BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS106B11

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    213   7e-61   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    211   4e-60   Nicotiana tomentosiformis
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    205   8e-58   Solanum lycopersicum
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    204   9e-58   Vitis vinifera
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    202   6e-57   Solanum tuberosum [potatoes]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    196   1e-54   Solanum tuberosum [potatoes]
emb|CAN61355.1|  hypothetical protein VITISV_027762                     193   5e-54   Vitis vinifera
gb|KJB62955.1|  hypothetical protein B456_009G445400                    194   5e-54   Gossypium raimondii
ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    188   5e-54   Nicotiana sylvestris
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    189   4e-52   Gossypium arboreum [tree cotton]
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    188   5e-52   Solanum lycopersicum
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   183   5e-51   Citrus sinensis [apfelsine]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                185   7e-51   Erythranthe guttata [common monkey flower]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   184   9e-51   Citrus sinensis [apfelsine]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   184   1e-50   Citrus sinensis [apfelsine]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             184   1e-50   Citrus clementina [clementine]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    184   2e-50   Citrus sinensis [apfelsine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   184   2e-50   Citrus sinensis [apfelsine]
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    183   4e-50   Gossypium arboreum [tree cotton]
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    182   1e-49   Cucumis melo [Oriental melon]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    181   1e-49   Sesamum indicum [beniseed]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    180   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    179   1e-48   Sesamum indicum [beniseed]
emb|CDP13760.1|  unnamed protein product                                179   1e-48   Coffea canephora [robusta coffee]
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    176   2e-48   
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    178   3e-48   Ricinus communis
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    178   3e-48   
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    177   4e-48   Populus euphratica
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    177   4e-48   
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    177   5e-48   
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    173   2e-47   
gb|KJB13800.1|  hypothetical protein B456_002G094900                    175   2e-47   Gossypium raimondii
gb|KJB13801.1|  hypothetical protein B456_002G094900                    175   3e-47   Gossypium raimondii
gb|KJB13799.1|  hypothetical protein B456_002G094900                    175   3e-47   Gossypium raimondii
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    174   4e-47   Populus euphratica
ref|XP_002867546.1|  MRH5/SHV3                                          174   5e-47   
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    174   5e-47   Populus euphratica
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    174   5e-47   Brassica rapa
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             174   6e-47   Eutrema salsugineum [saltwater cress]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    174   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    171   5e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       171   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    171   6e-46   
gb|AAL07129.1|  unknown protein                                         171   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    171   7e-46   Brassica rapa
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    171   8e-46   Tarenaya hassleriana [spider flower]
emb|CDY61647.1|  BnaCnng38120D                                          171   1e-45   Brassica napus [oilseed rape]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             171   1e-45   Populus trichocarpa [western balsam poplar]
emb|CDX94294.1|  BnaC01g18900D                                          170   1e-45   
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    170   1e-45   Prunus mume [ume]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         170   2e-45   Jatropha curcas
emb|CDY46687.1|  BnaA03g48210D                                          169   3e-45   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    169   4e-45   Brassica rapa
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    169   4e-45   
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    168   4e-45   
emb|CDY14478.1|  BnaC03g21170D                                          171   5e-45   Brassica napus [oilseed rape]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    169   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    169   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             168   8e-45   
emb|CDX92806.1|  BnaC07g40640D                                          168   9e-45   
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    168   1e-44   Glycine soja [wild soybean]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    168   1e-44   Glycine max [soybeans]
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    167   2e-44   Arabis alpina [alpine rockcress]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   169   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAF98210.1|AC007152_6  Unknown protein                               169   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             167   3e-44   Capsella rubella
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             166   4e-44   Eutrema salsugineum [saltwater cress]
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    165   4e-44   
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    166   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    166   5e-44   Brassica rapa
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    166   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             166   7e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    165   1e-43   Camelina sativa [gold-of-pleasure]
gb|AAP40466.1|  unknown protein                                         165   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    165   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             164   1e-43   Phaseolus vulgaris [French bean]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             164   2e-43   Prunus persica
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    164   2e-43   Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                          164   2e-43   
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    164   2e-43   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY13237.1|  BnaC09g24190D                                          164   2e-43   Brassica napus [oilseed rape]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    166   3e-43   Brassica rapa
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    163   5e-43   Camelina sativa [gold-of-pleasure]
emb|CDY71959.1|  BnaCnng75290D                                          158   6e-43   Brassica napus [oilseed rape]
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    161   2e-42   Medicago truncatula
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    162   2e-42   Cucumis sativus [cucumbers]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    161   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    162   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    161   2e-42   
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              161   3e-42   
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    161   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             161   4e-42   Capsella rubella
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             160   5e-42   
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    160   5e-42   Brassica rapa
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             160   5e-42   
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             160   6e-42   Phaseolus vulgaris [French bean]
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             160   6e-42   
emb|CDY36746.1|  BnaA03g11400D                                          160   7e-42   Brassica napus [oilseed rape]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    160   8e-42   Arabis alpina [alpine rockcress]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    159   8e-42   Glycine max [soybeans]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    159   9e-42   Glycine soja [wild soybean]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    160   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    160   1e-41   Fragaria vesca subsp. vesca
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             159   1e-41   
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    159   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    159   1e-41   Camelina sativa [gold-of-pleasure]
gb|AFW58563.1|  hypothetical protein ZEAMMB73_741781                    150   2e-41   
ref|XP_010470590.1|  PREDICTED: glycerophosphodiester phosphodies...    148   2e-41   
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             159   2e-41   Capsella rubella
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    158   2e-41   Glycine soja [wild soybean]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                158   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002888566.1|  kinase family protein                              160   3e-41   
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    160   4e-41   
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    158   5e-41   Brassica rapa
emb|CDX92782.1|  BnaC07g40400D                                          159   6e-41   
emb|CDY17323.1|  BnaA10g09570D                                          157   8e-41   Brassica napus [oilseed rape]
emb|CDY46667.1|  BnaA03g48410D                                          159   8e-41   Brassica napus [oilseed rape]
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    155   2e-40   
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             156   2e-40   Phaseolus vulgaris [French bean]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    155   3e-40   
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    157   3e-40   
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    155   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    152   5e-40   Pyrus x bretschneideri [bai li]
emb|CDY60410.1|  BnaC02g45300D                                          144   5e-40   Brassica napus [oilseed rape]
emb|CDY12600.1|  BnaA02g12680D                                          155   7e-40   Brassica napus [oilseed rape]
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    153   1e-39   Cicer arietinum [garbanzo]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    155   1e-39   
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    153   3e-39   Glycine soja [wild soybean]
emb|CDY11996.1|  BnaC03g14220D                                          153   3e-39   Brassica napus [oilseed rape]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    153   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    152   3e-39   Glycine max [soybeans]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    152   4e-39   Pyrus x bretschneideri [bai li]
emb|CDY12601.1|  BnaA02g12690D                                          142   4e-39   Brassica napus [oilseed rape]
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    150   4e-39   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    152   7e-39   
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    152   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    152   7e-39   Glycine max [soybeans]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    152   8e-39   Glycine soja [wild soybean]
ref|XP_009127509.1|  PREDICTED: probable glycerophosphoryl dieste...    141   8e-39   Brassica rapa
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    151   9e-39   Triticum urartu
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    151   1e-38   
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    150   1e-38   
dbj|BAJ87963.1|  predicted protein                                      151   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85772.1|  predicted protein                                      151   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    151   2e-38   
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    151   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    151   2e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     150   2e-38   Zea mays [maize]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    150   3e-38   Setaria italica
emb|CAH67272.1|  B0806H07.1                                             150   3e-38   Oryza sativa [red rice]
ref|NP_001053060.1|  Os04g0472300                                       150   3e-38   
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    150   3e-38   Elaeis guineensis
ref|XP_010422831.1|  PREDICTED: glycerophosphodiester phosphodies...    140   4e-38   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    149   5e-38   
ref|NP_001142429.1|  uncharacterized protein LOC100274608               145   7e-38   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    150   8e-38   
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    149   9e-38   Oryza brachyantha
emb|CDY60415.1|  BnaC02g45340D                                          149   2e-37   Brassica napus [oilseed rape]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    148   2e-37   Glycine soja [wild soybean]
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          147   3e-37   Sorghum bicolor [broomcorn]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             147   3e-37   Phaseolus vulgaris [French bean]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    147   3e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    147   4e-37   
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    147   5e-37   Phoenix dactylifera
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479              142   8e-37   
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    146   9e-37   Elaeis guineensis
gb|AAV64200.1|  unknown                                                 142   1e-36   Zea mays [maize]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    145   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    142   2e-36   
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    145   2e-36   Triticum urartu
gb|AAV64238.1|  unknown                                                 141   3e-36   Zea mays [maize]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    143   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    143   1e-35   Cicer arietinum [garbanzo]
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    143   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    142   1e-35   Setaria italica
emb|CBI18678.3|  unnamed protein product                                142   2e-35   Vitis vinifera
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    142   2e-35   Vitis vinifera
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    142   3e-35   Elaeis guineensis
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    142   3e-35   Setaria italica
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    142   4e-35   Phoenix dactylifera
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    141   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047275.1|  Os02g0588500                                       140   8e-35   
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    140   9e-35   
gb|EAY86479.1|  hypothetical protein OsI_07859                          140   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    139   4e-34   Phoenix dactylifera
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    138   5e-34   
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    137   5e-34   Medicago truncatula
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    138   6e-34   
dbj|BAD17454.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    129   6e-34   Oryza sativa Japonica Group [Japonica rice]
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     138   6e-34   Eucalyptus grandis [rose gum]
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              137   9e-34   Medicago truncatula
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    138   2e-33   Setaria italica
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    135   3e-33   Glycine max [soybeans]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    135   5e-33   Cicer arietinum [garbanzo]
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          135   6e-33   Amborella trichopoda
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          135   8e-33   Amborella trichopoda
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    135   8e-33   Glycine max [soybeans]
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    135   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    134   1e-32   
ref|NP_001169682.1|  hypothetical protein precursor                     134   2e-32   Zea mays [maize]
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            132   2e-32   Phaseolus vulgaris [French bean]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    132   3e-32   
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             133   3e-32   Phaseolus vulgaris [French bean]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          133   3e-32   Sorghum bicolor [broomcorn]
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          134   3e-32   
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    133   4e-32   Elaeis guineensis
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    133   5e-32   Populus euphratica
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             132   6e-32   Phaseolus vulgaris [French bean]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             132   6e-32   
ref|XP_010474169.1|  PREDICTED: glycerophosphodiester phosphodies...    129   6e-32   
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    132   8e-32   Phoenix dactylifera
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    131   1e-31   
emb|CDY19634.1|  BnaA05g20420D                                          131   2e-31   Brassica napus [oilseed rape]
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    131   2e-31   Brassica rapa
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    131   2e-31   Morus notabilis
ref|NP_001062173.1|  Os08g0503200                                       130   3e-31   
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943              129   3e-31   
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    130   3e-31   Fragaria vesca subsp. vesca
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                    127   4e-31   
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...    124   6e-31   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    129   6e-31   Nelumbo nucifera [Indian lotus]
ref|NP_001170117.1|  hypothetical protein                               129   7e-31   Zea mays [maize]
dbj|BAJ93663.1|  predicted protein                                      129   8e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    129   9e-31   
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             128   1e-30   Capsella rubella
emb|CDY36036.1|  BnaC03g41620D                                          129   2e-30   Brassica napus [oilseed rape]
ref|XP_004506009.1|  PREDICTED: uncharacterized protein LOC101491157    125   2e-30   
emb|CDY11831.1|  BnaC03g12570D                                          127   2e-30   Brassica napus [oilseed rape]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    128   2e-30   Zea mays [maize]
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    128   3e-30   Zea mays [maize]
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    127   3e-30   Populus euphratica
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    127   4e-30   
gb|AAO42211.1|  unknown protein                                         127   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    127   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    127   7e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    127   7e-30   Phoenix dactylifera
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             126   9e-30   
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    126   1e-29   Camelina sativa [gold-of-pleasure]
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    127   2e-29   Triticum urartu
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    125   2e-29   
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    125   2e-29   
