPTTAARVVRIPACDAELSEYTPCEDVNRSLPF  117

Query  178  DRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQN  357
             R  L YRERHCP K E+L+CRIPAP+GY  P RWPESRD  W+ANVPH  LTVEK  QN
Sbjct  118  PRERLIYRERHCPEKGEILRCRIPAPYGYMAPFRWPESRDVAWFANVPHTELTVEKKSQN  177

Query  358  WVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSR  537
            WVR++ +RF FPGGGTMFPRGADAYIDDIG+LINL+DGSIRTAIDTGCGVASWGAYL+SR
Sbjct  178  WVRYEKDRFLFPGGGTMFPRGADAYIDDIGQLINLRDGSIRTAIDTGCGVASWGAYLMSR  237

Query  538  DIFPLSFAPKDTHEAQVQFALERXIP  615
            ++  +SFAP+DTHEAQVQFALER +P
Sbjct  238  NVVAMSFAPRDTHEAQVQFALERGVP  263



>ref|XP_010692380.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 160/205 (78%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            T   +S+   + LDF++HH+    +A         FPPC    SEYTPC D +RSL+F R
Sbjct  61   TLKNSSNPIPIPLDFSSHHSISSSLARVN-----HFPPCSLNFSEYTPCHDVDRSLRFPR  115

Query  184  RMLKYRERHCPAK-EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
              L YRERHCP +  E + CR+PAP GY  P RWPESRD VWYANVPHK LTVEKAGQNW
Sbjct  116  DRLVYRERHCPMELGEFVTCRVPAPNGYTTPFRWPESRDMVWYANVPHKWLTVEKAGQNW  175

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VRF+ +RFTFPGGGTMFPRGADAYID+IGR+INLKDGS+RTAIDTGCGVAS+GAYLLSR+
Sbjct  176  VRFEEDRFTFPGGGTMFPRGADAYIDEIGRIINLKDGSVRTAIDTGCGVASFGAYLLSRN  235

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAPKDTHEAQVQFALER +P
Sbjct  236  ILTVSFAPKDTHEAQVQFALERGVP  260



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDFA HH A+   +    P  +EFP C  + SEYTPC+D  RSL+FDR+ L YRERHCP 
Sbjct  78   LDFAVHHGADQ--SSTGFPVVREFPACDVKYSEYTPCEDRTRSLRFDRKRLIYRERHCPE  135

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K ELLKC IPAP GY+ P  WP SRD+ W+ANVPHK L V KAGQNW+R  G++F FPGG
Sbjct  136  KGELLKCLIPAPPGYKSPFPWPASRDTAWFANVPHKELAVGKAGQNWIRVDGDKFRFPGG  195

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GAD YIDDI +LI+L DGSIRTA+DTGCGVASWGAYLLSR++  +SFAPKD+HE
Sbjct  196  GTMFPNGADTYIDDIDQLISLSDGSIRTAVDTGCGVASWGAYLLSRNVLTMSFAPKDSHE  255

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  256  AQVQFALERGVP  267



>emb|CBI34642.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            S    SLDF +HH  E    +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYR
Sbjct  55   SRVGSSLDFESHHQVE----INNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYR  110

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+R
Sbjct  111  ERHCPTKDELLLCLIPAPPKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDR  170

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFA
Sbjct  171  FRFPGGGTMFPRGADAYIDDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFA  230

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  231  PRDTHEAQVQFALERGVP  248



>ref|XP_002317647.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE98259.1| dehydration-responsive family protein [Populus trichocarpa]
Length=625

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 150/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS SAV LDF +HH     + +       E PPC    SEYTPCQD +R  KFDR MLKY
Sbjct  68   SSESAV-LDFNSHHQ----IQINNTDSVNEIPPCDMSYSEYTPCQDPQRGRKFDRNMLKY  122

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY N+PH  L++EKA QNW++ +G+
Sbjct  123  RERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHNELSIEKAVQNWIQVEGD  182

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  183  RFRFPGGGTMFPRGADAYIDDISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIIAMSF  242

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQV FALER +P
Sbjct  243  APRDTHEAQVWFALERGVP  261



>ref|XP_007039271.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23772.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=630

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +1

Query  28   SAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            S+ +LDFA+HH  E    V  +    +FPPC    SEYTPCQD  R  KFDR MLKYRER
Sbjct  75   SSTNLDFASHHQVE----VDSSKTVSQFPPCDMSFSEYTPCQDKVRGRKFDRDMLKYRER  130

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP KEELL C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF 
Sbjct  131  HCPTKEELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAIQNWIQVEGDRFR  190

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFPRGADAYIDDIG+LI L DG+IRTA+DTGCGVAS+GAYLL R++  +S AP+
Sbjct  191  FPGGGTMFPRGADAYIDDIGQLIPLTDGTIRTAVDTGCGVASFGAYLLKRNVLTMSIAPR  250

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  251  DTHEAQVQFALERGVP  266



>gb|KEH17379.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=636

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 153/192 (80%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH   +    +    + ++PPC   L++YTPC+D  RSLK+ R  + YRERHCP 
Sbjct  83   LDFFSHHNLTNPTTTSTTK-SSQYPPCTPSLTDYTPCEDHTRSLKYTRDKMIYRERHCPK  141

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K E+LKCR+PAP GY+ P  WP SRD  WYANVP++HLTVEKAGQNW+RF G++F FPGG
Sbjct  142  KHEILKCRVPAPNGYKNPFPWPTSRDMAWYANVPYRHLTVEKAGQNWIRFDGDKFRFPGG  201

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GAD YIDDIG+LI+L+DGS+RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHE
Sbjct  202  GTMFPNGADKYIDDIGKLIDLEDGSVRTAVDTGCGVASWGAYLLSRDILTVSIAPRDTHE  261

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  262  AQVQFALERGVP  273



>ref|XP_006653692.1| PREDICTED: probable methyltransferase PMT15-like, partial [Oryza 
brachyantha]
Length=592

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T L  SSS+  LDFAAHH AE +  VA     + +  C A+ SEYTPC+D ERSL+F R 
Sbjct  28   TVLGGSSSSAPLDFAAHHTAEGM-EVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRE  86

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCP++ E L+C +PAP GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R
Sbjct  87   RLVYRERHCPSEGERLRCLVPAPKGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIR  146

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
              G+RF FPGGGTMFP GA AYIDDIG++I L DGSIRTAIDTG GVASWGAYLLSR+I 
Sbjct  147  VDGDRFRFPGGGTMFPHGAGAYIDDIGKIIPLHDGSIRTAIDTGWGVASWGAYLLSRNIL  206

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+D+HEAQVQFALER +P
Sbjct  207  AMSFAPRDSHEAQVQFALERGVP  229



>ref|XP_004492680.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=1073

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 151/198 (76%), Gaps = 12/198 (6%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPP-----AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            +LDF+AHH   D       PP         P C   LSEYTPC+D +RSLKF R  L YR
Sbjct  90   ALDFSAHHNIPD-------PPETTARVTHAPVCDVSLSEYTPCEDVQRSLKFPRENLMYR  142

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP K+E+L+CRIPAPFGYR+P RWPESRD  WYANVPHK LT+EK  QNWV      
Sbjct  143  ERHCPEKKEILRCRIPAPFGYRVPPRWPESRDWAWYANVPHKELTIEKMKQNWVXXXXXX  202

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGA AYIDDIG+LINLKDGSIRTA+DTGCGVASWGAYLL RDI  +SFA
Sbjct  203  FRFPGGGTMFPRGAGAYIDDIGKLINLKDGSIRTALDTGCGVASWGAYLLPRDIIAVSFA  262

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  263  PRDTHEAQVQFALERGVP  280



>ref|XP_010061323.1| PREDICTED: probable methyltransferase PMT16 [Eucalyptus grandis]
 gb|KCW90733.1| hypothetical protein EUGRSUZ_A02808 [Eucalyptus grandis]
Length=605

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 154/193 (80%), Gaps = 2/193 (1%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            SLDF    A +     + +   + +PPC  + SE+TPC+D +RS +FDRR L +RERHCP
Sbjct  55   SLDFRPRRAQDG--GASSSENVRTYPPCDVKHSEHTPCEDPKRSHRFDRRRLIFRERHCP  112

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             + E LKCR+PAP GYR P RWP SRD  WYANVPHK LTVEKA QNW++F+G+RF FPG
Sbjct  113  ERNETLKCRVPAPPGYRNPFRWPTSRDMAWYANVPHKELTVEKAVQNWIQFEGDRFRFPG  172

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFP GADAYIDDIG+LI+L++GSIRTAIDTGCGVASWGAYLLSR I  +SFAP+DTH
Sbjct  173  GGTMFPNGADAYIDDIGKLIDLRNGSIRTAIDTGCGVASWGAYLLSRGILAMSFAPRDTH  232

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  233  EAQVQFALERGVP  245



>ref|XP_008377156.1| PREDICTED: probable methyltransferase PMT16 [Malus domestica]
Length=647

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 152/196 (78%), Gaps = 1/196 (1%)
 Frame = +1

Query  31   AVSLDFAAHHAAE-DLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRER  207
            A +LDF +HH+        + A     FP C A+ SEYTPC+D +RSLKFDR  L YRER
Sbjct  84   ASALDFTSHHSPNFSTATSSHATTTNVFPRCDAKYSEYTPCEDDKRSLKFDRDRLIYRER  143

Query  208  HCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            HCP K ELLKCRIPAP GY+    WP SRD  WYAN PHK LTVEKA QNW+ ++G+RF 
Sbjct  144  HCPEKSELLKCRIPAPHGYKNVFPWPRSRDLAWYANAPHKELTVEKAVQNWIIYEGDRFR  203

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP GADAYIDDIG+ INLKDGSIRTAIDTGCGVASWGAYLLSRDI  +SFAP+
Sbjct  204  FPGGGTMFPNGADAYIDDIGKFINLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPR  263

Query  568  DTHEAQVQFALERXIP  615
            DTH +QVQFALER +P
Sbjct  264  DTHVSQVQFALERGVP  279



>ref|XP_010461135.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=641

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  90   VGLDFESHHKLE-LKVTNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  146

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  147  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  206

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  207  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  266

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  267  HEAQVQFALERGVP  280



>ref|XP_006306983.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
 gb|EOA39881.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
Length=640

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  90   VELDFESHHKLE-LKVTNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  146

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  147  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFKFP  206

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  207  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  266

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  267  HEAQVQFALERGVP  280



>ref|XP_010478718.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=638

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  87   VGLDFESHHKLE-LKVTNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  143

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  144  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  203

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  204  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  263

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  264  HEAQVQFALERGVP  277



>ref|XP_003548213.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=632

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF++HH + +L           FPPC   LSEYTPC+D  RSL++ RR + YRERHCP  
Sbjct  77   DFSSHHNSTNLNPSTST--TLHFPPCHVSLSEYTPCEDHARSLQYSRRRMVYRERHCPRN  134

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
             E+LKCR+PAP GYR P  WP SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FPGGG
Sbjct  135  NEVLKCRVPAPHGYRNPFPWPASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFHFPGGG  194

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            TMFP GAD YIDDI  L+NL+DG++RTA+DTGCGVASWGAYLLSRDI  +S AP+DTHEA
Sbjct  195  TMFPDGADKYIDDIADLVNLRDGTVRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEA  254

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  255  QVQFALERGVP  265



>ref|NP_564419.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
 sp|Q9C884.1|PMTI_ARATH RecName: Full=Probable methyltransferase PMT18 [Arabidopsis thaliana]
 gb|AAG51278.1|AC027035_1 hypothetical protein [Arabidopsis thaliana]
 gb|AAM98224.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78933.1| At1g33170 [Arabidopsis thaliana]
 gb|AEE31570.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
Length=639

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  88   VELDFESHHKLE-LKITNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  144

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  145  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  204

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  205  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  264