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             125   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    124   4e-29   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX82243.1|  BnaA03g35780D                                          120   4e-29   
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    124   5e-29   
emb|CDX71386.1|  BnaC04g16210D                                          117   9e-29   
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    123   1e-28   Brassica rapa
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    123   1e-28   
emb|CDX88656.1|  BnaA03g09930D                                          123   1e-28   
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    122   2e-28   Oryza brachyantha
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    122   2e-28   Pyrus x bretschneideri [bai li]
ref|NP_001046128.1|  Os02g0187400                                       122   2e-28   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    122   3e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    122   3e-28   Triticum urartu
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    122   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    122   4e-28   Ricinus communis
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    120   4e-28   Camelina sativa [gold-of-pleasure]
gb|EEE53168.1|  hypothetical protein OsJ_36008                          122   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72640.1|  hypothetical protein OsI_06154                          122   6e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    121   7e-28   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    120   9e-28   
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    120   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    120   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             120   1e-27   
dbj|BAK08209.1|  predicted protein                                      120   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             120   1e-27   Capsella rubella
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    120   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_007011972.1|  SHV3-like 5                                        119   2e-27   
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...    117   3e-27   Camelina sativa [gold-of-pleasure]
emb|CDY02800.1|  BnaC02g10890D                                          119   4e-27   
gb|EEE56466.1|  hypothetical protein OsJ_05675                          119   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    119   4e-27   
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   118   5e-27   Genlisea aurea
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    118   6e-27   
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    118   6e-27   Camelina sativa [gold-of-pleasure]
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        118   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    118   8e-27   
emb|CDY32730.1|  BnaA02g07920D                                          117   9e-27   Brassica napus [oilseed rape]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    117   9e-27   
emb|CDY02788.1|  BnaC02g11010D                                          117   1e-26   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    117   1e-26   
dbj|BAJ92515.1|  predicted protein                                      112   1e-26   
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        117   1e-26   
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    117   1e-26   
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    117   1e-26   
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    117   2e-26   
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    117   2e-26   
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    117   2e-26   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    117   2e-26   
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    117   2e-26   
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             117   2e-26   
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    117   2e-26   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    117   2e-26   
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                    113   3e-26   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    116   4e-26   
emb|CDY32720.1|  BnaA02g07820D                                          115   8e-26   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    115   9e-26   
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...    115   1e-25   
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    114   1e-25   
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...    114   2e-25   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    114   2e-25   
emb|CDY58867.1|  BnaC09g52640D                                          113   4e-25   
emb|CDX86765.1|  BnaA09g21550D                                          107   4e-25   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    113   4e-25   
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    112   8e-25   
emb|CDX86766.1|  BnaA09g21560D                                          111   1e-24   
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    112   1e-24   
emb|CDY43885.1|  BnaC09g33580D                                          111   2e-24   
gb|KDP38642.1|  hypothetical protein JCGZ_03995                         110   6e-24   
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    109   8e-24   
gb|EEE69509.1|  hypothetical protein OsJ_28963                          106   2e-23   
emb|CDP10204.1|  unnamed protein product                                104   6e-22   
gb|KJB54927.1|  hypothetical protein B456_009G054700                    103   8e-22   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    103   1e-21   
emb|CDY12605.1|  BnaA02g12730D                                          102   2e-21   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                101   4e-21   
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          101   4e-21   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    101   5e-21   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  99.0    4e-20   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...  95.5    7e-19   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  94.4    2e-18   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           94.0    2e-18   
ref|NP_001062919.2|  Os09g0339800                                     93.6    2e-18   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...  93.2    3e-18   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  92.8    4e-18   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           92.4    6e-18   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  92.0    8e-18   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  91.7    1e-17   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  91.3    2e-17   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  90.9    2e-17   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           90.1    3e-17   
gb|EPS68532.1|  hypothetical protein M569_06231                       90.1    4e-17   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...  88.6    1e-16   
ref|XP_003610370.1|  GPI-anchored protein                             88.2    1e-16   
ref|XP_006586114.1|  PREDICTED: probable glycerophosphoryl dieste...  81.3    5e-16   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  84.3    3e-15   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                 80.9    4e-14   
ref|WP_026880196.1|  glycerophosphodiester phosphodiesterase          79.0    6e-14   
gb|KDB51915.1|  glycerophosphoryl diester phosphodiesterase           79.0    7e-14   
ref|WP_037482455.1|  glycerophosphodiester phosphodiesterase          78.6    8e-14   
ref|WP_012348374.1|  glycerophosphoryl diester phosphodiesterase      78.6    9e-14   
ref|WP_027846981.1|  hypothetical protein                             77.4    2e-13   
ref|XP_001756342.1|  predicted protein                                77.0    8e-13   
ref|XP_010428404.1|  PREDICTED: glycerophosphodiester phosphodies...  75.9    9e-13   
ref|XP_010416272.1|  PREDICTED: glycerophosphodiester phosphodies...  75.9    9e-13   
ref|WP_008906374.1|  glycerophosphoryl diester phosphodiesterase      75.5    1e-12   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  76.6    1e-12   
ref|XP_004241605.1|  PREDICTED: glycerophosphodiester phosphodies...  74.7    2e-12   
ref|XP_006354752.1|  PREDICTED: probable glycerophosphoryl dieste...  74.3    3e-12   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...  75.1    4e-12   
ref|XP_001691613.1|  glycerophosphoryl diester phosphodiesterase ...  72.4    9e-12   
ref|XP_010416256.1|  PREDICTED: glycerophosphodiester phosphodies...  70.9    1e-11   
ref|XP_010416257.1|  PREDICTED: glycerophosphodiester phosphodies...  70.5    1e-11   
ref|XP_010416252.1|  PREDICTED: glycerophosphodiester phosphodies...  70.9    1e-11   
ref|XP_976827.1|  Glycerophosphoryl diester phosphodiesterase fam...  72.0    1e-11   
ref|WP_036269588.1|  glycerophosphodiester phosphodiesterase          72.0    2e-11   
ref|XP_001756508.1|  predicted protein                                73.2    2e-11   
ref|XP_002514650.1|  glycerophosphoryl diester phosphodiesterase,...  72.4    2e-11   
ref|XP_004299298.1|  PREDICTED: glycerophosphodiester phosphodies...  71.6    2e-11   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...  72.4    2e-11   
ref|XP_006302358.1|  hypothetical protein CARUB_v10020425mg           71.2    3e-11   
ref|XP_003549570.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    5e-11   
ref|XP_010416268.1|  PREDICTED: glycerophosphodiester phosphodies...  70.1    5e-11   
ref|XP_009345993.1|  PREDICTED: probable glycerophosphoryl dieste...  70.5    6e-11   
ref|XP_009338242.1|  PREDICTED: probable glycerophosphoryl dieste...  70.5    6e-11   
gb|ELR99882.1|  glycerophosphoryl diester phosphodiesterase           71.2    8e-11   
gb|KDP31354.1|  hypothetical protein JCGZ_11730                       69.7    9e-11   
ref|XP_010491423.1|  PREDICTED: glycerophosphodiester phosphodies...  69.7    1e-10   
ref|XP_010471509.1|  PREDICTED: glycerophosphodiester phosphodies...  69.7    1e-10   
ref|XP_009593560.1|  PREDICTED: probable glycerophosphoryl dieste...  69.7    1e-10   
gb|ELU07955.1|  hypothetical protein CAPTEDRAFT_127725                69.3    1e-10   
ref|WP_036838616.1|  glycerophosphodiester phosphodiesterase          69.3    1e-10   
gb|EJL83967.1|  glycerophosphoryl diester phosphodiesterase           69.3    1e-10   
ref|XP_006440766.1|  hypothetical protein CICLE_v10020540mg           69.3    1e-10   
gb|EYU45734.1|  hypothetical protein MIMGU_mgv1a007920mg              69.3    2e-10   
ref|XP_008351894.1|  PREDICTED: probable glycerophosphoryl dieste...  69.3    2e-10   
ref|XP_007045851.1|  PLC-like phosphodiesterases superfamily protein  68.9    2e-10   
gb|EPS69640.1|  hypothetical protein M569_05124                       68.9    2e-10   
ref|XP_002283945.1|  PREDICTED: glycerophosphodiester phosphodies...  68.9    2e-10   
ref|XP_002466838.1|  hypothetical protein SORBIDRAFT_01g015000        68.9    2e-10   
gb|KEH32030.1|  glycerophosphoryl diester phosphodiesterase famil...  68.2    2e-10   
ref|XP_009795261.1|  PREDICTED: probable glycerophosphoryl dieste...  68.6    2e-10   
ref|WP_019960329.1|  hypothetical protein                             68.2    3e-10   
ref|WP_008178488.1|  glycerophosphoryl diester phosphodiesterase      69.3    3e-10   
gb|KEH32031.1|  glycerophosphoryl diester phosphodiesterase famil...  68.2    4e-10   
ref|XP_010695228.1|  PREDICTED: glycerophosphodiester phosphodies...  68.2    4e-10   
emb|CDX73068.1|  BnaC06g35160D                                        67.8    4e-10   
ref|WP_026436377.1|  glycerophosphodiester phosphodiesterase          67.8    5e-10   
ref|XP_007155231.1|  hypothetical protein PHAVU_003G184300g           67.8    5e-10   
gb|ACU20513.1|  unknown                                               65.9    5e-10   
ref|WP_012163503.1|  glycerophosphoryl diester phosphodiesterase      68.6    6e-10   
ref|NP_001241112.1|  uncharacterized protein LOC100778145 precursor   67.4    7e-10   
ref|XP_007037580.1|  PLC-like phosphodiesterases superfamily prot...  67.4    8e-10   
ref|XP_007037581.1|  PLC-like phosphodiesterases superfamily prot...  67.4    8e-10   
ref|WP_039781895.1|  glycerophosphodiester phosphodiesterase          67.8    8e-10   
ref|WP_036483116.1|  glycerophosphodiester phosphodiesterase          67.8    8e-10   
ref|WP_036478771.1|  glycerophosphodiester phosphodiesterase          67.8    9e-10   
gb|ERT04513.1|  glycerophosphoryl diester phosphodiesterase famil...  67.8    1e-09   
ref|WP_029315687.1|  glycerophosphodiester phosphodiesterase          67.4    1e-09   
ref|XP_008374638.1|  PREDICTED: probable glycerophosphoryl dieste...  66.6    1e-09   
ref|XP_010258037.1|  PREDICTED: glycerophosphodiester phosphodies...  66.6    1e-09   
gb|KCW83726.1|  hypothetical protein EUGRSUZ_B00600                   66.2    1e-09   
gb|KCW83727.1|  hypothetical protein EUGRSUZ_B00600                   66.2    1e-09   
gb|KCW83725.1|  hypothetical protein EUGRSUZ_B00600                   66.2    1e-09   
emb|CDP19102.1|  unnamed protein product                              66.6    1e-09   
emb|CDP11621.1|  unnamed protein product                              66.2    1e-09   
ref|XP_010030714.1|  PREDICTED: probable glycerophosphoryl dieste...  66.2    2e-09   
ref|XP_006390448.1|  hypothetical protein EUTSA_v10018684mg           66.2    2e-09   
gb|ADK26134.1|  glycerophosphodiester phosphodiesterase 1             66.2    2e-09   
ref|WP_015914076.1|  glycerophosphoryl diester phosphodiesterase      66.2    2e-09   
ref|WP_011806527.1|  glycerophosphoryl diester phosphodiesterase      66.2    2e-09   
emb|CDX68196.1|  BnaA07g22360D                                        66.2    2e-09   
ref|XP_009104778.1|  PREDICTED: probable glycerophosphoryl dieste...  65.9    2e-09   
ref|XP_009104777.1|  PREDICTED: probable glycerophosphoryl dieste...  65.9    2e-09   
emb|CDY11071.1|  BnaC06g23230D                                        65.9    2e-09   
ref|WP_036353136.1|  glycerophosphodiester phosphodiesterase          65.5    3e-09   
ref|NP_177561.1|  glycerophosphoryl diester phosphodiesterase         65.5    3e-09   
ref|WP_027730853.1|  hypothetical protein                             62.8    3e-09   
ref|XP_008450755.1|  PREDICTED: probable glycerophosphoryl dieste...  65.1    4e-09   
gb|AAV74406.1|  glycerophosphodiester phosphodiesterase-like protein  64.3    4e-09   
ref|XP_002966299.1|  hypothetical protein SELMODRAFT_85502            65.1    4e-09   
ref|XP_002978269.1|  hypothetical protein SELMODRAFT_108000           65.1    4e-09   
ref|WP_038119525.1|  glycerophosphodiester phosphodiesterase          65.1    4e-09   
ref|WP_024301826.1|  glycerophosphodiester phosphodiesterase          65.1    4e-09   
ref|WP_012745495.1|  glycerophosphoryl diester phosphodiesterase      65.1    4e-09   
gb|AEY88262.1|  glycerophosphoryl diester phosphodiesterase           62.4    5e-09   
ref|XP_007209220.1|  hypothetical protein PRUPE_ppa006823mg           64.7    5e-09   
ref|XP_008240011.1|  PREDICTED: probable glycerophosphoryl dieste...  64.7    5e-09   
ref|WP_040484619.1|  hypothetical protein                             65.1    6e-09   
ref|WP_018996438.1|  hypothetical protein                             64.3    6e-09   
gb|EDX77851.1|  Glycerophosphoryl diester phosphodiesterase family    64.3    6e-09   
ref|WP_044205264.1|  glycerophosphodiester phosphodiesterase          64.3    6e-09   
emb|CDX68195.1|  BnaA07g22350D                                        64.3    7e-09   
emb|CDX69980.1|  BnaA10g23290D                                        64.3    7e-09   
ref|XP_011072888.1|  PREDICTED: glycerophosphodiester phosphodies...  64.3    7e-09   
ref|XP_004982462.1|  PREDICTED: probable glycerophosphoryl dieste...  64.3    7e-09   
gb|ELR97763.1|  glycerophosphoryl diester phosphodiesterase           65.1    8e-09   
ref|WP_043335615.1|  hypothetical protein                             64.3    8e-09   
ref|XP_004508666.1|  PREDICTED: glycerophosphoryl diester phospho...  64.3    8e-09   
ref|XP_001758075.1|  predicted protein                                63.9    8e-09   
ref|XP_010068779.1|  PREDICTED: probable glycerophosphoryl dieste...  63.9    8e-09   
emb|CDX85814.1|  BnaC06g23200D                                        62.0    8e-09   
gb|KDO65721.1|  hypothetical protein CISIN_1g016353mg                 63.5    9e-09   
ref|WP_007835428.1|  glycerophosphoryl diester phosphodiesterase      63.9    9e-09   
ref|XP_004982461.1|  PREDICTED: probable glycerophosphoryl dieste...  63.9    9e-09   
gb|ABK95148.1|  unknown                                               63.9    9e-09   
gb|KCW64880.1|  hypothetical protein EUGRSUZ_G02445                   63.9    9e-09   
ref|XP_010695224.1|  PREDICTED: glycerophosphodiester phosphodies...  63.9    9e-09   
ref|XP_011006572.1|  PREDICTED: glycerophosphodiester phosphodies...  63.9    1e-08   
ref|XP_010695225.1|  PREDICTED: glycerophosphodiester phosphodies...  63.9    1e-08   
ref|XP_004137431.1|  PREDICTED: glycerophosphoryl diester phospho...  63.5    1e-08   
ref|NP_001044335.1|  Os01g0763600                                     63.5    1e-08   
gb|KDO65720.1|  hypothetical protein CISIN_1g016353mg                 63.5    1e-08   
ref|XP_002873336.1|  predicted protein                                63.5    1e-08   
ref|XP_009104775.1|  PREDICTED: uncharacterized protein LOC103830713  63.5    1e-08   
ref|XP_006477678.1|  PREDICTED: probable glycerophosphoryl dieste...  63.5    1e-08   
ref|XP_010452775.1|  PREDICTED: glycerophosphodiester phosphodies...  63.2    1e-08   
ref|XP_006477679.1|  PREDICTED: probable glycerophosphoryl dieste...  63.5    1e-08   
gb|AHG89434.1|  glycerophosphoryl diester phosphodiesterase           63.2    2e-08   
ref|WP_040697410.1|  glycerophosphodiester phosphodiesterase          63.9    2e-08   
gb|AFU81122.1|  phospholipase C3                                      63.2    2e-08   
gb|KFK25174.1|  hypothetical protein AALP_AA8G076000                  63.2    2e-08   
ref|WP_015013304.1|  glycerophosphoryl diester phosphodiesterase      63.2    2e-08   
ref|WP_015228782.1|  glycerophosphoryl diester phosphodiesterase      63.9    2e-08   
ref|XP_006650282.1|  PREDICTED: probable glycerophosphoryl dieste...  63.2    2e-08   
ref|WP_038017664.1|  glycerophosphodiester phosphodiesterase          63.5    2e-08   
ref|XP_009122414.1|  PREDICTED: probable glycerophosphoryl dieste...  63.2    2e-08   
tpg|DAA50258.1|  TPA: glycerophosphoryl diester phosphodiesterase     63.2    2e-08   
ref|XP_002887531.1|  predicted protein                                62.8    2e-08   
ref|WP_017507486.1|  hypothetical protein                             62.8    2e-08   
ref|XP_010030704.1|  PREDICTED: probable glycerophosphoryl dieste...  62.8    2e-08   
dbj|BAF81519.1|  glycerophosphodiester phosphodiesterase              62.8    2e-08   
ref|XP_009122415.1|  PREDICTED: probable glycerophosphoryl dieste...  62.8    2e-08   
gb|ABR16222.1|  unknown                                               62.8    2e-08   
ref|WP_011612320.1|  glycerophosphoryl diester phosphodiesterase      63.5    2e-08   
ref|WP_011647402.1|  MULTISPECIES: glycerophosphoryl diester phos...  62.4    2e-08   
emb|CBA33326.1|  hypothetical protein Csp_B18490                      62.8    3e-08   
ref|WP_037247003.1|  glycerophosphodiester phosphodiesterase          62.4    3e-08   
ref|WP_015216930.1|  glycerophosphoryl diester phosphodiesterase      63.2    3e-08   
dbj|BAJ92666.1|  predicted protein                                    62.4    3e-08   
ref|XP_010423145.1|  PREDICTED: glycerophosphodiester phosphodies...  62.4    3e-08   
ref|XP_001766682.1|  predicted protein                                62.8    3e-08   
gb|EDX87604.1|  Glycerophosphoryl diester phosphodiesterase family    63.2    3e-08   
emb|CDX99041.1|  BnaC09g47940D                                        62.0    3e-08   
gb|EAY90926.1|  hypothetical protein OsI_12541                        62.0    4e-08   
gb|AGC70933.1|  glycerophosphoryl diester phosphodiesterase           62.4    4e-08   
ref|WP_007879816.1|  glycerophosphoryl diester phosphodiesterase      62.0    4e-08   
ref|NP_001050628.1|  Os03g0603600                                     62.0    4e-08   
ref|WP_042580472.1|  glycerophosphodiester phosphodiesterase          62.0    4e-08   
ref|WP_021005092.1|  putative glycerophosphoryl diester phosphodi...  62.0    4e-08   
ref|XP_006374408.1|  hypothetical protein POPTR_0015s06930g           62.0    5e-08   
ref|XP_010260099.1|  PREDICTED: glycerophosphodiester phosphodies...  62.0    5e-08   
ref|WP_033366138.1|  glycerophosphodiester phosphodiesterase          62.0    5e-08   
ref|WP_038368073.1|  glycerophosphodiester phosphodiesterase          61.6    5e-08   
ref|XP_009106082.1|  PREDICTED: probable glycerophosphoryl dieste...  61.6    5e-08   
ref|XP_009020602.1|  hypothetical protein HELRODRAFT_192312           61.6    5e-08   
emb|CDS53213.1|  Glycerophosphoryl diester phosphodiesterase          61.6    5e-08   
ref|WP_026602279.1|  glycerophosphodiester phosphodiesterase          61.6    6e-08   
ref|WP_003286770.1|  glycerophosphoryl diester phosphodiesterase      61.6    6e-08   



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW LRSI  LLLLC +   V+AQ S N+TSKW TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSNNATSKWFTLSGDAPKVIARGGFSGLMPDSSFNAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            + A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61   TLASTISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVDVLFKNKQNTYLVNGVPQKGW  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +DFNFK L LV L+QGV+SRS RFDG
Sbjct  121  FSVDFNFKDLALVTLKQGVFSRSPRFDG  148



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW LRSI  LLLLC +   V+AQ S N+TSKW TL+GDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSDNATSKWLTLTGDAPKVIARGGFSGLMPDSSFNAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61   ILAKAISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVNVLFKNKQNTYLVNGVPQKGW  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +DFNFK L LV+L+QGV+SRS RFDG
Sbjct  121  FSVDFNFKDLALVSLKQGVFSRSPRFDG  148



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M K+RS+  LL+LC +V  VAAQ S N TSKW+TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MRKMRSVLCLLVLCCSVAFVAAQRSNNVTSKWKTLSGDAPKVIARGGFSGLLPDSSFNAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A   S  + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61   MLAQAISSADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYPNRNNNYSVNGIPQTGW  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F IDF+ K L  V+L+QGVYSRS RFDG
Sbjct  121  FSIDFSIKDLAPVSLKQGVYSRSPRFDG  148



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M KLR +  LL L  +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AY
Sbjct  1    MSKLRQVI-LLFLLHSVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAY  59

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            S A +TSL+NV++WCDVQLTKDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  W
Sbjct  60   SLALMTSLSNVVLWCDVQLTKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGW  119

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +DF    L  V L QGVYSRS RFDG
Sbjct  120  FSVDFTLTDLETVALNQGVYSRSGRFDG  147



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW LR +  L +L S  + V  Q   N+T+KW TL GDAPLVIARGGFSGL PDSS++AY
Sbjct  1    MWNLRRLSYLFVLLSCFS-VTTQALNNATTKWLTLHGDAPLVIARGGFSGLLPDSSYDAY  59

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT  W
Sbjct  60   IMALETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPTQGW  119

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F ID+NFK L  V L+QGVYSR+SRFDG
Sbjct  120  FSIDYNFKDLAPVTLKQGVYSRTSRFDG  147



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M K+RS+  LLLLC +   VAAQ S+N TSKW+TLSGDAP VIARGGFSGL PDSS+NAY
Sbjct  1    MRKMRSVLCLLLLCCSAAFVAAQRSSNVTSKWKTLSGDAPKVIARGGFSGLLPDSSYNAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A   SL + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61   LLAQAISLADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYLNRNNNYSVNGIPQTGW  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F IDFN K L  V+L+QGVYSRS RFDG
Sbjct  121  FSIDFNIKDLAPVSLKQGVYSRSPRFDG  148



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +2

Query  218  AVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AYS A +TSL+NV++WC
Sbjct  15   SVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAYSLALMTSLSNVVLWC  74

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQL+KDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  WF +DF    L  V L
Sbjct  75   DVQLSKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGWFSVDFTLTDLETVAL  134

Query  578  QQGVYSRSSRFDG  616
             QGVYSRS +FDG
Sbjct  135  NQGVYSRSGKFDG  147



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 118/152 (78%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1    MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
            F AYS A LTSL +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++KD+Q TYLVNGV 
Sbjct  60   FGAYSLALLTSLPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAVVYKDRQKTYLVNGVS  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF IDF  ++L  V L QGVYSR+++FDG
Sbjct  120  TKGWFSIDFTLRELGNVILNQGVYSRTNKFDG  151



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW LRS+  LLLLC +VT VAAQ + + T+KW TL+GDAPLVIA GGFSGLFPDSS++AY
Sbjct  14   MWNLRSLSCLLLLCFSVTTVAAQRTNSETTKWLTLNGDAPLVIALGGFSGLFPDSSYDAY  73

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  TSL NVI WCDVQLTKDGVGIC PD+KLDNAS++   FK+K++ Y VNGVP   W
Sbjct  74   MVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFKNKETKYSVNGVPMQGW  133

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F IDFNFK L  V L+QGV+SR+ +FDG
Sbjct  134  FSIDFNFKDLAPVTLRQGVFSRTPKFDG  161



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1    MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
            F AYS A LTS  +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K++Q TYLVNGV 
Sbjct  60   FGAYSLALLTSPPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAIVYKNRQKTYLVNGVS  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF IDF  ++L  V L QGVYSR+++FDG
Sbjct  120  TKGWFSIDFTLRELGNVILSQGVYSRTNKFDG  151



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 7/150 (5%)
 Frame = +2

Query  173  MWKLRSIF--NLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  346
            MW LRS+    +LL C +V   AAQG   + +KW TL+G+APLVIARGGFSGL PDSS++
Sbjct  1    MWNLRSLSWSFVLLTCFSV---AAQGV--NRTKWLTLNGNAPLVIARGGFSGLLPDSSYD  55

Query  347  AYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTT  526
            AY     TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT 
Sbjct  56   AYIMGLETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPTQ  115

Query  527  AWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
             WF ID+N K L  V L+QGVYSR+ RFDG
Sbjct  116  GWFSIDYNLKDLVHVTLKQGVYSRTQRFDG  145