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  265  HEAQVQFALERGVP  278



>ref|XP_010693482.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 158/207 (76%), Gaps = 3/207 (1%)
 Frame = +1

Query  4    TTNLTSSSSAVSL-DFAAHHAAEDLVAVAQAPP--AKEFPPCKAELSEYTPCQDTERSLK  174
            T NLT   S++SL DF+AHH AED+ +         K +P C A  S+YTPC+D  R+LK
Sbjct  60   THNLTGLGSSLSLLDFSAHHLAEDVPSTVSGSSLMTKSYPGCNASYSDYTPCEDPNRALK  119

Query  175  FDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQ  354
              +  + + ERHCP K E+LKCR+PAP+GY+ P +WP SRD  WY NVP K LT  KA Q
Sbjct  120  LKQTRMMHLERHCPTKTEVLKCRVPAPYGYKSPFKWPVSRDYAWYNNVPSKMLTEHKAVQ  179

Query  355  NWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLS  534
            NW+RF+G+RF FPGGGTMF  GADAYID+I +LINL DGSIRTAIDTGCGVASWGAYL+S
Sbjct  180  NWIRFEGDRFKFPGGGTMFRFGADAYIDNIAKLINLHDGSIRTAIDTGCGVASWGAYLMS  239

Query  535  RDIFPLSFAPKDTHEAQVQFALERXIP  615
            R+I P+SFAP+DTHEAQVQFALER +P
Sbjct  240  RNILPMSFAPRDTHEAQVQFALERGVP  266



>ref|XP_011004387.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
 ref|XP_011004388.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
Length=625

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS SAV LDF +HH     +         E PPC    SEYTPCQD  R  KFDR MLKY
Sbjct  68   SSESAV-LDFNSHHQ----IQFNNTDSVNEIPPCDMSYSEYTPCQDPRRGRKFDRNMLKY  122

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+
Sbjct  123  RERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGD  182

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L DGSIRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  183  RFRFPGGGTMFPRGADAYIDDISELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIISMSF  242

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQV FALER +P
Sbjct  243  APRDTHEAQVWFALERGVP  261



>ref|XP_002891032.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67291.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  88   VELDFESHHKLE-LKITNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  144

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  145  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  204

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  205  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  264

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  265  HEAQVQFALERGVP  278



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 149/192 (78%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH  E    V  +  ++ FPPC    +EYTPCQD  R  KFDR+ LKYRERHCP 
Sbjct  95   LDFESHHQLE----VNSSEESQAFPPCDKSYTEYTPCQDPSRGRKFDRKFLKYRERHCPD  150

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELL+C IPAP  Y+ P +WP+SRD  WYAN+PHKHL+VEKA QNW++ +G+RF FPGG
Sbjct  151  KEELLRCLIPAPPNYKTPFKWPQSRDYAWYANIPHKHLSVEKANQNWIQLEGDRFKFPGG  210

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDI  LI L +G IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHE
Sbjct  211  GTMFPNGADAYIDDINELIPLSNGDIRTALDTGCGVASWGAYLLKRNIIAMSFAPRDTHE  270

Query  580  AQVQFALERXIP  615
            AQV FALER +P
Sbjct  271  AQVWFALERGVP  282



>gb|AAF97349.1|AC021045_6 Unknown Protein [Arabidopsis thaliana]
Length=656

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E L    Q    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  88   VELDFESHHKLE-LKITNQT--VKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  144

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  145  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  204

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  205  GGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  264

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  265  HEAQVQFALERGVP  278



>gb|KHN16709.1| Putative methyltransferase PMT18 [Glycine soja]
Length=594

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 149/193 (77%), Gaps = 4/193 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            +L+F +HH     + +  +  A+EFP C    SEYTPCQD  R  KFDR MLKYRERHCP
Sbjct  43   NLNFDSHHQ----IDINNSGGAQEFPSCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCP  98

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
            AK ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPG
Sbjct  99   AKNELLNCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPG  158

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTH
Sbjct  159  GGTMFPRGADAYIDDINELIPLTSGTIRTAIDTGCGVASWGAYLLRRDILAMSFAPRDTH  218

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  219  EAQVQFALERGVP  231



>ref|XP_004145886.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
 gb|KGN49950.1| hypothetical protein Csa_5G146240 [Cucumis sativus]
Length=636

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS+   SLDF +HH  E    +      K   PC    SEYTPCQD  R+ KFDR MLKY
Sbjct  74   SSTPTRSLDFDSHHGVEINNTIEAV--TKTIFPCDMSFSEYTPCQDPTRARKFDRTMLKY  131

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCPAKEELL C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+
Sbjct  132  RERHCPAKEELLHCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGD  191

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L  G IRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  192  RFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASWGAYLLKRDIVAMSF  251

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  252  APRDTHEAQVQFALERGVP  270



>gb|EYU33422.1| hypothetical protein MIMGU_mgv1a002913mg [Erythranthe guttata]
Length=626

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 161/210 (77%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    DTTNLTS---SSSAVS--LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTER  165
            +T+N  S   SS+ +S  LDF +HH     ++V  +   ++FPPC    SEYTPCQD  R
Sbjct  58   ETSNRNSELPSSTGISDPLDFESHHQ----LSVNSSEEIEKFPPCDMAYSEYTPCQDNLR  113

Query  166  SLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEK  345
              KF R MLKYRERHCP+KEELL+C +PAP  Y+ P +WP+SRD  WYAN+PHK L++EK
Sbjct  114  GRKFPRDMLKYRERHCPSKEELLRCLVPAPPNYKSPFKWPQSRDYAWYANIPHKELSIEK  173

Query  346  AGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAY  525
            A QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI + DG++RTA+DTGCGVASWGAY
Sbjct  174  AVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINALIPITDGTVRTAVDTGCGVASWGAY  233

Query  526  LLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            LL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  234  LLKRDIMAMSFAPRDTHEAQVWFALERGVP  263



>ref|XP_004169220.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
Length=636

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS+   SLDF +HH  E    +      K   PC    SEYTPCQD  R+ KFDR MLKY
Sbjct  74   SSTPTRSLDFDSHHGVEINNTIEAV--TKTIFPCDMSFSEYTPCQDPTRARKFDRTMLKY  131

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCPAKEELL C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+
Sbjct  132  RERHCPAKEELLHCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGD  191

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L  G IRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  192  RFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASWGAYLLKRDIVAMSF  251

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  252  APRDTHEAQVQFALERGVP  270



>ref|XP_004515722.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=649

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 150/197 (76%), Gaps = 4/197 (2%)
 Frame = +1

Query  37   SLDFAAHH----AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            +LDF +HH          +   +     +PPC   L++YTPC+D  RSLK+ R  + YRE
Sbjct  89   NLDFFSHHNATTLTYTTTSTTASTKKNHYPPCTPSLTDYTPCEDHARSLKYTRDKMIYRE  148

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP K E+LKCR+PAP GY+ P  WP SRD  WYANVP++HLTVEKA QNW+RF G+RF
Sbjct  149  RHCPNKNEILKCRVPAPNGYKNPFPWPTSRDMAWYANVPYRHLTVEKAVQNWIRFDGDRF  208

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GAD YIDDIG+LINL DGSIRTA+DTGCGVASWGAYLLSRDI  +S AP
Sbjct  209  RFPGGGTMFPDGADKYIDDIGKLINLSDGSIRTAVDTGCGVASWGAYLLSRDIITVSIAP  268

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  269  RDTHEAQVQFALERGVP  285



>ref|XP_002518966.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43499.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 146/192 (76%), Gaps = 4/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH  E    +       EFPPC    SEYTPCQ  ER  KFDR MLKYRERHCP 
Sbjct  79   LDFNSHHQIE----INTTDAVAEFPPCDMSYSEYTPCQHPERGRKFDRNMLKYRERHCPT  134

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELL C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FPGG
Sbjct  135  KEELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGG  194

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHE
Sbjct  195  GTMFPRGADAYIDDINELVPLTGGAIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHE  254

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  255  AQVQFALERGVP  266



>ref|XP_008663475.1| PREDICTED: probable methyltransferase PMT15 [Zea mays]
 gb|AFW59147.1| hypothetical protein ZEAMMB73_843401 [Zea mays]
Length=641

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T   SS  A  LDFAAHH AE + + A A   + +  C A+ SEYTPC+D ERSL+F R 
Sbjct  77   TTAPSSPPAGPLDFAAHHTAEGMESEA-ALRQRSYEACPAKYSEYTPCEDVERSLRFPRD  135

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCPA  E L+C +PAP GYR P  WP SRD  W+ANVPHK L+VEKA QNW+R
Sbjct  136  RLVYRERHCPADGERLRCLVPAPRGYRNPFPWPASRDVAWFANVPHKELSVEKAVQNWIR  195

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
              G+RF FPGGGTMFPRGA AYIDDI +LI L DGSIRTA+DTGCGVASWGAYLLSRDI 
Sbjct  196  VDGDRFRFPGGGTMFPRGAGAYIDDIAKLIPLHDGSIRTALDTGCGVASWGAYLLSRDIL  255

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+D+HEAQVQFALER +P
Sbjct  256  AMSFAPRDSHEAQVQFALERGVP  278



>ref|XP_003530522.1| PREDICTED: probable methyltransferase PMT18-like [Glycine max]
Length=629

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 149/193 (77%), Gaps = 4/193 (2%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            +L+F +HH     + +  +  A+EFP C    SEYTPCQD  R  KFDR MLKYRERHCP
Sbjct  78   NLNFDSHHQ----IDINNSGGAQEFPSCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCP  133

Query  217  AKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
            AK ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPG
Sbjct  134  AKNELLNCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPG  193

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTH
Sbjct  194  GGTMFPRGADAYIDDINELIPLTSGTIRTAIDTGCGVASWGAYLLRRDILAMSFAPRDTH  253

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  254  EAQVQFALERGVP  266



>ref|XP_008437487.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
 ref|XP_008437488.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
Length=636

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SS+   SLDF +HH  E    +      K   PC    SEYTPCQD  R+ KFDR MLKY
Sbjct  74   SSTPTRSLDFQSHHGVEINNTIEAV--TKTISPCDMSFSEYTPCQDPTRARKFDRTMLKY  131

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCPAKEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+
Sbjct  132  RERHCPAKEEQLLCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGD  191

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI L  G IRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  192  RFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASWGAYLLKRDILAMSF  251

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  252  APRDTHEAQVQFALERGVP  270



>ref|XP_010250929.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250938.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250946.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250956.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250965.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250972.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250980.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
Length=633

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF AHH     V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHCP K
Sbjct  81   DFEAHHQ----VGINETDGIEKFPPCDMTYSEYTPCQDPVRGRKFDRNMLKYRERHCPTK  136

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            EELL+C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G RF FPGGG
Sbjct  137  EELLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGNRFRFPGGG  196

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            TMFPRGADAYIDDI +LI L  G+IRTA+DTGCGVASWGAYLL R+I  +SFAP+DTHEA
Sbjct  197  TMFPRGADAYIDDINKLIPLTSGTIRTALDTGCGVASWGAYLLKRNILAMSFAPRDTHEA  256

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  257  QVQFALERGVP  267



>ref|XP_008668482.1| PREDICTED: uncharacterized protein LOC100384329 isoform X1 [Zea 
mays]
Length=638

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T  +SS  A  LDFAAHH AE  V    A   + +  C A+ SEYTPC+D ERSL+F R 
Sbjct  74   TTASSSPPAGPLDFAAHHTAEG-VEAEGALRHRNYEACPAKYSEYTPCEDVERSLRFPRD  132

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCPA  E L+C +PAP GYR P  WP SRD  W+ANVPHK L+VEKA QNW+R
Sbjct  133  RLVYRERHCPAAGERLRCLVPAPKGYRNPFPWPASRDVAWFANVPHKELSVEKAVQNWIR  192