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  186  ILNQGVYSRTDKFDG  200



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  173  MWKLRSIFNL---LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M K R +F L   LLLCS+  LV+AQ S    S WQTLSG+APLVIARGGFSG+FPDSS 
Sbjct  1    MLKFRPVFCLFSFLLLCSSSVLVSAQRSRTRGSPWQTLSGNAPLVIARGGFSGIFPDSSL  60

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
             AYS A  T L N+  WCDVQLTKDG GICFPD++L+NAS++  ++K++Q TY VNGV T
Sbjct  61   YAYSLAVQTGLPNLHAWCDVQLTKDGAGICFPDLRLENASDIDNIYKNRQKTYDVNGVST  120

Query  524  TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              WF +DF  ++L  VN++Q ++SR+  FDG
Sbjct  121  QGWFSVDFTLEELAPVNMKQRIFSRAPNFDG  151



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  186  ILNQGVYSRTDKFDG  200



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  186  ILNQGVYSRTDKFDG  200



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  138

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  139  ILNQGVYSRTDKFDG  153



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  138

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  139  ILNQGVYSRTDKFDG  153



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  212  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  391
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  392  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  571
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  572  NLQQGVYSRSSRFDG  616
             L QGVYSR+ +FDG
Sbjct  186  ILNQGVYSRTDKFDG  200



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +2

Query  188  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            T  ++VI+WCDVQLTKDG GICFPD+KLDN SN+AT+F DK  TYLVNGV T   F ID+
Sbjct  69   TGPSDVILWCDVQLTKDGAGICFPDLKLDNNSNIATIFSDKPVTYLVNGVSTKGLFSIDY  128

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
              K L  V L QG+YSR+++FDG
Sbjct  129  TLKDLGSVYLSQGIYSRTNKFDG  151



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            IF  L L S + LV+AQGS NST+ WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + 
Sbjct  10   IFFSLFLHSFLALVSAQGS-NSTALWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAVMV  68

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA-TLFKDKQSTYLVNGVPTTAWFPIDF  547
            S+ +VI+WCDVQLTKDGVGIC PD++LDNA++   TL K++ S+YLVNGV T+  F +DF
Sbjct  69   SVPDVILWCDVQLTKDGVGICLPDLRLDNATDAPTTLGKNRTSSYLVNGVRTSGLFTVDF  128

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            +FK+L  V+L QG+YSRS++FDG
Sbjct  129  DFKELENVSLVQGIYSRSTKFDG  151



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            MWK+RS+  LL L          AAQGS   +SKWQTLSGDAPLVIARGGFSG+FPDSSF
Sbjct  1    MWKVRSVLGLLSLLLLSASVGLAAAQGSRGRSSKWQTLSGDAPLVIARGGFSGIFPDSSF  60

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
             AYS A  TSLTNV +WCDVQLTKDG GICFPDI+L+N+S++  ++K+ ++TY+VNGV T
Sbjct  61   YAYSLAVQTSLTNVHVWCDVQLTKDGAGICFPDIRLENSSDIDNVYKNGRNTYVVNGVST  120

Query  524  TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              WF +DF    L  VNL+Q +++R+  FDG
Sbjct  121  QGWFSVDFTLNDLAPVNLKQRIFTRAPNFDG  151



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = +2

Query  185  RSIFNLLLLCSAVTLVAAQGSTN-STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFA  361
            R +F LL+L SAV + + + STN STS W TL+G APLVIA+GGFSGLFPDSS+ AYS A
Sbjct  5    RPLFLLLVLHSAVLITSQRSSTNNSTSPWLTLNGKAPLVIAKGGFSGLFPDSSYAAYSLA  64

Query  362  GLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPI  541
             +TSL+NVI+WCDVQLTKD VGICFPD+KLDN+S++A +FK+  + YLVNG     +FP+
Sbjct  65   NMTSLSNVILWCDVQLTKDAVGICFPDLKLDNSSDIANVFKN-STVYLVNGQLMKGYFPV  123

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            D+    L  V L QG+YSR+ +FDG
Sbjct  124  DYTLNDLANVYLTQGIYSRTDKFDG  148



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW+ R +F L++LC     VAAQG+     +WQTLSG+APLVIARGGFSG+FP SS  AY
Sbjct  1    MWRFRDVFLLIMLCLLAVSVAAQGTRRGGRQWQTLSGNAPLVIARGGFSGVFPYSSGYAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A LT L N+ +WCDVQLTKDG GICFPDI+L NAS++  ++ +K +TY ++G     W
Sbjct  61   ELALLTGLPNLHIWCDVQLTKDGAGICFPDIRLQNASDIKYVYGNKSNTYTIDGKQEQGW  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +DF  K L LVN+ QG+++R   FDG
Sbjct  121  FSVDFTLKDLKLVNMNQGIHNRVPHFDG  148



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            ST KWQTLSG APL IARGGFSGLFPDSS+NAY  A  TSL+++++WCDVQLTKD  GIC
Sbjct  26   STRKWQTLSGSAPLAIARGGFSGLFPDSSYNAYVLAVGTSLSDLVLWCDVQLTKDAAGIC  85

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+KLDNAS+V  +F ++ STY+V+GV T  WF ID+N K L LV+L+Q +YSR++RFD
Sbjct  86   FPDLKLDNASDVNVVFNNRASTYIVSGVSTRGWFSIDYNLKDLRLVSLKQRIYSRTNRFD  145

Query  614  G  616
            G
Sbjct  146  G  146



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF +D+  K +  V L QGV+SRS++FDG
Sbjct  120  TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDG  151



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 7/152 (5%)
 Frame = +2

Query  173  MWKLRSI----FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            MW  RS+       +LL S  +LV+AQGS  S   W+TLSG+ PLVIARGGFSG+FPDSS
Sbjct  11   MWSRRSVSCVVAAFVLLNSLASLVSAQGSGTS---WKTLSGNPPLVIARGGFSGIFPDSS  67

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
              AY  A +T + ++I+WCDVQLTKDGVGIC PD++LDN+++++ +FK+K   YLVNG P
Sbjct  68   SAAYQLALITGVPDLILWCDVQLTKDGVGICAPDLRLDNSTDISLVFKNKDKNYLVNGAP  127

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF +DF F  L+ V L QGVYSRS++FDG
Sbjct  128  TQGWFSVDFTFNDLSSVVLTQGVYSRSNKFDG  159



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF +D+  K +  V L QGV+SRS++FDG
Sbjct  120  TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDG  151



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSAAFQFAPLTSLPDVVLWCDVQLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV+L QG+Y
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVSLTQGIY  141

Query  593  SRSSRFD  613
            SRS RFD
Sbjct  142  SRSERFD  148



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T  WF +D+  K +  V L QGV+SRS++FDG
Sbjct  120  TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDG  151



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LL C  V +   VA   +  STS+WQTL+GDAPLVIARGGFSGLFPDSS  AY FA   S
Sbjct  18   LLFCGVVLIQLFVAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLFPDSSLAAYQFAMQAS  77

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            L +VI+WCDVQLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFPIDF+ 
Sbjct  78   LADVILWCDVQLTKDEVGICFPDLNLANASNIQDVYSTRRKSYRVNGVTTQGWFPIDFSL  137

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
             +L  V+L +G++SRS RFDG
Sbjct  138  TELQNVSLIRGIFSRSERFDG  158



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNRPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDGVGIC PD++LDN++++A + K+K   YLVNG+PT  WF +DF   +L+LV L QG+Y
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGIPTRGWFTVDFTLNELSLVFLAQGIY  141

Query  593  SRSSRFD  613
            SRS RFD
Sbjct  142  SRSERFD  148



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +2

Query  188  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSSF AYS A  
Sbjct  10   AIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSSFGAYSLALE  68

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV T   F ID+
Sbjct  69   TGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVSTKGLFSIDY  128

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
                L  V L QG+YSR+++ DG
Sbjct  129  TLNDLGSVYLSQGIYSRTNKLDG  151



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
            F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T   F ID+    L  V L QG+YSR+++ DG
Sbjct  120  TKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDG  151



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  340
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  341  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  520
            F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  521  TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            T   F ID+    L  V L QG+YSR+++ DG
Sbjct  120  TKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDG  151



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV L QG+Y
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIY  141

Query  593  SRSSRFD  613
            SRS RFD
Sbjct  142  SRSERFD  148



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L AAQ  +    S W TL+GD P VIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLFAAQINAQKPKSPWPTLTGDPPFVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +++V++WCDVQLTKD +GICFPD+ + NAS++  ++  +Q +Y VNGVPT+ WF IDF+ 
Sbjct  69   VSDVVLWCDVQLTKDALGICFPDLTMSNASSIEVVYPTRQKSYPVNGVPTSGWFTIDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            K L  VNL +G+ SRS +FDG
Sbjct  129  KDLKAVNLIRGILSRSEKFDG  149



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV L QG+Y
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIY  141

Query  593  SRSSRFD  613
            SRS RFD
Sbjct  142  SRSERFD  148



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            +LLC  V   L A Q    S+S WQTLSGDAPLVIARGGFSGLFPDSS NAYSFA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGDAPLVIARGGFSGLFPDSSLNAYSFAVQTSV  65

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
                +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q +Y VNGV T  WF IDF+ +
Sbjct  66   PGSALWCDVQLTKDGAGICFPDLKLNNASTVEYVYPNRQKSYPVNGVSTQGWFTIDFSLR  125

Query  557  QLTLVNLQQGVYSRSSRFDG  616
             L  V+L +G+ SR+ +FDG
Sbjct  126  DLNDVSLIRGILSRTEKFDG  145



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  224  TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDV  403
            T +AAQ    S S WQTLSGDAPL+IARGGFSGL PDSS +AYSF  +TS+ + ++WCDV
Sbjct  31   TQLAAQ---RSKSPWQTLSGDAPLIIARGGFSGLLPDSSLDAYSFVSMTSVPDAVLWCDV  87

Query  404  QLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQ  583
            QLTKDGVGICFPD+K+ NASN+   + D++++YL+NGVPT  WF IDF FK L  V L +
Sbjct  88   QLTKDGVGICFPDVKMMNASNIQVAYPDRKNSYLLNGVPTQDWFTIDFTFKDLKTVFLMR  147

Query  584  GVYSRSSRFD  613
            G+ SRS  FD
Sbjct  148  GILSRSDAFD  157



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  251  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  430
             S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +G+
Sbjct  37   RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQTSVPGAVLWCDVQLTKDAIGL  96

Query  431  CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRF  610
            CFPD+K+ NASN+  ++  ++++YL+NGVPT  WF IDFNFK LT V L+QG+ SRS+ F
Sbjct  97   CFPDVKMMNASNIQDVYPKRKTSYLLNGVPTQDWFTIDFNFKDLTKVILKQGILSRSAAF  156

Query  611  DG  616
            DG
Sbjct  157  DG  158



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  129

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            + K L  VNL +G+ SRS +FDG
Sbjct  130  SLKDLKDVNLIRGILSRSEKFDG  152



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  21   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  80

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  81   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  140

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            + K L  VNL +G+ SRS +FDG
Sbjct  141  SLKDLKDVNLIRGILSRSEKFDG  163



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  275  LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  454
             +GDAPLVIARGGFSGLFPDSS++AY  A  TSL NVI WCDVQLTKDGVGIC PD+KLD
Sbjct  23   FAGDAPLVIARGGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLD  82

Query  455  NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            NAS++   FK+K+S Y VNGVP   WF IDFNFK L  V L+QGV SR+ +FDG
Sbjct  83   NASDIDVYFKNKKSKYSVNGVPMQGWFSIDFNFKDLAPVTLRQGVLSRTPKFDG  136



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 106/143 (74%), Gaps = 5/143 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  129

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            + K L  VNL +G+ SRS +FDG
Sbjct  130  SLKDLKDVNLIRGILSRSKKFDG  152



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 104/142 (73%), Gaps = 4/142 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            +LLC  V   L A Q  +  S+S WQTLSGDAPLVIARGGFSGLFPDSSFNAY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQADAQRSSSPWQTLSGDAPLVIARGGFSGLFPDSSFNAYDFAKQTS  65

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF IDF+ 
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWFTIDFSL  125

Query  554  KQL-TLVNLQQGVYSRSSRFDG  616
            + L + V L +G+ SRS +F+G
Sbjct  126  RDLISNVKLNRGILSRSEKFNG  147



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+AAQ  +  S S WQTL+GDAPLVIARGGFSG+ PDSS +AY  A   S
Sbjct  9    LLLCGVVLIQLLAAQVDAQRSRSPWQTLAGDAPLVIARGGFSGVLPDSSVDAYGLAVQVS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +T+V++WCDVQLTKDG+GICFPD+ L NASN+  ++  +Q++YLVNGVPT  WF IDF  
Sbjct  69   VTDVVLWCDVQLTKDGIGICFPDVNLGNASNIGDVYPKQQNSYLVNGVPTQGWFSIDFTL  128

Query  554  KQLTLVNLQQGVYSRSSRFD  613
            K L  V L +G+ SR   FD
Sbjct  129  KDLAKVALIRGILSRPEAFD  148



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            +LLC  V +    G T+   S+S+WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQTDAQRSSSRWQTLSGDAPLVIARGGFSGLFPDSSSIAYGFAKQTS  65

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF IDF+ 
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWFTIDFSL  125

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + L+ V L +G+ SRS +F+G
Sbjct  126  RDLSDVKLNRGILSRSEKFNG  146



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS  +   WQTL+G+ PLVIARGGFSGLFPDSS +A+ FA LTSL  V++WCDVQLT
Sbjct  25   SAQGSATT---WQTLTGNPPLVIARGGFSGLFPDSSSDAFQFATLTSLPGVVLWCDVQLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KD VGIC PD++LDN++++A + ++K   YLVNG+PT  WF +DF   +L+LV+L QG++
Sbjct  82   KDSVGICAPDLRLDNSTSIAQVMQNKDKLYLVNGIPTRGWFTVDFTLNELSLVSLNQGIF  141

Query  593  SRSSRFD  613
            SRS RFD
Sbjct  142  SRSERFD  148



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A Q  +    + W+TLSG +P VIARGGFSGLFPDSS +AY+FA LTS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTHWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMLTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCD+QLTKDG GICFPD+ + NASNV T++   QSTY VNGVPT  WF IDF+ 
Sbjct  69   VADAVLWCDLQLTKDGAGICFPDLTMSNASNVETVYPKGQSTYPVNGVPTPGWFTIDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + LT V+L +G+ SRS +FDG
Sbjct  129  RALTNVSLIRGILSRSDKFDG  149



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +2

Query  215  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  394
            S V LV+A+GS NSTS+WQTLSGDAPLVIARGGFSGLFP  S  A++ A +TS+ +V++W
Sbjct  16   SVVALVSAKGS-NSTSQWQTLSGDAPLVIARGGFSGLFPGFSTAAFNLALVTSVPDVVLW  74

Query  395  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  574
            CDVQLT+DG GICFPD+ L+N S++  +F  K  TYLVNGV T  WF +D+ F  L  V 
Sbjct  75   CDVQLTRDGAGICFPDLLLNNNSDIEAVFPKKDKTYLVNGVSTRGWFTVDYTFNDLASVF  134

Query  575  LQQGVYSRSSRFDG  616
            + QGVYSR+++FDG
Sbjct  135  VTQGVYSRTNKFDG  148



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 115/151 (76%), Gaps = 7/151 (5%)
 Frame = +2

Query  173  MWKLRSIFNLL---LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M + R+  +LL   +L   ++ V+A+GSTN   +WQTLSG+ PLV+ARGGFSG+FPDSS 
Sbjct  1    MCRPRAFASLLAGFILLHLLSFVSAKGSTN---RWQTLSGNPPLVVARGGFSGIFPDSSS  57

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
             AY  A  TS+ +V++WCDVQLTKDGVGIC PD++L+N+++++  FK+++STY+VNGV T
Sbjct  58   YAYQLALATSVPDVVLWCDVQLTKDGVGICAPDVRLENSTDISLFFKNRESTYIVNGVST  117

Query  524  TAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  613
              WF +DF F +L + + L QGVYSRS+ FD
Sbjct  118  KGWFSVDFTFSELISNIGLTQGVYSRSNMFD  148



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  578  QQGVYSRSSRFDG  616
             +G+ SRS RFDG
Sbjct  133  IRGILSRSERFDG  145



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  578  QQGVYSRSSRFDG  616
             +G+ SRS RFDG
Sbjct  133  IRGILSRSERFDG  145



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS  S + WQTLSG APL IARGGFSGLFPDSS+ AYSFA +TSL  V++WCDVQLT
Sbjct  21   SAQGS-GSKTPWQTLSGGAPLAIARGGFSGLFPDSSYAAYSFAIMTSLPEVVLWCDVQLT  79

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KD  GIC PDIKLDN++++A +F ++   Y++NGV T  WF +DF   +L+ V + QG+Y
Sbjct  80   KDSKGICLPDIKLDNSTDIADVFNNRDKEYVINGVATKGWFSLDFTSSELSNVIVSQGIY  139

Query  593  SRSSRFDG  616
            SRS++FDG
Sbjct  140  SRSNKFDG  147



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A+Q  +  S S W TL+G+ PLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGNPPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT  WF +DF+ 
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEAVLKNRLKSYSVNGVPTQGWFTLDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFD  613
            K L  VNL +G+ SRS +FD
Sbjct  129  KDLKDVNLIRGILSRSEKFD  148



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            + LLC  V +    G T+   S   WQTLSGDAPLVIARGGFSGLFPDSS  AYSF   T
Sbjct  44   MFLLCGVVLIQLFAGQTDAQRSRGPWQTLSGDAPLVIARGGFSGLFPDSSLKAYSFVKQT  103

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+    +WCDVQLTKDG GICFPD+KL+NAS +  ++ +++ +YLVNGVPT  WF I+F+
Sbjct  104  SVAGAALWCDVQLTKDGAGICFPDLKLNNASTIDFVYPNRKKSYLVNGVPTQGWFTIEFS  163

Query  551  FKQLTLVNLQQGVYSRSSRFDG  616
             ++L+ V L +G+  RS +FDG
Sbjct  164  LRELSNVTLNRGILFRSEKFDG  185



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ--GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            LLLC  V   L+AAQ     +  S WQTL+GDAPLVIARGGFSGL PDSS +AY  A  T
Sbjct  18   LLLCGVVLMQLLAAQVDAQRSGRSPWQTLTGDAPLVIARGGFSGLLPDSSIDAYGLALQT  77

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+++V++WCDVQLTKDGVGICFPD+ L NASN+  ++   QS+Y+VNGVPT  WF IDF 
Sbjct  78   SVSDVVLWCDVQLTKDGVGICFPDVNLRNASNIDVVYPKGQSSYIVNGVPTQGWFSIDFT  137

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
             K L  V L +G+ SR + FD
Sbjct  138  LKDLGDVALIRGILSRPNAFD  158



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +2

Query  203  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  382
            LLL S V LV+AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A++ A LTSL +
Sbjct  12   LLLHSVVALVSAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFNLALLTSLQD  67

Query  383  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  562
             ++WCDVQLTKDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF +DF    L
Sbjct  68   AVLWCDVQLTKDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWFTVDFTLDDL  127

Query  563  TLVNLQQGVYSRSSRFDG  616
              V++ QG+YSR++RFDG
Sbjct  128  ASVSVTQGIYSRTNRFDG  145



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            STS WQTLSGDAPLVIARGGFSGLFPDSS +AY+FA LTS+ +V++WCDVQLTKDGVGIC
Sbjct  43   STSPWQTLSGDAPLVIARGGFSGLFPDSSSDAYNFAILTSVADVVLWCDVQLTKDGVGIC  102

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+ L NAS +  ++ + Q +Y+VNGV T  WF ID  FK L  V L +G+ SRS +FD
Sbjct  103  FPDLNLANASIIKYIYPNGQKSYMVNGVTTQGWFTIDTTFKDLENVTLNRGILSRSEKFD  162



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L+A Q  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAVQTDAQRSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  578  QQGVYSRSSRFDG  616
             +G+ SRS RFDG
Sbjct  133  IRGILSRSERFDG  145



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 8/153 (5%)
 Frame = +2

Query  173  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  337
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  338  SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  517
            S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  518  PTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  613
             T+A+F +DF F++L + V L QG ++RS +FD
Sbjct  119  QTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFD  151



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 8/153 (5%)
 Frame = +2

Query  173  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  337
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  338  SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  517
            S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  518  PTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  613
             T+A+F +DF F++L + V L QG ++RS +FD
Sbjct  119  QTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFD  151



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M  LRS  + L+LC  V   L ++Q  +  S S WQTL GDAPLVIARGGFSGLFPDSS 
Sbjct  1    MRGLRS--SSLILCGFVLIQLFSSQIDAQRSKSPWQTLLGDAPLVIARGGFSGLFPDSSL  58

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
            +AYSFA  TS+   ++WCDVQLTKDG GICFPD+ + NAS +   +  +Q TY VNGVPT
Sbjct  59   DAYSFAMQTSVAGAVLWCDVQLTKDGAGICFPDLTMSNASTIDVAYPTRQKTYTVNGVPT  118

Query  524  TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              WF IDF+ K L  V L +G+ SRS +FDG
Sbjct  119  QNWFTIDFSLKDLKSVFLVRGILSRSDKFDG  149



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 5/141 (4%)
 Frame = +2

Query  206  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  20   LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  79

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
             +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFPIDF+  
Sbjct  80   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFPIDFSLT  139

Query  557  QL--TLVNLQQGVYSRSSRFD  613
            +L   L +L +G+ SRS +FD
Sbjct  140  ELQKVLFSLIRGILSRSGKFD  160



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 5/141 (4%)
 Frame = +2

Query  206  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  9    LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  68

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
             +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFPIDF+  
Sbjct  69   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFPIDFSLT  128

Query  557  QL--TLVNLQQGVYSRSSRFD  613
            +L   L +L +G+ SRS +FD
Sbjct  129  ELQKVLFSLIRGILSRSGKFD  149



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A+   +  S S W TL+GDAPLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  10   LLLCVVVLIQLLASHIHAQRSKSPWPTLTGDAPLVIARGGFSGLFPDSSYDAYNFAMLTS  69

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + +  +WCDVQLTKD +GICFPD+ + NAS +  ++   Q +Y VNGVPT  WF IDF+ 
Sbjct  70   VPDAALWCDVQLTKDALGICFPDLNMANASTIDGVYPKGQKSYSVNGVPTQGWFTIDFSL  129

Query  554  KQLTLVNLQQGVYSRSSRFD  613
            K L  VNL +G+ SRS RFD
Sbjct  130  KDLKNVNLIRGILSRSERFD  149



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+AAQ  +  S S W TL+GD P VIARGGFSGLFPDSS +AY FA +TS
Sbjct  9    LLLCGVVLIQLLAAQIDAQKSKSPWLTLTGDFPRVIARGGFSGLFPDSSLDAYKFAMITS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + +V++WCD+QLTKDG GICFP + + NAS++  ++ ++Q +YLVNGVPT  WF IDF+ 
Sbjct  69   VPDVVLWCDLQLTKDGAGICFPGLTMSNASSINGVYPNRQKSYLVNGVPTQGWFTIDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + L  V L +G+ SRS +FDG
Sbjct  129  RDLKDVTLIRGILSRSEKFDG  149



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S+WQTL+GD P VIARGGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFP
Sbjct  1    SRWQTLNGDVPFVIARGGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFP  60

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            D+KLDN S++ T+F +KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG
Sbjct  61   DLKLDNNSDITTVFPNKQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDG  119



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 9/144 (6%)
 Frame = +2

Query  203  LLLCSAV------TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            LL C  V      T + A+GST   S+WQTLSGDAPLVIARGGFSGL PDSS  AY+ A 
Sbjct  18   LLFCGVVMIQLFATQIDAEGST---SRWQTLSGDAPLVIARGGFSGLLPDSSLVAYNLAT  74

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  544
            LTS+T+V++WCDVQLTKDG GICFPD+ + NASN+  ++ +++++Y VNGV T  WF ID
Sbjct  75   LTSVTSVVLWCDVQLTKDGAGICFPDLNMANASNIDVVYPNRKNSYPVNGVTTQGWFAID  134

Query  545  FNFKQLTLVNLQQGVYSRSSRFDG  616
               + L  V L +G+ SRS +FDG
Sbjct  135  STLRDLQNVALIRGILSRSDKFDG  158



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +2

Query  206  LLCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            +L S+V L+   AAQ  + +S S WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLSSVVLIQLFAAQIDAKSSRSPWQTLSGDAPLVIARGGFSGLFPDSSSVAYKFAKQTS  65

Query  374  L--TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            +  T+ ++WCDVQLTKDG GICFPD+KL+NASN+  LF ++Q+ Y VNGV +  WF IDF
Sbjct  66   VAGTSSVLWCDVQLTKDGHGICFPDLKLNNASNIGDLFPNRQNFYPVNGVTSQGWFTIDF  125