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
              G++F FPGGGTMFPRGA AYIDDIG+LI L DGSIRTA+DTGCGVASWGAYLLSR+I 
Sbjct  193  VDGDKFRFPGGGTMFPRGAGAYIDDIGKLIPLHDGSIRTALDTGCGVASWGAYLLSRNIL  252

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+D+HEAQVQFALER +P
Sbjct  253  AMSFAPRDSHEAQVQFALERGVP  275



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   285 bits (729),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 159/205 (78%), Gaps = 10/205 (5%)
 Frame = +1

Query  13   LTSSSSAVSLDFAAHHAAEDLVAVAQAPPAK----EFPPCKAELSEYTPCQDTERSLKFD  180
             + ++S   LDF  HH   D       PP K     FP C A+LSE+TPC+D +RSLKF 
Sbjct  57   FSKTTSTRDLDFNTHHNPHD------PPPVKAATVSFPSCGAKLSEHTPCEDAKRSLKFP  110

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R  L+YR+RHCP +EE LKCRIPAP+GY+ P RWPESRD  W+ANVPH  LTVEK  QNW
Sbjct  111  RGRLEYRQRHCPEREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  170

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            VR++ +RF FPGGGTMFPRGAD+YIDDIG+LI+L  GSIRTAIDTGCGVAS+GAYLLSR+
Sbjct  171  VRYENDRFWFPGGGTMFPRGADSYIDDIGQLIDLSHGSIRTAIDTGCGVASFGAYLLSRN  230

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  231  ITTMSFAPRDTHEAQVQFALERGVP  255



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH AE    V  AP  + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP+
Sbjct  89   LDFRAHHTAEG-TEVESAPAKRTYEACPAQYSEYTPCEDVERSLRFPRDRLMYRERHCPS  147

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            + E L+C +PAP GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R  G++F FPGG
Sbjct  148  EGERLRCLVPAPQGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGG  207

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GA AYIDDIG+LI L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HE
Sbjct  208  GTMFPHGAGAYIDDIGKLIPLHDGSIRTALDTGCGVASWGAYLLSRDILVMSFAPRDSHE  267

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  268  AQVQFALERGVP  279



>ref|XP_010056104.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056105.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056106.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 gb|KCW72678.1| hypothetical protein EUGRSUZ_E01134 [Eucalyptus grandis]
Length=633

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 157/204 (77%), Gaps = 4/204 (2%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDR  183
            +T L+SSS +VSLDF +HH     VA+  +   +  P C    SEYTPCQD +R  KFDR
Sbjct  70   STKLSSSSESVSLDFQSHHQ----VAINDSDTVETIPACDMAHSEYTPCQDPQRGRKFDR  125

Query  184  RMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWV  363
             MLKYRERHCP K+ELLKC IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW+
Sbjct  126  NMLKYRERHCPKKDELLKCLIPAPPRYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWI  185

Query  364  RFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDI  543
            + +G+RF FPGGGTMFPRGADAYIDDI  LI L  G IRTAIDTGCGVASWGAYLL RDI
Sbjct  186  QVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGKIRTAIDTGCGVASWGAYLLKRDI  245

Query  544  FPLSFAPKDTHEAQVQFALERXIP  615
              +SFAP+DTHEAQVQFALER +P
Sbjct  246  VTMSFAPRDTHEAQVQFALERGVP  269



>ref|XP_009768341.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768342.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768343.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768344.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768345.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
Length=636

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH     + V  +  ++ FPPC    SEYTPCQ+ +R  KFDR MLKYRERHC
Sbjct  85   VPLDFESHHQ----LVVNNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHC  140

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+KEEL++C IPAP  Y+IP +WP+SRD  W+AN+PHK L++EKA QNWV+ +G+R  FP
Sbjct  141  PSKEELIRCLIPAPPNYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFP  200

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFP GADAYIDDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  201  GGGTMFPHGADAYIDDISELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDT  260

Query  574  HEAQVQFALERXIP  615
            HEAQV FALER +P
Sbjct  261  HEAQVWFALERGVP  274



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDFAAHH AE +  VA     + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP+
Sbjct  91   LDFAAHHTAEGM-EVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPS  149

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            + E L+C +PAP GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R +GE+F FPGG
Sbjct  150  EGERLRCLVPAPQGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVEGEKFRFPGG  209

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GA AYIDDIG++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HE
Sbjct  210  GTMFPHGAGAYIDDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHE  269

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  270  AQVQFALERGVP  281



>ref|XP_009596889.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596890.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596891.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596893.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596894.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596895.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
Length=634

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH     + V  +  ++ FPPC    SEYTPCQ+ +R  KFDR MLKYRERHC
Sbjct  83   VPLDFESHHQ----LVVNNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHC  138

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL+C IPAP  Y+IP +WP+SRD  W+AN+PHK L++EKA QNWV+ +G+R  FP
Sbjct  139  PSKDELLRCLIPAPPNYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFP  198

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFP GADAYIDDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  199  GGGTMFPHGADAYIDDISELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDT  258

Query  574  HEAQVQFALERXIP  615
            HEAQV FALER +P
Sbjct  259  HEAQVWFALERGVP  272



>ref|XP_003592303.1| hypothetical protein MTR_1g101370 [Medicago truncatula]
 gb|AES62554.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=634

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = +1

Query  37   SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCP  216
            +LDF +HH + D + +A +     FP C    +EYTPC+D  RSL++ R  + YRERHCP
Sbjct  69   TLDFQSHHNSSDTI-IALSSETFNFPRCGVNFTEYTPCEDPTRSLRYKRSRMIYRERHCP  127

Query  217  AK-EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
             K EE LKCR+P P GY+ P  WP SRD  WYANVPH+ LTVEKA QNW+R+ G+RF FP
Sbjct  128  VKGEEDLKCRVPPPHGYKTPFTWPASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFFFP  187

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFP GA AYIDDIG+LINLKDGSIRTA+DTGCGVASWGAYL SR+I  LS AP+DT
Sbjct  188  GGGTMFPNGAGAYIDDIGKLINLKDGSIRTALDTGCGVASWGAYLQSRNIITLSLAPRDT  247

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  248  HEAQVQFALERGVP  261



>ref|XP_009389104.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389112.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389120.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            SSS+   LDF AHH +   V  A      +FPPC    SEYTPC D  R  +F+R ML Y
Sbjct  70   SSSTNAVLDFDAHHESNLNVTPATN---DKFPPCDLNFSEYTPCHDRTRGRRFERAMLVY  126

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP  +EL++C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++  G+
Sbjct  127  RERHCPGNDELIRCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVDGD  186

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  LI+L DGSIRTAIDTGCGVASWGAYLL RDI  +SF
Sbjct  187  RFRFPGGGTMFPRGADAYIDDINALISLTDGSIRTAIDTGCGVASWGAYLLRRDIVTMSF  246

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  247  APRDTHEAQVQFALERGVP  265



>gb|KDP25187.1| hypothetical protein JCGZ_20343 [Jatropha curcas]
Length=626

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
             S+ S++ LDF +HH  E    +        FP C    SEYTPCQ  +R  KFDR MLK
Sbjct  67   NSNPSSILLDFDSHHQIE----INNTDTVANFPSCDMSFSEYTPCQHPQRGRKFDRNMLK  122

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP KEELL C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G
Sbjct  123  YRERHCPTKEELLFCLIPAPPKYKTPFKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEG  182

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  183  DRFRFPGGGTMFPRGADAYIDDINELIPLTGGTIRTAIDTGCGVASWGAYLLKREILAMS  242

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  243  FAPRDTHEAQVQFALERGVP  262



>ref|XP_004496597.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=623

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = +1

Query  34   VSLDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
             +LDF +HH    D+ ++++      FP C    +EYTPC+D  RSL++ R  + +RERH
Sbjct  71   TTLDFQSHHNVTADITSLSKT---IVFPRCSVNFTEYTPCEDPTRSLRYKRSRMIFRERH  127

Query  211  CPAK-EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            CP K EE LKCR+P P+GYR P  WP SRD  WYANVPH+ LTVEKA QNW+R+ G+RF 
Sbjct  128  CPIKGEEDLKCRVPPPYGYRNPFPWPASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFF  187

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP GADAYIDDIG+LINLKDGSIRTA+DTGCGVASWGAYL+SR+I  LS AP+
Sbjct  188  FPGGGTMFPNGADAYIDDIGKLINLKDGSIRTALDTGCGVASWGAYLMSRNIITLSIAPR  247

Query  568  DTHEAQVQFALERXIP  615
            DTHEAQVQFALER +P
Sbjct  248  DTHEAQVQFALERGVP  263



>emb|CDX84046.1| BnaC08g07230D [Brassica napus]
Length=612

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 150/194 (77%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E      +    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  62   VKLDFESHHKLE---LKQKNQTIKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  118

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  119  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  178

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYIDDI RLI L DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  179  GGGTGFPRGADAYIDDISRLIPLTDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDT  238

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  239  HEAQVQFALERGVP  252



>emb|CDY54063.1| BnaA02g36490D, partial [Brassica napus]
Length=554

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +1

Query  106  EFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWP  285
            + P C  E SEYTPC+   RSL F R  L YRERHCP+K+E+L+CRIPAP+GY +P RWP
Sbjct  87   QIPSCGVEFSEYTPCESVSRSLSFPRDRLIYRERHCPSKDEILRCRIPAPYGYSVPFRWP  146

Query  286  ESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLK  465
            ESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGGGTMFPRGADAYI +IGRLINLK
Sbjct  147  ESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIGEIGRLINLK  206

Query  466  DGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            DGS+R AIDTGCGVAS+GAYL+SR+I  +SFAP+DTHEAQVQFALER +P
Sbjct  207  DGSVRAAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVP  256



>ref|XP_002270920.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660487.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660490.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
Length=632

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF +HH  E    +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYRERHCP K
Sbjct  82   DFESHHQVE----INNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTK  137

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            +ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGG
Sbjct  138  DELLLCLIPAPPKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGG  197

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            TMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEA
Sbjct  198  TMFPRGADAYIDDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEA  257

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  258  QVQFALERGVP  268



>ref|XP_009124372.1| PREDICTED: probable methyltransferase PMT18 [Brassica rapa]
Length=638

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E      +    K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  87   VELDFESHHKLE---LKQKNQTIKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  143

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  144  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  203

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  204  GGGTGFPRGADAYIDDISRLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDT  263

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  264  HEAQVQFALERGVP  277



>ref|XP_006846537.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
 gb|ERN08212.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
Length=634

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   LDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            LDF +HH  ++ D  A  Q     +FP C+ + SEYTPCQD +R+ KF+++ML YRERHC
Sbjct  83   LDFESHHQVSSNDTSAGFQ-----KFPACEMKFSEYTPCQDPKRARKFEKKMLIYRERHC  137

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            PAK+ELL+C IPAP GY+ P  WP SRD  WYANVPHK LT+EKA QNW++ +GE+F FP
Sbjct  138  PAKDELLRCLIPAPPGYKNPFPWPRSRDWAWYANVPHKELTIEKAVQNWIQVEGEKFRFP  197

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGADAYIDDI  LI L  G IRTA+DTGCGVASWGAYLLSR+I  +SFAP+DT
Sbjct  198  GGGTMFPRGADAYIDDINELIPLTSGKIRTALDTGCGVASWGAYLLSRNILAMSFAPRDT  257

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  258  HEAQVQFALERGVP  271



>ref|NP_001065036.1| Os10g0510400 [Oryza sativa Japonica Group]
 gb|AAK84446.1|AC087192_7 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54570.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47874.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26950.1| Os10g0510400 [Oryza sativa Japonica Group]
 dbj|BAG93354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51256.1| hypothetical protein OsJ_32126 [Oryza sativa Japonica Group]
Length=634

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S+S  SLDF AHH  + +D  A A   P   FP C    SEYTPC+D +R  +F+R ML 
Sbjct  76   SASQESLDFEAHHQLSLDDTGAEAAVQP---FPACPLNFSEYTPCEDRKRGRRFERAMLV  132

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E ++C IPAP  YR P +WP+SRD  W+ N+PHK L++EKA QNW++  G
Sbjct  133  YRERHCPGKDEEIRCLIPAPPKYRTPFKWPQSRDFAWFNNIPHKELSIEKAVQNWIQVDG  192

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDIG+LI+L DG IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  193  QRFRFPGGGTMFPRGADAYIDDIGKLISLTDGKIRTAIDTGCGVASWGAYLLKRNILAMS  252

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  253  FAPRDTHEAQVQFALERGVP  272



>ref|XP_009128495.1| PREDICTED: probable methyltransferase PMT15 [Brassica rapa]
Length=665

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L F   H +      A+     + P C  E SEYTPC+   RSL F R  L YRERHCP+
Sbjct  112  LPFTPRHTSPSETTTARV---VQIPSCGVEFSEYTPCESVSRSLSFPRDRLIYRERHCPS  168

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+E+L+CRIPAP+GY +P RWPESRD  W+ANVPH  LTVEK  QNWVR++ +RF FPGG
Sbjct  169  KDEILRCRIPAPYGYSVPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGG  228

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYI +IGRLINLKDGS+RTAIDTGCGVAS+GAYL+SR+I  +SFAP+DTHE
Sbjct  229  GTMFPRGADAYIGEIGRLINLKDGSVRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHE  288

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  289  AQVQFALERGVP  300



>ref|XP_010660482.1| PREDICTED: probable methyltransferase PMT18 isoform X1 [Vitis 
vinifera]
Length=652

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF +HH  E    +  +   + FPPC    SEYTPCQD  R+ KFDR MLKYRERHCP K
Sbjct  102  DFESHHQVE----INNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTK  157

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            +ELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGGG
Sbjct  158  DELLLCLIPAPPKYKNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGG  217

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            TMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DTHEA
Sbjct  218  TMFPRGADAYIDDINELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEA  277

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  278  QVQFALERGVP  288



>gb|EEC67295.1| hypothetical protein OsI_34283 [Oryza sativa Indica Group]
Length=634

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S+S  SLDF AHH  + +D  A A   P   FP C    SEYTPC+D +R  +F+R ML 
Sbjct  76   SASQESLDFEAHHQLSLDDTDAEAAVQP---FPACPLNFSEYTPCEDRKRGRRFERAMLV  132

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E ++C IPAP  YR P +WP+SRD  W+ N+PHK L++EKA QNW++  G
Sbjct  133  YRERHCPGKDEEIRCLIPAPPKYRTPFKWPQSRDFAWFNNIPHKELSIEKAVQNWIQVDG  192

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDIG+LI+L DG IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  193  QRFRFPGGGTMFPRGADAYIDDIGKLISLTDGKIRTAIDTGCGVASWGAYLLKRNILAMS  252

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  253  FAPRDTHEAQVQFALERGVP  272



>ref|XP_008378063.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378064.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378065.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            + T+   SSS + LDF +HH     V V +    ++FPPC    SEYTPCQD  R  KFD
Sbjct  68   NKTSSPVSSSPLRLDFESHHQ----VDVNKTEAVQKFPPCDMSYSEYTPCQDPRRGRKFD  123

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R+MLK+RERHCP KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW
Sbjct  124  RKMLKHRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNW  183

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL R+
Sbjct  184  IQVEGDRFRFPGGGTMFPRGADAYIDDINXLIPLTKGNIRTAIDTGCGVASWGAYLLKRN  243

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+H AQVQFALER +P
Sbjct  244  IVTMSFAPRDSHAAQVQFALERGVP  268



>emb|CDX99540.1| BnaC09g24520D [Brassica napus]
Length=537

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+  E      Q    K F PC   LSEYTPC+D +R  KFDR MLKYRERHCP+
Sbjct  70   LDFKSHNQDE-FKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRKFDRNMLKYRERHCPS  126

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  127  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGG  186

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  187  GTMFPRGADAYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  246

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  247  AQVQFALERGVP  258



>ref|XP_006415121.1| hypothetical protein EUTSA_v10007044mg [Eutrema salsugineum]
 gb|ESQ33474.1| hypothetical protein EUTSA_v10007044mg [Eutrema salsugineum]
Length=638

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E  V        K F PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  88   VELDFESHHKLELKVPNQTV---KYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  144

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GE+F FP
Sbjct  145  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGEKFRFP  204

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYIDDI RLI L DG+IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  205  GGGTGFPRGADAYIDDISRLIPLTDGAIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDT  264

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  265  HEAQVQFALERGVP  278



>ref|XP_006661944.1| PREDICTED: probable methyltransferase PMT18-like [Oryza brachyantha]
Length=633

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 153/200 (77%), Gaps = 5/200 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S+S  SLDF AHH  + +D  A A   P   FP C    SEYTPC+D  R  +F+R ML 
Sbjct  75   SASQESLDFEAHHQLSLDDSDAGAAVQP---FPACPMNFSEYTPCEDRTRGRRFERAMLV  131

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E ++C +PAP  YR P +WP+SRD  W+ N+PHK L++EKA QNW++  G
Sbjct  132  YRERHCPGKDEEIRCLVPAPPKYRTPFKWPQSRDYAWFNNIPHKELSIEKAVQNWIQVDG  191

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            ERF FPGGGTMFPRGADAYIDDIG+LI+L DG IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  192  ERFRFPGGGTMFPRGADAYIDDIGKLISLSDGRIRTAIDTGCGVASWGAYLLKRNILAMS  251

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  252  FAPRDTHEAQVQFALERGVP  271



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 152/205 (74%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            + T+   SSS + LDF +HH     V V +    + F PC    SEYTPCQD  R  KFD
Sbjct  68   NKTSSPVSSSPLRLDFESHHQ----VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFD  123

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R+MLKYRERHCP KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW
Sbjct  124  RKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNW  183

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RD
Sbjct  184  IQVEGDRFRFPGGGTMFPRGADAYIDDINALIPLTKGNIRTAIDTGCGVASWGAYLLKRD  243

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+H AQVQFALER +P
Sbjct  244  IVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 152/205 (74%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            + T+   SSS + LDF +HH     V V +    + F PC    SEYTPCQD  R  KFD
Sbjct  68   NKTSSPVSSSPLRLDFESHHQ----VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFD  123

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R+MLKYRERHCP KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW
Sbjct  124  RKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNW  183

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RD
Sbjct  184  IQVEGDRFRFPGGGTMFPRGADAYIDDINALIPLTKGNIRTAIDTGCGVASWGAYLLKRD  243

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+H AQVQFALER +P
Sbjct  244  IVTMSFAPRDSHAAQVQFALERGVP  268



>ref|XP_008348991.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348992.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348993.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            + T+   SSS + LDF +HH     V V +    ++FPPC    SEYTPCQD  R  KFD
Sbjct  68   NKTSSPVSSSPLRLDFESHHQ----VDVNKTEAVQKFPPCDMSYSEYTPCQDPRRGRKFD  123

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R+MLK RERHCP KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW
Sbjct  124  RKMLKXRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNW  183

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL R+
Sbjct  184  IQVEGDRFRFPGGGTMFPRGADAYIDDINXLIPLTKGNIRTAIDTGCGVASWGAYLLKRN  243

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+H AQVQFALER +P
Sbjct  244  IVTMSFAPRDSHAAQVQFALERGVP  268



>emb|CDY44966.1| BnaA08g06660D [Brassica napus]
Length=620

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E      +    K   PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  62   VELDFESHHKLE---LKQKNQTIKYLEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  118

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  119  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  178

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYIDDI RLI L DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  179  GGGTGFPRGADAYIDDISRLIPLTDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDT  238

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  239  HEAQVQFALERGVP  252



>ref|NP_192782.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
 sp|Q9SZX8.1|PMTH_ARATH RecName: Full=Probable methyltransferase PMT17 [Arabidopsis thaliana]
 emb|CAB40037.1| putative protein [Arabidopsis thaliana]
 emb|CAB78167.1| putative protein [Arabidopsis thaliana]
 gb|AEE82883.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
Length=633

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+  E L    Q    K F PC+  LSEYTPC+D +R  +FDR M+KYRERHCP 
Sbjct  73   LDFKSHNQIE-LKETNQT--IKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPV  129

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  130  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  189

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  190  GTMFPRGADAYIDDIARLIPLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  249

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  250  AQVQFALERGVP  261



>ref|XP_009107959.1| PREDICTED: probable methyltransferase PMT18 [Brassica rapa]
Length=641

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            V LDF +HH  E      +    K   PC   LSEYTPC+D ER  +FDR M+KYRERHC
Sbjct  90   VELDFESHHKLE---LKQKNQTIKYLEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHC  146

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L++EKA QNW++ +GERF FP
Sbjct  147  PSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFP  206

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYIDDI RLI L DG++RTAIDTGCGVAS+GAYLL RDI  +SFAP+DT
Sbjct  207  GGGTGFPRGADAYIDDISRLIPLTDGAVRTAIDTGCGVASFGAYLLKRDILAMSFAPRDT  266

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  267  HEAQVQFALERGVP  280



>emb|CDX99539.1| BnaC09g24530D [Brassica napus]
Length=625

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+  E      Q    K F PC   LSEYTPC+D +R  KFDR MLKYRERHCP+
Sbjct  70   LDFKSHNQDE-FKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRKFDRNMLKYRERHCPS  126

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  127  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGG  186

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  187  GTMFPRGADAYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  246

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  247  AQVQFALERGVP  258



>ref|XP_011070323.1| PREDICTED: probable methyltransferase PMT18 [Sesamum indicum]
Length=626

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 154/201 (77%), Gaps = 7/201 (3%)
 Frame = +1

Query  22   SSSAVS---LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRML  192
            SSSA+S   LDF +HH     ++V  +   ++FPPC    SEYTPC+D +RS KFDR   
Sbjct  73   SSSAMSQDALDFESHHE----LSVNSSQDIEKFPPCDISYSEYTPCEDQQRSKKFDRDRF  128

Query  193  KYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFK  372
            KYRERHCP K+ELL+C +PAP  Y+ P +WP+SRD  WYAN+PHK L++EKA QNW++ +
Sbjct  129  KYRERHCPTKQELLRCLVPAPPNYKRPFKWPQSRDYAWYANIPHKELSIEKAVQNWIQVE  188

Query  373  GERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPL  552
            GERF FPGGGTMF  GAD YIDDI  LI + DGSIRTA+DTGCGVASWGAYLL RDI  +
Sbjct  189  GERFRFPGGGTMFANGADVYIDDINALIPITDGSIRTALDTGCGVASWGAYLLKRDIVAM  248

Query  553  SFAPKDTHEAQVQFALERXIP  615
            SFAP+DTHEAQV FALER +P
Sbjct  249  SFAPRDTHEAQVWFALERGVP  269



>ref|XP_010421961.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=637

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            +DF +H+   DL    Q    K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+
Sbjct  78   IDFKSHNQI-DLKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPS  134

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  135  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  194

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  195  GTMFPRGADAYIDDIARLIPLNDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  254

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  255  AQVQFALERGVP  266



>ref|XP_010455441.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=633

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            +DF +H+   DL    Q    K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP+
Sbjct  78   IDFKSHNQI-DLKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPS  134

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  135  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  194

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  195  GTMFPRGADAYIDDIARLIPLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  254

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  255  AQVQFALERGVP  266



>ref|XP_004976536.1| PREDICTED: probable methyltransferase PMT15-like [Setaria italica]
Length=640

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 152/193 (79%), Gaps = 2/193 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDFAAHH AE +   A AP  + +  C  + SEYTPC+D ERSL+F R  L YRERHCP+
Sbjct  86   LDFAAHHTAEGMEEDA-APRQRAYDACPVKYSEYTPCEDVERSLRFSRDRLVYRERHCPS  144