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            + + L   +L +G++SRS +FDG
Sbjct  126  SLRDLKNASLIRGIFSRSEKFDG  148



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A+Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCDVQLTKD  GICFPD+ + NASN+  + K++  +Y VNGVPT   F +DF+ 
Sbjct  69   VPDAVLWCDVQLTKDAFGICFPDLTMSNASNIEAVHKNRLKSYSVNGVPTQGRFTLDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFD  613
            K L  VNL +G+ SRS +FD
Sbjct  129  KDLKDVNLIRGILSRSEKFD  148



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            +LLC  V   L AAQ     S S WQTLSGDAPLVIARGGFSGLFPDSS  AYSFA  TS
Sbjct  15   VLLCGIVLAHLFAAQIDGQRSRSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYSFAMQTS  74

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +    +WCDVQLTKDG+GICFPD+ L+NAS +  ++  +Q +Y VNGV T  WF IDF+ 
Sbjct  75   VAGSALWCDVQLTKDGLGICFPDLTLNNASTIEFVYPSRQKSYPVNGVRTRGWFTIDFSL  134

Query  554  KQLTLVNLQQGVYSRSSRFD  613
              L  V+L +G+YSRS +FD
Sbjct  135  SDLNNVSLIRGIYSRSEKFD  154



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+++Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLSSQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT   F +DF+ 
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEVVHKNQLKSYSVNGVPTQGLFTLDFSL  128

Query  554  KQLTLVNLQQGVYSRSSRFD  613
            K L  VNL +G+ SRS +FD
Sbjct  129  KDLKDVNLIRGILSRSEKFD  148



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP DF+ 
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPNDFSL  137

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
             +L    L +G+ SR+ RFDG
Sbjct  138  TELQNFLLIRGILSRTDRFDG  158



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP DF+ 
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPNDFSL  137

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
             +L    L +G+ SR+ RFDG
Sbjct  138  TELQNFLLIRGILSRTDRFDG  158



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L +L    +LVA   S    S W+TL G  PLVIARGGFSG+FPDSS  AY+ A  TS  
Sbjct  11   LPILILQYSLVALVSSAGPPSGWKTLQGSPPLVIARGGFSGIFPDSSSLAYNLALNTSSP  70

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            NVI+WCDVQLTKDG GICFP++KLDNA++++ +++ K   + V+GVPT  WF +D+NF++
Sbjct  71   NVILWCDVQLTKDGTGICFPELKLDNATDISVVYQGKAKDHFVSGVPTRGWFSVDYNFQE  130

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V+L QGVYSR++ FDG
Sbjct  131  LANVSLVQGVYSRTNVFDG  149



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +2

Query  215  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  394
            S V LV+A+GS NSTS+W+TLSGDAPLVIARGGFSGLFP  S  A+S A +TS+ +V++W
Sbjct  16   SVVALVSAKGS-NSTSQWKTLSGDAPLVIARGGFSGLFPGFSSAAFSLALITSVPDVVLW  74

Query  395  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  574
            CDVQLTKD  GICFPDI L+N S+V  +F  K  TYLVNG  T  WF +D+    L  V 
Sbjct  75   CDVQLTKDEAGICFPDILLNNNSDVQDVFAKKDKTYLVNGASTHGWFSVDYTLNDLANVF  134

Query  575  LQQGVYSRSSRFDG  616
            + QG+YSR+++FDG
Sbjct  135  VTQGIYSRTNKFDG  148



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTLSGDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD +GIC
Sbjct  39   SKSPWQTLSGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAIGIC  98

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+K+ NASN+  ++  ++++YL+NGVPT  WF IDF  K L  V L +G+ SRS  FD
Sbjct  99   FPDVKMMNASNIQVVYPKRKNSYLLNGVPTQDWFTIDFTLKDLKSVFLIRGIMSRSDAFD  158

Query  614  G  616
            G
Sbjct  159  G  159



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF ID + 
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWFTIDLSL  128

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + LT V+L +G+ SRS +FDG
Sbjct  129  RALTNVSLIRGILSRSDKFDG  149



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF ID + 
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWFTIDLSL  128

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + LT V+L +G+ SRS +FDG
Sbjct  129  RALTNVSLIRGILSRSDKFDG  149



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +2

Query  188  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            S+  +++        +AQ +T S S W TL+G  PLVIA+GGFSGLFPDSS NAY FA +
Sbjct  20   SLIVIIVFLQFFAFASAQQAT-SNSPWLTLNGSPPLVIAKGGFSGLFPDSSANAYQFATM  78

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
             S+ +V++WCDVQLT+DGVGICFP++KLDN+S +  +F +  ++Y VNGVPT  +FPIDF
Sbjct  79   VSVPDVVLWCDVQLTRDGVGICFPNLKLDNSSGIEHVFPNGSNSYDVNGVPTDGFFPIDF  138

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
             F++L+ V L QG+++R+  FDG
Sbjct  139  TFEELSTVPLIQGIFTRNPFFDG  161



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            +LLC  V   L A Q    S+S WQTLSG APLVIARGGFSGLFPDSS  AY FA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGGAPLVIARGGFSGLFPDSSSAAYGFAVQTSV  65

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
               ++WCDVQLTKDG  ICFPD+KL+NAS V   + ++Q +Y VNGV T  WF IDF+  
Sbjct  66   PGAVLWCDVQLTKDGAAICFPDLKLNNASTVEYFYPNRQKSYPVNGVSTQGWFTIDFSLS  125

Query  557  QLTLVNLQQGVYSRSSRFDG  616
             L+ V L +G+ SR+ +FDG
Sbjct  126  DLSNVYLLRGILSRTEKFDG  145



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            +LLC  V +      T++    S W+TLSGDAP VI+RGGFSGLFPDSS +AY+FA  TS
Sbjct  6    VLLCGVVLIHVFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYNFALQTS  65

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + I+WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF +DF+ 
Sbjct  66   VADAILWCDVQLTKDGAGICFPDLNMSNASTIEVVYPKGQKTYPVNGVPTQGWFTVDFSL  125

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            K L  V L +G+ SRS RFDG
Sbjct  126  KDLNKVYLIRGILSRSDRFDG  146



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD  GIC
Sbjct  41   SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAFGIC  100

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+K+ NASN+  ++  + ++YL+NGVPT  WF IDF+ K LT V L +G+ SRS+ FD
Sbjct  101  FPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWFTIDFSLKDLTSVFLIRGILSRSNAFD  160

Query  614  G  616
            G
Sbjct  161  G  161



>emb|CDY71959.1| BnaCnng75290D, partial [Brassica napus]
Length=328

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            + ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81   DAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYSKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  560  LTLVNLQQGVYSRSSRFD  613
            L  V L +G+ SRS  FD
Sbjct  141  LKPVFLIRGILSRSDAFD  158



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  26   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  85

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            D+KLDNA++++ ++  K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG
Sbjct  86   DVKLDNATDISVVYPGKAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDG  144



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            LV+AQGS N+   WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + S+ +VI+WCDVQ
Sbjct  22   LVSAQGS-NTPPLWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAAIVSVPDVILWCDVQ  80

Query  407  LTKDGVGICFPDIKLDNASNVATLF-KDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQ  583
            LTKDGVGIC PD++LDNA++ + +    +  +Y VNGV  +  F +D++FK+L  V++ Q
Sbjct  81   LTKDGVGICLPDLRLDNATDASVILGTTRTRSYSVNGVSMSGLFTVDYDFKELENVSVVQ  140

Query  584  GVYSRSSRFDG  616
            G+Y+RS++FDG
Sbjct  141  GIYTRSTKFDG  151



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 12/143 (8%)
 Frame = +2

Query  209  LCSAVT--------LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            +CSAV         + AAQG+    S W+TLSGDAP +IA+GGFSGLFPDSS  AY FA 
Sbjct  7    VCSAVASFVLLWLGVAAAQGA----SSWKTLSGDAPAIIAKGGFSGLFPDSSEFAYQFAL  62

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  544
            + S  + I++CDV+LTKDG+G+C PDIKLDN +N+   + D + +YLVNGV TT WF +D
Sbjct  63   IASSPDTILYCDVRLTKDGLGVCLPDIKLDNCTNIPEFYADGKKSYLVNGVSTTGWFSVD  122

Query  545  FNFKQLTLVNLQQGVYSRSSRFD  613
            +N  +L+ V+L+Q +YSR+ RFD
Sbjct  123  YNGTELSQVSLKQSIYSRTPRFD  145



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTK+ +GIC
Sbjct  39   SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKEAIGIC  98

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+K+ NASN+  ++  + ++YL+NGVPT  WF IDF+ K L  V L +G+ SRS+ FD
Sbjct  99   FPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWFTIDFSLKDLKSVFLIRGILSRSNAFD  158

Query  614  G  616
            G
Sbjct  159  G  159



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +GIC
Sbjct  29   SKSPWQTLTGDAPRIIARGGFSGLLPDSSIDAYSFVSQTSVPGTLLWCDVQLTKDAIGIC  88

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+K+ NAS++  ++  ++++YL+NGV T  WF IDFNFK L  V L+QG+ SRS  F+
Sbjct  89   FPDVKMMNASHIQDVYPKRKNSYLLNGVLTQDWFTIDFNFKDLNTVFLKQGILSRSDAFE  148

Query  614  G  616
            G
Sbjct  149  G  149



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  49   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  108

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            D+KLDNA++++ ++  K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG
Sbjct  109  DVKLDNATDISVVYPGKAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDG  167



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 101/141 (72%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LL CS V   L AAQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCSVVLIQLFAAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            +  V++WCDVQLTKDG GICFP++ + NASN+  ++ + Q +Y VNGV T  WF ID   
Sbjct  76   VAEVVLWCDVQLTKDGAGICFPELNMANASNIDFVYPNGQKSYPVNGVTTQGWFAIDSTL  135

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + L  V L +G+ SRS++FDG
Sbjct  136  RDLQNVILTRGILSRSNKFDG  156



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+GDAPL++ARGGFSGLFPDSS ++YSF   TS+   ++WCD+QLTKD +GIC
Sbjct  39   SKSPWQTLTGDAPLIVARGGFSGLFPDSSLDSYSFVAQTSVQGTVLWCDLQLTKDAIGIC  98

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FPD+K+ NASN+  +F  ++++YL++GV T  WF IDFNFK L  V L +G+ SRS  FD
Sbjct  99   FPDVKMMNASNIQVVFPKQKNSYLLDGVLTQDWFTIDFNFKDLKNVFLIRGMLSRSDAFD  158

Query  614  G  616
            G
Sbjct  159  G  159



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = +2

Query  194  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  541
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76   QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            DF+   L  V+L +G+ SRS +FDG
Sbjct  136  DFSLGDLQNVSLIRGILSRSDKFDG  160



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FP + + N SNV   +  K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD
Sbjct  100  FPYVTMYNDSNVQEAYPKKKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFD  159



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = +2

Query  194  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  541
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76   QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            DF+   L  V+L +G+ SRS +FDG
Sbjct  136  DFSLGDLQNVSLIRGILSRSDKFDG  160



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW  R++  +LLL S + +V+AQ      S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAVLLLHSLIAIVSAQ-----ISAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  55

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            S A +T+  +V + CDVQLTKD VGIC PDI L N++ +A+ + ++ ++YLVNGVP   +
Sbjct  56   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIASRYPNETTSYLVNGVPIRGY  115

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +D+  KQL  V L QGVYSR++RFDG
Sbjct  116  FSLDYTMKQLNSVFLTQGVYSRTNRFDG  143



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = +2

Query  194  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  541
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76   QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            DF+   L  V+L +G+ SRS +FDG
Sbjct  136  DFSLGDLQNVSLIRGILSRSDKFDG  160



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FP + + N SNV   +  K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD
Sbjct  100  FPYVTMYNDSNVQDAYPKKKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFD  159



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            +F L+L+    T + AQ    S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   T
Sbjct  17   LFALILIHLLPTQLFAQ---RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQT  73

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+++ ++WCDVQLTKDG+GICFPD+ + NASN+   + +++++YLVNGV T  WF IDF 
Sbjct  74   SVSDAVLWCDVQLTKDGIGICFPDLTMMNASNIQDAYPNRKNSYLVNGVTTQDWFTIDFT  133

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
             K L  V L +G+ SRS  FD
Sbjct  134  SKDLRSVFLIRGILSRSDAFD  154



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF +D+NF +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWFSVDYNFGE  126