Query  220  KE-ELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPG  396
             + E L+C +PAP GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R  G++F FPG
Sbjct  145  SDAERLRCLVPAPRGYRNPFPWPASRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPG  204

Query  397  GGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTH  576
            GGTMFPRGA AYIDDIG++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+H
Sbjct  205  GGTMFPRGAGAYIDDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSH  264

Query  577  EAQVQFALERXIP  615
            EAQVQFALER +P
Sbjct  265  EAQVQFALERGVP  277



>ref|XP_009113612.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 ref|XP_009113613.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
Length=625

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+  E      Q    K F PC   LSEYTPC+D +R  KFDR M+KYRERHCP+
Sbjct  70   LDFKSHNQDE-FKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRKFDRNMMKYRERHCPS  126

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  127  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGG  186

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  187  GTMFPRGADAYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  246

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  247  AQVQFALERGVP  258



>ref|XP_002874627.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50886.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +++  E L    Q    K F PC+  LSEYTPC+D +R  +FDR M+KYRERHCP+
Sbjct  76   LDFKSYNQIE-LKETNQT--IKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPS  132

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  133  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  192

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  193  GTMFPRGADAYIDDIARLIPLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  252

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  253  AQVQFALERGVP  264



>ref|XP_006397065.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
 gb|ESQ38518.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
Length=665

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 150/195 (77%), Gaps = 3/195 (2%)
 Frame = +1

Query  31   AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
            +  LDF +H+   D     Q    K F PC   LSEYTPC+D +R  +FDR M+KYRERH
Sbjct  107  SAELDFKSHNQI-DFKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERH  163

Query  211  CPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTF  390
            CP+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF F
Sbjct  164  CPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRF  223

Query  391  PGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKD  570
            PGGGTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+D
Sbjct  224  PGGGTMFPRGADAYIDDIARLIPLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRD  283

Query  571  THEAQVQFALERXIP  615
            THEAQVQFALER +P
Sbjct  284  THEAQVQFALERGVP  298



>emb|CDX94256.1| BnaC02g29160D [Brassica napus]
Length=619

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 151/203 (74%), Gaps = 3/203 (1%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T    SS +  LDF +H+  E           K F PC   LSEYTPC+D +R  +FDR 
Sbjct  54   TQSNPSSESADLDFKSHNQFE---FKETNLTIKNFEPCDLSLSEYTPCEDRQRGRRFDRN  110

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
            M+KYRERHCP+K+ELL C IP P  Y+IP +WP+SRD  WY N+PH+ L+VEKA QNW++
Sbjct  111  MMKYRERHCPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHRELSVEKAVQNWIQ  170

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +G+RF FPGGGTMFPRGADAYIDDI RLI L  G IRTAIDTGCGVAS+GAYLL RDI 
Sbjct  171  VEGDRFRFPGGGTMFPRGADAYIDDIARLIPLTAGGIRTAIDTGCGVASFGAYLLKRDIM  230

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTHEAQVQFALER +P
Sbjct  231  AVSFAPRDTHEAQVQFALERGVP  253



>ref|XP_007160205.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 ref|XP_007160206.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 gb|ESW32199.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
 gb|ESW32200.1| hypothetical protein PHAVU_002G301800g [Phaseolus vulgaris]
Length=627

 Score =   272 bits (696),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 156/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            ++  S+ +LDFA+HH     + +  +   +EFPPC   LSEYTPCQD +R  ++DR MLK
Sbjct  69   SAVQSSTNLDFASHHQ----IDINNSGGTQEFPPCNISLSEYTPCQDRDRGRRYDRNMLK  124

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP+KEE L C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G
Sbjct  125  YRERHCPSKEEQLYCLIPAPPKYKPPFKWPQSRDYAWYNNIPHKELSIEKAIQNWIQVEG  184

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
            +RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +S
Sbjct  185  DRFRFPGGGTMFPRGADAYIDDINELIPLTTGTIRTAIDTGCGVASWGAYLLKRDIIAMS  244

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  245  FAPRDTHEAQVQFALERGVP  264



>ref|XP_007143370.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
 gb|ESW15364.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
Length=598

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +1

Query  100  AKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVR  279
            ++ FP C A  SEYTPCQD +RSL + R  + YRERHCP  EE LKCR+PAP GYR P  
Sbjct  67   SRTFPRCSANFSEYTPCQDPQRSLGYKRHRMIYRERHCP--EEPLKCRVPAPHGYRNPFP  124

Query  280  WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLIN  459
            WP SRD  W+ANVPH+ LTVEKA QNW+RF+GERF FPGGGT FP GADAYI+DIG+LIN
Sbjct  125  WPASRDRAWFANVPHRELTVEKAVQNWIRFEGERFVFPGGGTTFPNGADAYIEDIGKLIN  184

Query  460  LKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            L+DGSIRTA+DTGCGVASWGAYLLSR+I  LS AP+DTHEAQVQFALER +P
Sbjct  185  LRDGSIRTALDTGCGVASWGAYLLSRNILTLSIAPRDTHEAQVQFALERGVP  236



>ref|XP_006286418.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
 gb|EOA19316.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
Length=637

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+   DL    Q    K   PC   LSEYTPC+D +R  +FDR M+KYRERHCP+
Sbjct  79   LDFKSHNQI-DLKETNQT--IKYLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPS  135

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  136  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  195

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L DG IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  196  GTMFPRGADAYIDDIARLIPLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  255

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  256  AQVQFALERGVP  267



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF +HH  E    V+      EFPPC    S+YTPCQD  RS KFDR M KYRERHCP  
Sbjct  83   DFESHHQIEINSTVS----LHEFPPCDMSYSDYTPCQDPVRSRKFDREMAKYRERHCPKS  138

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            EELL+C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGG
Sbjct  139  EELLRCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGG  198

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            T FP GADAYID+I  LI L  G+IRTA+DTGCGVASWGAYLL RDI  +SFAP+DTHEA
Sbjct  199  TTFPNGADAYIDNINELIPLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFAPRDTHEA  258

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  259  QVQFALERGVP  269



>ref|XP_007210288.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
 gb|EMJ11487.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
Length=636

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 148/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            + LDF +HH  E    + ++   ++FP C    SEYTPCQDT+R  KFDR+MLKYRERHC
Sbjct  85   LHLDFESHHQVE----INKSDAVQKFPACDMAYSEYTPCQDTQRGRKFDRKMLKYRERHC  140

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FP
Sbjct  141  PTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFP  200

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGA AYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL  DI  +SFAP+DT
Sbjct  201  GGGTMFPRGAGAYIDDIDALIPLSKGNIRTAIDTGCGVASWGAYLLRNDILAMSFAPRDT  260

Query  574  HEAQVQFALERXIP  615
            H AQVQFALER +P
Sbjct  261  HAAQVQFALERGVP  274



>ref|XP_002975160.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
 gb|EFJ23945.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
Length=632

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 7/198 (4%)
 Frame = +1

Query  31   AVSLDFAAHHAA--EDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            A SLDF+AHHA   +D  A+        F  C  + SEYTPC+D ERSL+FDR  L YRE
Sbjct  73   ASSLDFSAHHAGGGDDDPALLDL----AFDSCALKFSEYTPCEDIERSLRFDRDRLIYRE  128

Query  205  RHCPAKE-ELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            RHCPA++ E L+C IPAP GYR P  WP+SRD  WYANVPHK LTVEKA QNW++++G+R
Sbjct  129  RHCPAQDSERLRCLIPAPPGYRNPFPWPKSRDFAWYANVPHKELTVEKAVQNWIQYEGDR  188

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFP+GADAYIDDIG+L+ LKDGSIRTA+DTGCGVAS+GA+LLSR++  +SFA
Sbjct  189  FKFPGGGTMFPKGADAYIDDIGKLVPLKDGSIRTALDTGCGVASFGAFLLSRNVLTMSFA  248

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHE QVQFALER +P
Sbjct  249  PRDTHEGQVQFALERGVP  266



>ref|XP_010110846.1| putative methyltransferase PMT18 [Morus notabilis]
 gb|EXC28325.1| putative methyltransferase PMT18 [Morus notabilis]
Length=448

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 149/211 (71%), Gaps = 23/211 (11%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +HH     V ++Q+   ++ PPC   LSEYTPCQ   R  KFDR ML YRERHCPA
Sbjct  77   LDFESHHT----VNISQSEGIRKLPPCDMSLSEYTPCQHPPRGRKFDRNMLMYRERHCPA  132

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEELL C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKA QNW++ +G+RF FPGG
Sbjct  133  KEELLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGG  192

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCG-------------------VASWGA  522
            GTMFPRGADAYIDDI  LI L  G+IRTAIDTGCG                   VASWGA
Sbjct  193  GTMFPRGADAYIDDINELIPLTTGAIRTAIDTGCGNRIANVFALVDHVLAVVGKVASWGA  252

Query  523  YLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            YLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  253  YLLKRNILTMSFAPRDTHEAQVQFALERGVP  283



>ref|XP_002977565.1| hypothetical protein SELMODRAFT_443549 [Selaginella moellendorffii]
 gb|EFJ21569.1| hypothetical protein SELMODRAFT_443549 [Selaginella moellendorffii]
Length=634

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +1

Query  31   AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
            A SLDF+AHHA        QA     F  C  + SEYTPC+D ERSL+FDR  L YRERH
Sbjct  73   ASSLDFSAHHAGGG--DDDQALLDLAFDSCALKFSEYTPCEDIERSLRFDRDRLIYRERH  130

Query  211  CPAK-EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFT  387
            CPA+  E L+C IPAP GYR P  WP+SRD  WYANVPHK LTVEKA QNW++++G+RF 
Sbjct  131  CPAQASERLRCLIPAPPGYRNPFPWPKSRDFAWYANVPHKELTVEKAVQNWIQYEGDRFK  190

Query  388  FPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPK  567
            FPGGGTMFP+GADAYIDDIG+L+ LKDGSIRTA+DTGCGVAS+GA+LLSR++  +SFAP+
Sbjct  191  FPGGGTMFPKGADAYIDDIGKLVPLKDGSIRTALDTGCGVASFGAFLLSRNVLTMSFAPR  250

Query  568  DTHEAQVQFALERXIP  615
            DTHE QVQFALER +P
Sbjct  251  DTHEGQVQFALERGVP  266



>ref|XP_009128712.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 emb|CDY25257.1| BnaA02g21990D [Brassica napus]
Length=620

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T    SS +  LDF +H+  E           K   PC   LSEYTPC+D +R  +FDR 
Sbjct  54   TQSNPSSESADLDFKSHNQFE---FKETNLTIKNLEPCDLSLSEYTPCEDRQRGRRFDRN  110

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
            M+KYRERHCP+K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++
Sbjct  111  MMKYRERHCPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  170

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +G+RF FPGGGTMFPRGADAYIDDI RLI L  G IRTAIDTGCGVAS+GAYLL RDI 
Sbjct  171  VEGDRFRFPGGGTMFPRGADAYIDDIARLIPLTAGGIRTAIDTGCGVASFGAYLLKRDIM  230

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+DTHEAQVQFALER +P
Sbjct  231  AVSFAPRDTHEAQVQFALERGVP  253



>ref|XP_008791705.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=566

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            SSS  +LDF A H   DL   +    A++FPPC +  +EYTPCQD  R  +F+R+ML YR
Sbjct  76   SSSDAALDFEARHRL-DLNETSGT--AEKFPPCPSNFTEYTPCQDRTRGRRFERKMLIYR  132

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP  +EL++C IPAP  Y++P +WP+SRD  W+ N+PHK L++EKA QNWV  +G++
Sbjct  133  ERHCPGNDELIRCLIPAPPNYKMPFKWPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDK  192

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGADAYIDDI  LI L DGSIRTAIDTGCGVAS GAYLL RD+  +SFA
Sbjct  193  FRFPGGGTMFPRGADAYIDDISALIPLTDGSIRTAIDTGCGVASLGAYLLKRDVITMSFA  252

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  253  PRDTHEAQVQFALERGVP  270



>gb|KFK31838.1| hypothetical protein AALP_AA6G165000 [Arabis alpina]
Length=625

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 148/192 (77%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF +H+   D     Q    K F PC   LSEYTPC+D +R  +FDR M+KYRERHCP 
Sbjct  70   LDFKSHNQI-DFKETNQT--IKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPT  126

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            K+ELL C IP P  Y+IP +WP+SRD  WY N+PHK L+VEKA QNW++ +G+RF FPGG
Sbjct  127  KDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGG  186

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFPRGADAYIDDI RLI L +G IRTAIDTGCGVAS+GAYLL RDI  +SFAP+DTHE
Sbjct  187  GTMFPRGADAYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHE  246

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  247  AQVQFALERGVP  258



>ref|XP_009398109.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398110.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398111.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
Length=634

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 146/194 (75%), Gaps = 7/194 (4%)
 Frame = +1

Query  40   LDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            LDF AHH  +  D   V +     +FPPC    SEYTPCQD  R  KF R ML YRERHC
Sbjct  82   LDFQAHHQLSFNDTFMVTE-----KFPPCALNFSEYTPCQDLTRCKKFARAMLAYRERHC  136

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            PA+ EL++C IPAP  Y+ P +WP SRD  WY N+PH+ L++EKA QNW++ +G+RF FP
Sbjct  137  PAQHELIRCLIPAPPKYKTPFKWPRSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFP  196

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGAD YIDDI  L++L DG IRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  197  GGGTMFPRGADVYIDDINALVSLTDGDIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDT  256

Query  574  HEAQVQFALERXIP  615
            HEAQVQFALER +P
Sbjct  257  HEAQVQFALERGVP  270



>ref|XP_010934594.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010934595.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=624

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 158/205 (77%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    TTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKE-FPPCKAELSEYTPCQDTERSLKFD  180
            TT L+SS S  SLDF AHH     V   ++  + E FP C  + SEYTPCQD  R+ KF 
Sbjct  63   TTRLSSSGS--SLDFQAHHQ----VGFNESSLSTEKFPSCDLKFSEYTPCQDPRRARKFV  116

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            + ML+YRERHCP K+ELL+C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW
Sbjct  117  KVMLRYRERHCPQKKELLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHRELSIEKAVQNW  176

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++ +G RF FPGGGTMFPRGAD+YIDDI  LI L +G+IRTAID+GCGVASWGAYLL+R+
Sbjct  177  IQVEGNRFRFPGGGTMFPRGADSYIDDINALIPLTNGNIRTAIDSGCGVASWGAYLLNRN  236

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+D+HEAQVQFALER +P
Sbjct  237  ILTMSFAPRDSHEAQVQFALERGVP  261



>gb|KDO43765.1| hypothetical protein CISIN_1g038698mg, partial [Citrus sinensis]
Length=283

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            L F  HH   ++V  ++ P AK F PC  + S+YTPCQ+ +R++KF R  + YRERHCP 
Sbjct  60   LSFETHHNDVEIVEPSE-PKAKVFKPCDVKYSDYTPCQEQDRAMKFPRENMTYRERHCPP  118

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            ++E L C IPAP GY  P  WP+ RD V YANVPHK LTVEKA QNWV+F+G  F FPGG
Sbjct  119  EDEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPHKSLTVEKAVQNWVQFQGNVFKFPGG  178

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP+GADAYID++  +I +KDGS+RTA+DTGCGVASWGAYLL R++  +SFAP+D HE
Sbjct  179  GTMFPQGADAYIDELASVIPIKDGSVRTALDTGCGVASWGAYLLKRNVLTMSFAPRDNHE  238

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  239  AQVQFALERGVP  250



>gb|AFW63361.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
 gb|AFW63362.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=352

 Score =   262 bits (670),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = +1

Query  94   PPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRI  270
            P    +P C A  SEYTPC+D ERSL+F R  L YRERHCPA E E L+C +PAP GYR 
Sbjct  111  PRRSSYPACPARYSEYTPCEDVERSLRFPRDRLVYRERHCPASERERLRCLVPAPPGYRT  170

Query  271  PVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGR  450
            P  WP SRD  W+AN PHK LTVEKA QNW+R  G+R  FPGGGTMFP GADAYIDDI +
Sbjct  171  PFPWPASRDVAWFANAPHKELTVEKAVQNWIRVDGDRLRFPGGGTMFPNGADAYIDDIAK  230

Query  451  LINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            L+ L DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  231  LVPLHDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  285



>ref|XP_009360254.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009360255.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=632

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 146/194 (75%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            + LDF +HH     V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHC
Sbjct  81   LHLDFESHHQ----VDINKTEAVQKFPPCDMSYSEYTPCQDATRGRKFDRSMLKYRERHC  136

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +GERF FP
Sbjct  137  PTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGERFRFP  196

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYID++  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  197  GGGTGFPRGADAYIDEMNALIPLTKGNIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDT  256

Query  574  HEAQVQFALERXIP  615
            H AQVQFALER +P
Sbjct  257  HAAQVQFALERGVP  270



>ref|XP_008356816.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=644

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    DTTNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFD  180
            + T+ + SSS++ LDF +HH A+    + +    ++FPPC    SEYTPCQD  R  KF+
Sbjct  68   NKTSSSMSSSSLHLDFESHHQAD----INKTKAVQKFPPCDMSYSEYTPCQDPTRGNKFN  123

Query  181  RRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNW  360
            R M K RERHCP +EE L C IPAP  Y+IP +WP SRD  WY N+PH+ L++EKAGQNW
Sbjct  124  RNMWKNRERHCPTQEEQLFCLIPAPPKYKIPFKWPRSRDFAWYDNIPHRELSIEKAGQNW  183

Query  361  VRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRD  540
            ++  G+RF FPGGGTMF RGADAYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL RD
Sbjct  184  IQVMGDRFRFPGGGTMFRRGADAYIDDINALIPLTKGNIRTAIDTGCGVASWGAYLLKRD  243

Query  541  IFPLSFAPKDTHEAQVQFALERXIP  615
            I  +SFAP+DTHEAQVQFALER +P
Sbjct  244  IVTMSFAPRDTHEAQVQFALERGVP  268



>tpg|DAA36414.1| TPA: hypothetical protein ZEAMMB73_585119 [Zea mays]
Length=651

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 155/216 (72%), Gaps = 14/216 (6%)
 Frame = +1

Query  7    TNLTSSSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            T  +SS  A  LDFAAHH AE  V    A   + +  C A+ SEYTPC+D ERSL+F R 
Sbjct  74   TTASSSPPAGPLDFAAHHTAEG-VEAEGALRHRNYEACPAKYSEYTPCEDVERSLRFPRD  132

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
             L YRERHCPA  E L+C +PAP GYR P  WP SRD  W+ANVPHK L+VEKA QNW+R
Sbjct  133  RLVYRERHCPAAGERLRCLVPAPKGYRNPFPWPASRDVAWFANVPHKELSVEKAVQNWIR  192

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCG-------------V  507
              G++F FPGGGTMFPRGA AYIDDIG+LI L DGSIRTA+DTGCG             V
Sbjct  193  VDGDKFRFPGGGTMFPRGAGAYIDDIGKLIPLHDGSIRTALDTGCGQYPMHSKSNFSENV  252

Query  508  ASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            ASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  253  ASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  288



>ref|XP_010933740.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=632

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            SSS   LDF A H  +    +A     ++F PC    SEYTPCQD  R  +F+R ML YR
Sbjct  75   SSSNAGLDFEARHQLDLNETLATV---EKFQPCALNFSEYTPCQDRTRGRRFEREMLIYR  131

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP K+EL++C IPAP  Y+ P +WP+SRD  W+ N+PHK L++EKA QNWV  +G+R
Sbjct  132  ERHCPEKDELIRCLIPAPPNYKTPFKWPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDR  191

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGADAYIDDI  LI+L DGSIRTAIDTGCGVAS+GAYLL RD+  +SFA
Sbjct  192  FRFPGGGTMFPRGADAYIDDINALISLTDGSIRTAIDTGCGVASFGAYLLKRDVITMSFA  251

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  252  PRDTHEAQVQFALERGVP  269



>ref|XP_008796868.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
 ref|XP_008796869.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=632

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYR  201
            SSS  +LDF A H   DL   A     ++F PC    SEYTPCQD  R  +F+R ML YR
Sbjct  75   SSSNAALDFEARHRP-DLDETAAT--VEKFHPCPLNFSEYTPCQDRTRGRRFEREMLIYR  131

Query  202  ERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGER  381
            ERHCP KEEL++C IPAP  Y+ P +WP+SRD  W+ N+PHK L++EKA QNWV  +G+R
Sbjct  132  ERHCPGKEELIRCLIPAPPNYKTPFKWPQSRDYAWFDNIPHKELSIEKAVQNWVIVEGDR  191

Query  382  FTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFA  561
            F FPGGGTMFPRGADAYIDDI  L++L DGSIRTAIDTGCGVAS+GAYLL RD+  +SFA
Sbjct  192  FRFPGGGTMFPRGADAYIDDINALLSLTDGSIRTAIDTGCGVASFGAYLLKRDVITMSFA  251

Query  562  PKDTHEAQVQFALERXIP  615
            P+DTHEAQVQFALER +P
Sbjct  252  PRDTHEAQVQFALERGVP  269



>gb|KJB18849.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18850.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18851.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18852.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18853.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18857.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=528

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  130  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  309
             SEYTPCQD  R  KFDR MLKYRERHCPAKEELL+C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYTPCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWY  62

Query  310  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  489
            +N+PH+ L++EKA QNW++ +G RF FPGGGTMFPRGADAYIDDIGRLI L DG+IRTAI
Sbjct  63   SNIPHRELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAI  122

Query  490  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            DTGCGVAS+GAYLL+R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  123  DTGCGVASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVP  164



>ref|XP_006655679.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Oryza 
brachyantha]
Length=626

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 153/203 (75%), Gaps = 9/203 (4%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAA---EDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            +++SS   LDF AHH     E  + V      ++ PPC+ + SEYTPCQD  R+ KF + 
Sbjct  67   STNSSGTRLDFQAHHQVSFNESSLVV------EKIPPCQLKYSEYTPCQDPRRARKFPKT  120

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
            M++YRERHCP KEEL +C IPAP  YR P +WP SRD  WY N+PH+ L++EKA QNW++
Sbjct  121  MMQYRERHCPRKEELFRCLIPAPPKYRNPFKWPLSRDYAWYNNIPHRELSIEKAVQNWIQ  180

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +G+RF FPGGGTMFP GADAYIDDI  LI L DG+IRTA+DTGCGVASWGAYL+ RDI 
Sbjct  181  VEGKRFRFPGGGTMFPHGADAYIDDINALIPLTDGNIRTALDTGCGVASWGAYLIKRDII  240

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+D+HEAQVQFALER +P
Sbjct  241  TMSFAPRDSHEAQVQFALERGVP  263



>ref|XP_008375441.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008375442.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=632

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 146/194 (75%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            + LDF +HH     V + +    ++FPPC    SEYTPCQD  R  KFDR MLKYRERHC
Sbjct  81   LHLDFESHHQ----VDINKTEAVQKFPPCDMSYSEYTPCQDATRGRKFDRSMLKYRERHC  136

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FP
Sbjct  137  PTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFP  196

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGT FPRGADAYID++  LI L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP+DT
Sbjct  197  GGGTGFPRGADAYIDEMNALIPLTKGNIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDT  256

Query  574  HEAQVQFALERXIP  615
            H AQVQFALER +P
Sbjct  257  HAAQVQFALERGVP  270



>ref|XP_003574187.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234900.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234901.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234902.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAE--DLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S+S   LDF AHH     D  AV Q     +FP C    SEYTPC+D +R  +F+R ML 
Sbjct  75   SASETVLDFDAHHQLNLTDTEAVVQ-----QFPACSLNFSEYTPCEDRKRGRRFEREMLA  129