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V++ QGVYSR+++FDG
Sbjct  127  LANVSVVQGVYSRTNKFDG  145



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF +D+NF +
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWFSVDYNFGE  126

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V++ QGVYSR+++FDG
Sbjct  127  LANVSVVQGVYSRTNKFDG  145



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            +AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A+S A LTSL + ++WCDVQLT
Sbjct  22   SAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFSLALLTSLQDAVLWCDVQLT  77

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF +DF    L  V++ QG+Y
Sbjct  78   KDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWFTVDFTLDDLASVSVTQGIY  137

Query  593  SRSSRFDG  616
            SR++RFDG
Sbjct  138  SRTNRFDG  145



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 108/150 (72%), Gaps = 6/150 (4%)
 Frame = +2

Query  173  MWKLRSIFNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  346
            MW  R+   +L  LL  ++ LV+AQGS    S W+TL+GD PLVIARGGFSGLFP  S  
Sbjct  1    MWNSRAPLFVLAALLFYSLALVSAQGS----SPWKTLTGDPPLVIARGGFSGLFPGFSSA  56

Query  347  AYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTT  526
            AY+ A +TS+ +V+++CDVQLTK+  GICFPD+ L+N+SNV  +F+ K+ TY VNG PT 
Sbjct  57   AYNLALITSVPDVVLYCDVQLTKEAAGICFPDLLLNNSSNVDQVFEKKEKTYPVNGFPTK  116

Query  527  AWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              F ID++ K L  + + QGVYSRS++FDG
Sbjct  117  GSFSIDYSLKDLANIFVTQGVYSRSNKFDG  146



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = +2

Query  194  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  541
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            DF+   L  V+L +G+ SRS RFDG
Sbjct  136  DFSLGDLQNVSLIRGILSRSDRFDG  160



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            LL +  +V LV A  S NS+S W TL+G+APLVIARGGF G+FPDSSF +Y  A  TSL+
Sbjct  9    LLFVLHSVGLVVA--SRNSSS-WLTLTGNAPLVIARGGFPGIFPDSSFASYQLALNTSLS  65

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            NVI+WCDVQLTKDG GICFP+IKL+N+S+++++F++ +  YLVNG  T  WF +D+    
Sbjct  66   NVILWCDVQLTKDGAGICFPNIKLENSSDISSVFRNSR-IYLVNGQSTRGWFSVDYTLDD  124

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V L QG+Y R+++FDG
Sbjct  125  LKSVYLMQGIYYRTNKFDG  143



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M  LRS  + +LLCS V   L A Q  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCSVVLIQLFAPQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  71

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
            +AY+ A  TS+ +VI+WCDV LTKDG+GICFP++ L NAS +  ++ + Q +Y VNGV T
Sbjct  72   DAYNLAIQTSVADVILWCDVHLTKDGIGICFPNLNLANASTIQYVYPNGQKSYPVNGVIT  131

Query  524  TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              WF ID   + L  V L +G+ SRS +FDG
Sbjct  132  QGWFTIDSTLRDLENVTLIRGLLSRSDKFDG  162



>gb|AFW58563.1| hypothetical protein ZEAMMB73_741781 [Zea mays]
Length=178

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +2

Query  242  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  421
             +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD 
Sbjct  21   AAAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDE  80

Query  422  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  601
            +GIC PDIK+DN +N+   +   Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+
Sbjct  81   IGICLPDIKMDNCTNIPDFYAQGQKSYLVNGVPTSGWFSVDYNGTELEQVTLKQSINSRT  140

Query  602  SRFD  613
             RFD
Sbjct  141  PRFD  144



>ref|XP_010470590.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=136

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  200  LLLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            ++L C  V   L AAQ  +  STS+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  T
Sbjct  1    MILFCGVVMIQLFAAQIDAERSTSRWQTLSGDAPRVIARGGFSGLLPDSSIDAYNLAIQT  60

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+ +V++WCDVQLTKDG GICFPD+ L NAS V  ++ + Q +Y +NGV T  WF ID  
Sbjct  61   SVADVVLWCDVQLTKDGFGICFPDLNLANASTVQFVYPNGQKSYPINGVTTQGWFTIDST  120

Query  551  FKQLTLVNLQQGVYS  595
             K L  V L +G+ S
Sbjct  121  LKDLKNVTLSRGILS  135



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = +2

Query  194  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  541
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  542  DFNFKQLTLVNLQQGVYSRSSRFDG  616
            DF+   L  V+L +G+ SRS RFDG
Sbjct  136  DFSLGDLQNVSLIRGILSRSDRFDG  160



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = +2

Query  185  RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            R +  L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS   
Sbjct  5    RVLAILILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTL  61

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  544
             T   NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVNGV T  WF +D
Sbjct  62   DTCGPNVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNGVSTRGWFSVD  121

Query  545  FNFKQLTLVNLQQGVYSRSSRFDG  616
            +N  +L  V++ QGVYSR+++FDG
Sbjct  122  YNLAELANVSVVQGVYSRTNKFDG  145



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +2

Query  176  WKLRSIFNLLLLCSAVTLVAAQGSTNSTS-KWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            W   ++     LCS+  +VA +  ++S   KWQTL+G+ PLVIA+GGFSG+FPDSS NAY
Sbjct  5    WHFCTLILFFWLCSSPPVVAGRRGSSSGGGKWQTLTGNPPLVIAKGGFSGIFPDSSLNAY  64

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  T L N + WC+V LTKDG GICFP+++L+NASN+  ++ DK +TY VNGV    W
Sbjct  65   RLAVETGLRNSLAWCEVYLTKDGAGICFPELRLENASNIGEVYGDKHNTYTVNGVSVEGW  124

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            F +DF    L  V L+Q +Y+RS +FD
Sbjct  125  FALDFTLDDLAYVQLRQRIYARSDKFD  151



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +2

Query  227  LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDV  403
            L AAQ  +  STS WQTLSG+APLVIARGGFSGLFPDSS  A+ FA   S+  VI+WCDV
Sbjct  10   LFAAQINAQRSTSTWQTLSGEAPLVIARGGFSGLFPDSSLAAFQFAMQASVDEVILWCDV  69

Query  404  QLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL--TLVNL  577
            QLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFPIDF+  +L   L +L
Sbjct  70   QLTKDEVGICFPDLNLANASNIQDVYSTRRKSYPVNGVTTQGWFPIDFSLTELQNVLFSL  129

Query  578  QQGVYSRSSRFD  613
             +G+ SRS +FD
Sbjct  130  IRGILSRSEKFD  141



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L A Q  +  S S+WQTLSG+APLVI RGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  49   IQLFAPQIDAQRSRSRWQTLSGEAPLVIDRGGFSGLLPDSSLDAYNLAIQTSVADVVLWC  108

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKDGVGICFPD+ L NASN+  ++ + Q +Y VNGV T  WF ID   + L  V L
Sbjct  109  DVQLTKDGVGICFPDLNLFNASNIEDVYPNGQKSYPVNGVTTQGWFTIDSTLRDLQNVTL  168

Query  578  QQGVYSRSSRFDG  616
             +G++SRS +FDG
Sbjct  169  SRGIFSRSDKFDG  181



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIHLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  560  LTLVNLQQGVYSRSSRFD  613
            L  V L +G+ SRS  FD
Sbjct  141  LKSVFLIRGILSRSDAFD  158



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            + LC  V   L A+Q  +    S W+TLSGDAP VI+RGGFSGLFPDSS +AY FA  TS
Sbjct  6    VFLCGVVLIHLFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYIFALQTS  65

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + + ++WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF +DF+ 
Sbjct  66   VADAVLWCDVQLTKDGAGICFPDLNMSNASIIEVVYPKGQKTYPVNGVPTQGWFTVDFSL  125

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            K L  V L + + SRS RFDG
Sbjct  126  KDLNKVYLIRAILSRSDRFDG  146



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  560  LTLVNLQQGVYSRSSRFD  613
            L  V L +G+ SRS  FD
Sbjct  141  LKSVFLIRGILSRSDAFD  158



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 103/143 (72%), Gaps = 5/143 (3%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGD--APLVIARGGFSGLFPDSSFNAYSFAGL  367
            +LLC  V   L A+Q  +    S W+TLSG+  AP VI+RGGFSGLFPDSS +AY+FA  
Sbjct  6    VLLCGVVLIHLFASQTDAQRPGSPWKTLSGESVAPRVISRGGFSGLFPDSSLDAYNFALQ  65

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS+ + +MWCDVQLTKDG GICFP + + NASN+   + ++ +TYLV+GV T  WF IDF
Sbjct  66   TSVADAVMWCDVQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVSGVSTQGWFTIDF  125

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
            + K L+ VNL +G+ SRS RFDG
Sbjct  126  SLKDLSKVNLIRGILSRSDRFDG  148



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQGS    SKW+TLSGD P VIARGGFSGLFP  S  A+S A +TS+ + ++WCDVQL
Sbjct  21   VSAQGS----SKWKTLSGDPPKVIARGGFSGLFPGYSSAAFSLALITSVQDAVLWCDVQL  76

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  589
            TKD  GICFPD+ L+N SN+  +   K  +YLVNGVPT  WF +D+    L  + + QG+
Sbjct  77   TKDXAGICFPDLLLNNNSNIDMVLPKKDKSYLVNGVPTKGWFTVDYTLDDLASIYVTQGI  136

Query  590  YSRSSRFDG  616
            YSR++RFDG
Sbjct  137  YSRTNRFDG  145



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = +2

Query  215  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  394
            S + LV+AQGS  +T+ W TLSG  PLVIARGGFSG++PDSS  AYS A  TSL NVI+W
Sbjct  22   SVLPLVSAQGS--NTTSWNTLSGSPPLVIARGGFSGIYPDSSDIAYSLAAQTSLANVILW  79

Query  395  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-LTLV  571
            CDVQLTKD  GIC PDIKL+NA+++  + + K  TY VNGV T+ +F +D+  K+ L+ V
Sbjct  80   CDVQLTKDREGICIPDIKLENATDIGHVSEFKSKTYSVNGVQTSGYFSVDYTLKELLSNV  139

Query  572  NLQQGVYSRSSRFDG  616
             L QG Y+R++RFDG
Sbjct  140  VLIQGDYTRTNRFDG  154



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = +2

Query  185  RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            R +  L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS   
Sbjct  5    RVLAILILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTL  61

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  544
             T   NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVN V T  WF +D
Sbjct  62   DTCGPNVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNEVSTRGWFSVD  121

Query  545  FNFKQLTLVNLQQGVYSRSSRFDG  616
            +N  +L  V++ QGVYSR+++FDG
Sbjct  122  YNLAELANVSVVQGVYSRTNKFDG  145



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKD  GIC+PD+KL+N S + +++  ++ +YLVNGVPT  WF IDF+ + L  V+L
Sbjct  74   DVQLTKDDFGICYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWFTIDFSLRDLKNVSL  133

Query  578  QQGVYSRSSRFDG  616
             QG+ S++ + DG
Sbjct  134  IQGILSQTGKIDG  146



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 101/137 (74%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  382
             L    VT++A      + S W TL+G+AP ++A+GGFSGLFPDSS +AYSFA + S  +
Sbjct  20   FLFLQQVTVIA-----RNASAWLTLTGNAPAIVAKGGFSGLFPDSSHDAYSFALIASSPD  74

Query  383  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  562
             I+WCDV+LTKDG+GIC PDIKLDN ++++ ++ + Q+ YLVNGV TT WF +D++ ++L
Sbjct  75   TILWCDVRLTKDGLGICLPDIKLDNCTDISNIYPNGQNVYLVNGVNTTGWFSVDYSIQEL  134

Query  563  TLVNLQQGVYSRSSRFD  613
            + V + Q +YSR+ RFD
Sbjct  135  STVAVTQSIYSRTFRFD  151



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  173  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
            +  A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FDLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINDVLPQKEKTYLVNGVSTKG  116

Query  530  WFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            WF +D+ +  L  +++ QG+YSRS+RFDG
Sbjct  117  WFTVDYTWDGLVNISVTQGIYSRSNRFDG  145



>emb|CDY60410.1| BnaC02g45300D [Brassica napus]
Length=136

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQTLSGDAPLVIARGGFSGLFPDSS +AY+ A  TS+   ++WC
Sbjct  14   IQLFAAQIDAKRSKSPWQTLSGDAPLVIARGGFSGLFPDSSIDAYNNAMQTSVAGAVLWC  73