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E ++C IPAP  Y+ P +WP+SRD  W+ N+PHK L++EKA QNW++ +G
Sbjct  130  YRERHCPGKDEEIQCLIPAPPKYKNPFKWPQSRDFAWFDNIPHKELSIEKAVQNWIQVEG  189

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
             +F FPGGGTMFP GADAYIDDI +LI+L DG IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  190  NKFRFPGGGTMFPHGADAYIDDIAKLISLSDGKIRTAIDTGCGVASWGAYLLKRNIIAMS  249

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  250  FAPRDTHEAQVQFALERGVP  269



>ref|XP_002452759.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
 gb|EES05735.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
Length=666

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 156/210 (74%), Gaps = 11/210 (5%)
 Frame = +1

Query  19   SSSSAVSLDFAAHHAAEDLVAVAQAPPA----------KEFPPCKAELSEYTPCQDTERS  168
            S +++ SLDF+  HAA   +  A    +          + +P C A+ SEYTPC+D ERS
Sbjct  90   SRTTSPSLDFSVRHAAAIALDDADGTASPGASSSSATPRRYPACAAKYSEYTPCEDVERS  149

Query  169  LKFDRRMLKYRERHCPAKE-ELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEK  345
            L+F R  L YRERHCPA E E+L+C +PAP GYR P  WP SRD  W+ANVPHK LTVEK
Sbjct  150  LRFPRDRLVYRERHCPASEREVLRCLVPAPAGYRTPFPWPASRDVAWFANVPHKELTVEK  209

Query  346  AGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAY  525
            A QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI L DGSIRTA+DTGCGVASWGAY
Sbjct  210  AVQNWIRVDGDKLRFPGGGTMFPNGADAYIDDIGKLIPLHDGSIRTALDTGCGVASWGAY  269

Query  526  LLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            LLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  270  LLSRDILAMSFAPRDSHEAQVQFALERGVP  299



>ref|XP_006655678.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Oryza 
brachyantha]
Length=640

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 153/203 (75%), Gaps = 9/203 (4%)
 Frame = +1

Query  16   TSSSSAVSLDFAAHHAA---EDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRR  186
            +++SS   LDF AHH     E  + V      ++ PPC+ + SEYTPCQD  R+ KF + 
Sbjct  81   STNSSGTRLDFQAHHQVSFNESSLVV------EKIPPCQLKYSEYTPCQDPRRARKFPKT  134

Query  187  MLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVR  366
            M++YRERHCP KEEL +C IPAP  YR P +WP SRD  WY N+PH+ L++EKA QNW++
Sbjct  135  MMQYRERHCPRKEELFRCLIPAPPKYRNPFKWPLSRDYAWYNNIPHRELSIEKAVQNWIQ  194

Query  367  FKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIF  546
             +G+RF FPGGGTMFP GADAYIDDI  LI L DG+IRTA+DTGCGVASWGAYL+ RDI 
Sbjct  195  VEGKRFRFPGGGTMFPHGADAYIDDINALIPLTDGNIRTALDTGCGVASWGAYLIKRDII  254

Query  547  PLSFAPKDTHEAQVQFALERXIP  615
             +SFAP+D+HEAQVQFALER +P
Sbjct  255  TMSFAPRDSHEAQVQFALERGVP  277



>ref|XP_010234899.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Brachypodium 
distachyon]
Length=662

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 7/200 (4%)
 Frame = +1

Query  22   SSSAVSLDFAAHHAAE--DLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLK  195
            S+S   LDF AHH     D  AV Q     +FP C    SEYTPC+D +R  +F+R ML 
Sbjct  106  SASETVLDFDAHHQLNLTDTEAVVQ-----QFPACSLNFSEYTPCEDRKRGRRFEREMLA  160

Query  196  YRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKG  375
            YRERHCP K+E ++C IPAP  Y+ P +WP+SRD  W+ N+PHK L++EKA QNW++ +G
Sbjct  161  YRERHCPGKDEEIQCLIPAPPKYKNPFKWPQSRDFAWFDNIPHKELSIEKAVQNWIQVEG  220

Query  376  ERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLS  555
             +F FPGGGTMFP GADAYIDDI +LI+L DG IRTAIDTGCGVASWGAYLL R+I  +S
Sbjct  221  NKFRFPGGGTMFPHGADAYIDDIAKLISLSDGKIRTAIDTGCGVASWGAYLLKRNIIAMS  280

Query  556  FAPKDTHEAQVQFALERXIP  615
            FAP+DTHEAQVQFALER +P
Sbjct  281  FAPRDTHEAQVQFALERGVP  300



>ref|XP_004982638.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Setaria 
italica]
Length=638

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   SSAVSLDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
             S   LDF AHH  A  D  A A     ++FP C    SEYTPC+D  R  +FDR ML Y
Sbjct  80   GSGEVLDFDAHHRLAINDTDAGAGL---QQFPACPLNFSEYTPCEDRTRGRRFDRTMLVY  136

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+E ++C IPAP GYR P +WP+SRD  ++ N+PHK L++EKA QNW++ +G+
Sbjct  137  RERHCPGKDEQVRCLIPAPPGYRTPFKWPKSRDYAYFNNIPHKELSIEKAVQNWIQVEGD  196

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            +F FPGGGTMFPRGADAYIDDI +LI+L DG IRTA+DTGCGVASWGAYLL R+I  +SF
Sbjct  197  KFRFPGGGTMFPRGADAYIDDINKLISLSDGQIRTAVDTGCGVASWGAYLLKRNIIAMSF  256

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  257  APRDTHEAQVQFALERGVP  275



>ref|XP_008239284.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
 ref|XP_008239285.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
Length=637

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   VSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHC  213
            + LDF +HH     V + ++   ++FP C    SEYTPCQD +R  KFDR+MLKYRERHC
Sbjct  86   LHLDFESHHQ----VDINKSDAVQKFPACDMAYSEYTPCQDPQRGRKFDRKMLKYRERHC  141

Query  214  PAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFP  393
            P KEE L C IPAP  Y+ P +WP+SRD  WY N+PH+ L++EKA QNW++ +G+RF FP
Sbjct  142  PTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFP  201

Query  394  GGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDT  573
            GGGTMFPRGA AYIDDI  LI L  G+IRTAIDTGCGVASWGAYLL  DI  +SFAP+DT
Sbjct  202  GGGTMFPRGAGAYIDDIDALIPLSKGNIRTAIDTGCGVASWGAYLLRNDILAMSFAPRDT  261

Query  574  HEAQVQFALERXIP  615
            H AQVQFALER +P
Sbjct  262  HAAQVQFALERGVP  275



>ref|XP_004982637.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Setaria 
italica]
Length=642

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   SSAVSLDFAAHH--AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
             S   LDF AHH  A  D  A A     ++FP C    SEYTPC+D  R  +FDR ML Y
Sbjct  84   GSGEVLDFDAHHRLAINDTDAGAGL---QQFPACPLNFSEYTPCEDRTRGRRFDRTMLVY  140

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K+E ++C IPAP GYR P +WP+SRD  ++ N+PHK L++EKA QNW++ +G+
Sbjct  141  RERHCPGKDEQVRCLIPAPPGYRTPFKWPKSRDYAYFNNIPHKELSIEKAVQNWIQVEGD  200

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            +F FPGGGTMFPRGADAYIDDI +LI+L DG IRTA+DTGCGVASWGAYLL R+I  +SF
Sbjct  201  KFRFPGGGTMFPRGADAYIDDINKLISLSDGQIRTAVDTGCGVASWGAYLLKRNIIAMSF  260

Query  559  APKDTHEAQVQFALERXIP  615
            AP+DTHEAQVQFALER +P
Sbjct  261  APRDTHEAQVQFALERGVP  279



>ref|XP_009405347.1| PREDICTED: probable methyltransferase PMT17 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 150/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S+SA  LDF AHH    +  ++A      +FP C  + SEYTPCQD  R+ KF + MLKY
Sbjct  59   SASAAGLDFQAHHPGGFNRTSLATT----DFPACDLKYSEYTPCQDPRRARKFKKMMLKY  114

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELL C IPAP  Y+ P RWP SRD  WY N+PH+ L++EKA QNW++ + +
Sbjct  115  RERHCPKKNELLHCLIPAPPKYKNPFRWPRSRDYAWYDNIPHRELSIEKAVQNWIQVEDD  174

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  L+ L +G IRTA+DTGCGVASWGAYLL+RDI  +SF
Sbjct  175  RFRFPGGGTMFPRGADAYIDDIDALVPLSNGDIRTALDTGCGVASWGAYLLNRDILTMSF  234

Query  559  APKDTHEAQVQFALERXIP  615
            AP+D+HEAQVQFALER +P
Sbjct  235  APRDSHEAQVQFALERGVP  253



>ref|XP_004244735.1| PREDICTED: probable methyltransferase PMT18 [Solanum lycopersicum]
Length=631

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 148/197 (75%), Gaps = 6/197 (3%)
 Frame = +1

Query  31   AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
             V +DF +HH     + V      + FPPC+   SEYTPCQ+ +R  KFDR MLKYRERH
Sbjct  80   VVPMDFESHHQ----LVVNNTKSLENFPPCEMLYSEYTPCQEPQRGRKFDRNMLKYRERH  135

Query  211  CPAKEE--LLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            CP KEE   L+C IPAP  Y+IP +WP+S+D  W+AN+PHK L++EKA QNWV+ +G+R 
Sbjct  136  CPNKEEKEALRCLIPAPPNYKIPFKWPQSKDYAWFANIPHKELSIEKAVQNWVQVEGDRL  195

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GADAYIDDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP
Sbjct  196  RFPGGGTMFPHGADAYIDDISALVPLTTGTIRTAIDTGCGVASWGAYLLRRDIIAMSFAP  255

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQV FALER +P
Sbjct  256  RDTHEAQVWFALERGVP  272



>gb|KHM99867.1| Putative methyltransferase PMT18 [Glycine soja]
Length=527

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  130  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  309
             SEYTPCQD  R  KFDR MLKYRERHCPAKEELL C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYTPCQDPVRGRKFDRNMLKYRERHCPAKEELLNCLIPAPPKYKTPFKWPQSRDYAWY  62

Query  310  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  489
             N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L  G+IRTAI
Sbjct  63   DNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGTIRTAI  122

Query  490  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            DTGCGVASWGAYLL RDI  +SFAP+DTHEAQVQFALER +P
Sbjct  123  DTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  164



>ref|XP_009405339.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=614

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 150/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S+SA  LDF AHH    +  ++A      +FP C  + SEYTPCQD  R+ KF + MLKY
Sbjct  59   SASAAGLDFQAHHPGGFNRTSLA----TTDFPACDLKYSEYTPCQDPRRARKFKKMMLKY  114

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELL C IPAP  Y+ P RWP SRD  WY N+PH+ L++EKA QNW++ + +
Sbjct  115  RERHCPKKNELLHCLIPAPPKYKNPFRWPRSRDYAWYDNIPHRELSIEKAVQNWIQVEDD  174

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  L+ L +G IRTA+DTGCGVASWGAYLL+RDI  +SF
Sbjct  175  RFRFPGGGTMFPRGADAYIDDIDALVPLSNGDIRTALDTGCGVASWGAYLLNRDILTMSF  234

Query  559  APKDTHEAQVQFALERXIP  615
            AP+D+HEAQVQFALER +P
Sbjct  235  APRDSHEAQVQFALERGVP  253



>ref|XP_004964271.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Setaria 
italica]
 ref|XP_004964272.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Setaria 
italica]
Length=620

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            SS   LDF AHH    +V    +   ++FP C+ + SEYTPCQD  R+ KF ++M++YRE
Sbjct  64   SSGARLDFQAHH---QVVFNESSLVLEKFPSCQLKYSEYTPCQDPRRARKFPKKMMQYRE  120

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP KE+LL+C IPAP GY+ P  WP+SRD  WY N+PH+ L++EKA QNW++ +G+  
Sbjct  121  RHCPKKEDLLRCLIPAPQGYKNPFEWPKSRDYAWYNNIPHRELSIEKAVQNWIQVEGDLL  180

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GADAYIDDI  LI L DG+IRTA+DTGCGVASWGAYL+ R+I  +SFAP
Sbjct  181  RFPGGGTMFPHGADAYIDDINALIPLNDGNIRTALDTGCGVASWGAYLMKRNIITMSFAP  240

Query  565  KDTHEAQVQFALERXIP  615
            +D+HEAQVQFALER +P
Sbjct  241  RDSHEAQVQFALERGVP  257



>ref|XP_009405306.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405314.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405323.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405331.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 150/199 (75%), Gaps = 5/199 (3%)
 Frame = +1

Query  22   SSSAVSLDFAAHH-AAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKY  198
            S+SA  LDF AHH    +  ++A      +FP C  + SEYTPCQD  R+ KF + MLKY
Sbjct  59   SASAAGLDFQAHHPGGFNRTSLA----TTDFPACDLKYSEYTPCQDPRRARKFKKMMLKY  114

Query  199  RERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGE  378
            RERHCP K ELL C IPAP  Y+ P RWP SRD  WY N+PH+ L++EKA QNW++ + +
Sbjct  115  RERHCPKKNELLHCLIPAPPKYKNPFRWPRSRDYAWYDNIPHRELSIEKAVQNWIQVEDD  174

Query  379  RFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSF  558
            RF FPGGGTMFPRGADAYIDDI  L+ L +G IRTA+DTGCGVASWGAYLL+RDI  +SF
Sbjct  175  RFRFPGGGTMFPRGADAYIDDIDALVPLSNGDIRTALDTGCGVASWGAYLLNRDILTMSF  234

Query  559  APKDTHEAQVQFALERXIP  615
            AP+D+HEAQVQFALER +P
Sbjct  235  APRDSHEAQVQFALERGVP  253



>ref|XP_003555372.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=600

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 148/197 (75%), Gaps = 10/197 (5%)
 Frame = +1

Query  25   SSAVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRE  204
            ++A+SL    +H +        A  +K FP C A  SEYTPC D +RSL++ R    Y+E
Sbjct  48   TTALSLSAPCNHFS--------AESSKTFPRCSANFSEYTPCHDPQRSLRYKRSRKIYKE  99

Query  205  RHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            RHCP  EE LKCR+PAP GYR P  WP SRD  W+ANVPH+ LTVEKA QNW+R  G+RF
Sbjct  100  RHCP--EEPLKCRVPAPHGYRNPFPWPASRDRAWFANVPHRELTVEKAVQNWIRSDGDRF  157

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGT FP GADAYI+DIG LINLKDGSIRTA+DTGCGVASWGAYLLSR+I  LS AP
Sbjct  158  VFPGGGTTFPNGADAYIEDIGMLINLKDGSIRTALDTGCGVASWGAYLLSRNILTLSIAP  217

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQVQFALER +P
Sbjct  218  RDTHEAQVQFALERGVP  234



>ref|XP_006352227.1| PREDICTED: probable methyltransferase PMT18-like [Solanum tuberosum]
Length=624

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = +1

Query  31   AVSLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERH  210
             V +DF +HH     + V      + F PC+   SEYTPCQ+ +R  KFDR MLKYRERH
Sbjct  73   VVPMDFESHHQ----LVVNNTKSLENFSPCEMLYSEYTPCQEPQRGRKFDRNMLKYRERH  128

Query  211  CPAKEE--LLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERF  384
            CP KEE   L+C IPAP  Y+IP +WP+SRD  W+AN+PHK L++EKA QNWV+ +G+R 
Sbjct  129  CPNKEEKEALRCLIPAPPNYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRL  188

Query  385  TFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAP  564
             FPGGGTMFP GADAYIDDI  L+ L  G+IRTAIDTGCGVASWGAYLL RDI  +SFAP
Sbjct  189  RFPGGGTMFPHGADAYIDDISELVPLTSGTIRTAIDTGCGVASWGAYLLKRDIIAMSFAP  248

Query  565  KDTHEAQVQFALERXIP  615
            +DTHEAQV FALER +P
Sbjct  249  RDTHEAQVWFALERGVP  265



>gb|EEE61530.1| hypothetical protein OsJ_15834 [Oryza sativa Japonica Group]
Length=529

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  76   VAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAP  255
            + VA     + +  C A+ SEYTPC+D ERSL+F R  L YRERHCP++ E L+C +PAP
Sbjct  1    MEVASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPSEGERLRCLVPAP  60

Query  256  FGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYI  435
             GYR P  WP SRD  W+ANVPHK LTVEKA QNW+R +GE+F FPGGGTMFP GA AYI
Sbjct  61   QGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWIRVEGEKFRFPGGGTMFPHGAGAYI  120

Query  436  DDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            DDIG++I L DGSIRTA+DTGCGVASWGAYLLSR+I  +SFAP+D+HEAQVQFALER +P
Sbjct  121  DDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVP  180



>ref|XP_002298987.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE83792.1| dehydration-responsive family protein [Populus trichocarpa]
Length=529

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +1

Query  130  LSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWY  309
             SEY PCQDT+R  KFDR MLKYRERHCP K+ELL C IPAP  Y+ P +WP+SRD  WY
Sbjct  3    FSEYAPCQDTQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWY  62

Query  310  ANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAI  489
             N+PHK L++EKA QNW++ +G+RF FPGGGTMFPRGADAYIDDI  LI L DGSIRTAI
Sbjct  63   DNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTDGSIRTAI  122

Query  490  DTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            DTGCGVASWGAYLL RDI  +SFAP+DTHEAQV FALER +P
Sbjct  123  DTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVP  164



>emb|CDM86771.1| unnamed protein product [Triticum aestivum]
Length=641

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  109  FPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPE  288
            +P C AE SEYTPC+D +RSL++ R  L YRERHCP+  E L+C +PAP GYR P  WP 
Sbjct  112  YPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPWPA  171

Query  289  SRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKD  468
            SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI L D
Sbjct  172  SRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPLHD  231

Query  469  GSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            GSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  232  GSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  280



>ref|XP_002466953.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
 gb|EER93951.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
Length=637

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = +1

Query  4    TTNLTSSSSAV---------SLDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQD  156
            T + T SS +V          LDF AHH    +         ++FP C    SEYTPC+D
Sbjct  64   TASTTQSSGSVPSFGPGSGEVLDFDAHHRLT-INNTDGDGELQQFPACPLNFSEYTPCED  122

Query  157  TERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLT  336
             +R  +FDR ML YRERHCP K+E ++C IPAP GYR P +WP SRD  ++ N+PHK L+
Sbjct  123  RKRGRRFDRAMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPHSRDYAYFNNIPHKELS  182

Query  337  VEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASW  516
            +EKA QNW++ +G++F FPGGGTMFPRGADAYIDDI +LI+L DG IRTA+DTGCGVASW
Sbjct  183  IEKAVQNWIQVEGDKFKFPGGGTMFPRGADAYIDDIDKLISLSDGKIRTAVDTGCGVASW  242

Query  517  GAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
            GAYLL R+I  +SFAP+DTHEAQVQFALER +P
Sbjct  243  GAYLLKRNIIAMSFAPRDTHEAQVQFALERGVP  275



>ref|XP_006476235.1| PREDICTED: probable methyltransferase PMT18-like [Citrus sinensis]
Length=629

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF +HH  E    +       EFPPC    S+ TPCQD  RS KFDR M KYRERHCP  
Sbjct  83   DFESHHQIE----INSTVSLHEFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKS  138

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            EELL+C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGG
Sbjct  139  EELLRCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGG  198

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            T FP GADAYID+I  LI L  G+IRTA+DTGCGVASWGAYLL RDI  +SFA +DTHEA
Sbjct  199  TTFPNGADAYIDNINELIPLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEA  258

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  259  QVQFALERGVP  269



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +1

Query  43   DFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAK  222
            DF +HH  E    +       EFPPC    S+ TPCQD  RS KFDR M KYRERHCP  
Sbjct  83   DFESHHQIE----INSTVSLHEFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKS  138

Query  223  EELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGG  402
            EELL+C IPAP  Y+ P +WP+SRD  WY N+PHK L++EKAGQNW++ +G RF FPGGG
Sbjct  139  EELLRCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGG  198

Query  403  TMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEA  582
            T FP GADAYID+I  LI L  G+IRTA+DTGCGVASWGAYLL RDI  +SFA +DTHEA
Sbjct  199  TTFPNGADAYIDNINELIPLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEA  258

Query  583  QVQFALERXIP  615
            QVQFALER +P
Sbjct  259  QVQFALERGVP  269



>ref|NP_001056546.2| Os06g0103900 [Oryza sativa Japonica Group]
 dbj|BAD67956.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 gb|EEE64943.1| hypothetical protein OsJ_19817 [Oryza sativa Japonica Group]
 dbj|BAF18460.2| Os06g0103900 [Oryza sativa Japonica Group]
Length=631

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH    +     +  A++FPPC+ + SEYTPCQD  R+ KF + M++YRERHCP 
Sbjct  80   LDFQAHH---QVSFNESSLVAEKFPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPR  136

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEEL +C IPAP  Y+ P +WP+ RD  WY N+PH+ L++EKA QNW++ +G+RF FPGG
Sbjct  137  KEELFRCLIPAPPKYKNPFKWPQCRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGG  196

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDI  LI+L DG+IRTA+DTGCGVASWGAYL+ R+I  +SFAP+D+HE
Sbjct  197  GTMFPHGADAYIDDINALISLTDGNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHE  256

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  257  AQVQFALERGVP  268



>gb|EEC79826.1| hypothetical protein OsI_21282 [Oryza sativa Indica Group]
Length=631

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  40   LDFAAHHAAEDLVAVAQAPPAKEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPA  219
            LDF AHH    +     +  A++FPPC+ + SEYTPCQD  R+ KF + M++YRERHCP 
Sbjct  80   LDFQAHH---QVSFNESSLVAEKFPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPR  136

Query  220  KEELLKCRIPAPFGYRIPVRWPESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGG  399
            KEEL +C IPAP  Y+ P +WP+ RD  WY N+PH+ L++EKA QNW++ +G+RF FPGG
Sbjct  137  KEELFRCLIPAPPKYKNPFKWPQCRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGG  196

Query  400  GTMFPRGADAYIDDIGRLINLKDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHE  579
            GTMFP GADAYIDDI  LI+L DG+IRTA+DTGCGVASWGAYL+ R+I  +SFAP+D+HE
Sbjct  197  GTMFPHGADAYIDDINALISLTDGNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHE  256

Query  580  AQVQFALERXIP  615
            AQVQFALER +P
Sbjct  257  AQVQFALERGVP  268



>dbj|BAJ98046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  103  KEFPPCKAELSEYTPCQDTERSLKFDRRMLKYRERHCPAKEELLKCRIPAPFGYRIPVRW  282
            + +P C AE SEYTPC+D +RSL++ R  L YRERHCP+  E L+C +PAP GYR P  W
Sbjct  112  RRYPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPW  171

Query  283  PESRDSVWYANVPHKHLTVEKAGQNWVRFKGERFTFPGGGTMFPRGADAYIDDIGRLINL  462
            P SRD  W+ANVPHK LTVEKA QNW+R  G++  FPGGGTMFP GADAYIDDIG+LI L
Sbjct  172  PASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPL  231

Query  463  KDGSIRTAIDTGCGVASWGAYLLSRDIFPLSFAPKDTHEAQVQFALERXIP  615
             DGSIRTA+DTGCGVASWGAYLLSRDI  +SFAP+D+HEAQVQFALER +P
Sbjct  232  HDGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVP  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520