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKDG GICFPD+KL+NAS++  ++ ++Q +Y VNGV    WF IDF  + L  V+ 
Sbjct  74   DVQLTKDGHGICFPDLKLNNASSIGYVYPNRQKSYPVNGVTIQGWFTIDFALRDLKNVSC  133

Query  578  Q  580
            +
Sbjct  134  K  134



>emb|CDY12600.1| BnaA02g12680D [Brassica napus]
Length=831

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  622  IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  681

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKD  GIC+PD+KL+N S + +++  ++ +YLVNGVPT  WF IDF+ + L  V+L
Sbjct  682  DVQLTKDDFGICYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWFTIDFSLRDLKNVSL  741

Query  578  QQGVYSRSSRFDG  616
             QG+ S++ +  G
Sbjct  742  IQGILSQTGKIHG  754



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TL G  PLVIARGGFSG+FPDSS  +Y+ A  TS  NV +WCDVQLTKDGVGICFP
Sbjct  22   SGWKTLQGSPPLVIARGGFSGIFPDSSSPSYNLALKTSSLNVTLWCDVQLTKDGVGICFP  81

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            D KLDNA++++ ++  K   Y VN   T  WF  D+NF +L  V+L QGVYSR+++FDG
Sbjct  82   DFKLDNATDISVVYPGKAKDYSVNNFSTRGWFSADYNFNELANVSLVQGVYSRTNKFDG  140



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L A Q  +  S S+WQTLSG+AP VIARGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  30   IQLFAPQIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWC  89

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKDGVGICFPD+ L NAS V  ++ + Q++Y V+GV T  WF ID   K L  V+L
Sbjct  90   DVQLTKDGVGICFPDLNLANASTVQFVYTNGQNSYPVHGVTTQGWFAIDSTLKDLQNVSL  149

Query  578  QQGVYSRSSRFDG  616
             +G+ SRS +FDG
Sbjct  150  IRGILSRSDKFDG  162



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  589
            TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP+D+  K L+ V L QGV
Sbjct  78   TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGV  137

Query  590  YSRSSRFDG  616
            YSRS+ FDG
Sbjct  138  YSRSNLFDG  146



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTL+G+APL+IARGGFSG+FPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLIIARGGFSGMFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FP + + N SNV   +   +++YL+NGV T  WF +DF  K L  V L +GV SRS+ FD
Sbjct  100  FPYVTMYNDSNVRDAYPKNKNSYLLNGVLTQDWFTVDFTSKDLNTVFLTRGVLSRSNAFD  159



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 97/141 (69%), Gaps = 3/141 (2%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
            LL C  V   L A Q  +  S S+WQTL+G+ P VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCGVVLIHLFATQIDAQRSRSRWQTLTGEVPRVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            + +V++WCDVQLTKDGVGIC+PD+ L NAS V  ++ + Q +Y VNGV T  WF ID   
Sbjct  76   VADVVLWCDVQLTKDGVGICYPDLNLANASTVQFVYPNGQKSYPVNGVTTQGWFTIDSTL  135

Query  554  KQLTLVNLQQGVYSRSSRFDG  616
            + L  V L +G+ SRS +FDG
Sbjct  136  RDLQNVALIRGILSRSDKFDG  156



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  589
            TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP+D+  K L+ V L QGV
Sbjct  78   TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGV  137

Query  590  YSRSSRFDG  616
            YSRS+ FDG
Sbjct  138  YSRSNLFDG  146



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  173  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGD P V+ARGGFSGLFP  +  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDPPKVVARGGFSGLFPGFTSAA  56

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
            ++FA +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNFALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  530  WFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            WF +D+ +  L  +++ QG+YSR++RFDG
Sbjct  117  WFTVDYTWDGLVNISVTQGIYSRANRFDG  145



>emb|CDY12601.1| BnaA02g12690D [Brassica napus]
Length=136

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKDG G+ FPD+KL+NASN+  ++ ++Q +Y VNGV T  WF IDF+ + L  V+ 
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIYPNRQKSYPVNGVTTQGWFTIDFSLRDLNNVSC  133

Query  578  Q  580
            +
Sbjct  134  K  134



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  173  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
            ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  530  WFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            WF +D+ +  L  +++ QG+YSR++RFDG
Sbjct  117  WFTVDYTWDGLVNISVTQGIYSRTNRFDG  145



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  407  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  586
            LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+ V+L+Q 
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQS  135

Query  587  VYSRSSRFD  613
            ++SR+ RFD
Sbjct  136  IFSRTPRFD  144



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 103/163 (63%), Gaps = 25/163 (15%)
 Frame = +2

Query  203  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSG----------------------DAPLVIAR  307
            LL C  V   L AAQ  +  STS+WQTL+G                      DAPLVIAR
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGESCSHFISFFCALFPRKQENLCDAPLVIAR  77

Query  308  GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  487
            GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  78   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  137

Query  488  KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ +Y VNGV T  WFP DF+  +L    L +G+ SR+ RFDG
Sbjct  138  REKSYSVNGVTTKGWFPNDFSLTELQNFLLIRGILSRTDRFDG  180



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            DI L N++ +AT++ +K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG
Sbjct  88   DINLANSTYIATIYPNKTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDG  146



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            DI L N++ +AT++ +K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG
Sbjct  88   DINLANSTYIATIYPNKTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDG  146



>ref|XP_009127509.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=136

 Score =   141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  577
            DVQLTKDG G+ FPD+KL+NASN+  ++ ++Q +Y VNGV T  WF IDF+ + +  V+ 
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIYPNRQKSYPVNGVTTHGWFTIDFSLRDINNVSC  133

Query  578  Q  580
            +
Sbjct  134  K  134



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  407  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  586
            LTKDG+G+C P+IK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+ V+L+Q 
Sbjct  76   LTKDGLGVCLPEIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQS  135

Query  587  VYSRSSRFD  613
            ++SR+ RFD
Sbjct  136  IFSRTPRFD  144



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  173  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
            ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  530  WFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            WF +D+ +  L  +++ QG+YSR++RFDG
Sbjct  117  WFTVDYTWDGLVNISVTQGIYSRTNRFDG  145



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  176  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  355
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  356  FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  535
            FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125

Query  536  PIDFNFKQLTL-VNLQQGVYSRSSRFD  613
             +D+   +LT  V L Q +YSR   FD
Sbjct  126  SVDYTLSELTQSVALTQAIYSRPDGFD  152



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  206  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  385
            ++ S V L     +    S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + 
Sbjct  9    VVASVVLLWLGVATAQGDSPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDT  68

Query  386  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  565
            +++CDV+LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+
Sbjct  69   VLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELS  128

Query  566  LVNLQQGVYSRSSRFD  613
             V+L+Q ++SR+ RFD
Sbjct  129  QVSLKQAIFSRTPRFD  144



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  206  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  385
            ++ S V L     +    S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + 
Sbjct  9    VVASVVLLWLGVATAQGDSPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDT  68

Query  386  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  565
            +++CDV+LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+
Sbjct  69   VLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELS  128

Query  566  LVNLQQGVYSRSSRFD  613
             V+L+Q ++SR+ RFD
Sbjct  129  QVSLKQAIFSRTPRFD  144



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 100/151 (66%), Gaps = 5/151 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M  LRS  + +LLC  V   L A +  +  S S+WQTLSG+AP VIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCGVVLIQLFAPRIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSL  71

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  523
            +AY+ A   S+ +V++WCDVQLTK GVGICFPD+ L NAS V   +   Q +Y VNGV T
Sbjct  72   DAYNLAIQKSVADVVLWCDVQLTKYGVGICFPDLNLANASTVQYAYPKGQKSYPVNGVTT  131

Query  524  TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
              WF ID   + L  V L +G+ SRS RFDG
Sbjct  132  QGWFTIDSTMRDLQNVALIRGILSRSDRFDG  162



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            TS WQTLSG+APLVIA+GGFSG+FPDSS++AY+ A +TSL NV++WCDVQLTKDG GICF
Sbjct  32   TSPWQTLSGNAPLVIAKGGFSGIFPDSSYHAYALALITSLPNVVLWCDVQLTKDGDGICF  91

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            P + L N+S+++ +F D +  Y VNG     +F +DF    LT V L QG+YSR+++FDG
Sbjct  92   PYLNLGNSSSISYVFNDTK-MYRVNGQLMEGFFSVDFTLDDLTNVYLTQGIYSRANKFDG  150


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 62/124 (50%), Gaps = 12/124 (10%)
 Frame = +2

Query  236  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  415
            A  STNS       SG APLVI+  G SG++P S+  AY  A      +VI  C VQ+T+
Sbjct  346  AHLSTNS-------SGKAPLVISHNGASGIYPSSTDIAYKQA-FDDGADVID-CAVQMTQ  396

Query  416  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYS  595
            DGV IC   I L + +NV     + +ST +    P    F  +  ++++  +   + V S
Sbjct  397  DGVSICLGSINLMDGTNVVQTDFNSRSTTIRQIQPIPGIFTFNLTWEEIKTL---KPVIS  453

Query  596  RSSR  607
              SR
Sbjct  454  NPSR  457



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 4/140 (3%)
 Frame = +2

Query  209  LCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            LC  + L+   AAQ  +  STS++  L GDAP VIARGGFSGL PDSS +AY+ A  TS+
Sbjct  20   LCCGIVLILLFAAQIDAQRSTSRFIYLPGDAPRVIARGGFSGLLPDSSLDAYNLAIQTSV  79

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
             +V++WCDVQLTKDGVGICFPD+ + NAS V  ++ + Q +Y VNGV T  WF I F+ +
Sbjct  80   ADVVLWCDVQLTKDGVGICFPDLNMANASTVQNVYPNGQKSYPVNGVSTQGWFTIAFSLR  139

Query  557  QLTLVNLQQGVYSRSSRFDG  616
             L  V+L +G+ SR+ +FDG
Sbjct  140  DLQNVSLIRGILSRTDKFDG  159



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +2

Query  242  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  421
             +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD 
Sbjct  21   AAAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDE  80

Query  422  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  601
            +GIC PDIK+DN +N+   +   Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+
Sbjct  81   IGICLPDIKMDNCTNIPDFYAQGQKSYLVNGVPTSGWFSVDYNGTELEQVTLKQSINSRT  140

Query  602  SRFD  613
             RFD
Sbjct  141  PRFD  144



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            + AAQ +T+    W+TLSG AP ++A+GGFSGLFPDSS +AY F   +S  + +++CDV+
Sbjct  20   VAAAQKATS----WKTLSGKAPAIVAKGGFSGLFPDSSPDAYGFVQYSSSPDTVLYCDVR  75

Query  407  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  586
            LTKD VG+C PDIK+DN +N+A ++   Q +YLVNGVPT+ WF +D+N  +L  V+L Q 
Sbjct  76   LTKDEVGLCLPDIKMDNCTNIADIYAQGQKSYLVNGVPTSGWFSVDYNNTELGQVSLIQS  135

Query  587  VYSRSSRFD  613
            + SRS RFD
Sbjct  136  IASRSPRFD  144



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  206  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  385
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  386  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  565
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF +D+N  +L 
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWFSVDYNGTELG  128

Query  566  LVNLQQGVYSRSSRFD  613
             V+L+Q ++SRS RFD
Sbjct  129  QVSLKQSIFSRSPRFD  144



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  206  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  385
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  386  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  565
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF +D+N  +L 
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWFSVDYNGTELG  128

Query  566  LVNLQQGVYSRSSRFD  613
             V+L+Q ++SRS RFD
Sbjct  129  QVSLKQSIFSRSPRFD  144



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  176  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  355
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  356  FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  535
            FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125

Query  536  PIDFNFKQLTL-VNLQQGVYSRSSRFD  613
             +D+   +LT  V L Q +YSR   FD
Sbjct  126  SVDYTLSELTQSVALTQAIYSRPDGFD  152



>ref|XP_010422831.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=146

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = +2

Query  206  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  376
            L C  V   L AAQ  +  S S+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  TS+
Sbjct  17   LFCGVVLINLFAAQIDAQRSRSRWQTLSGDAPRVIARGGFSGLLPDSSVDAYNLATQTSV  76

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
              V++WCDVQLTKDGVGICFPD+ L NAS V   + + Q +Y VNGV T  WF ID   +
Sbjct  77   AEVVLWCDVQLTKDGVGICFPDLNLANASTVQYAYPNGQKSYPVNGVTTQGWFTIDSTLR  136

Query  557  QL  562
             L
Sbjct  137  DL  138



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 97/142 (68%), Gaps = 3/142 (2%)
 Frame = +2

Query  194  FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  373
             N+LL    V L  A  +  S +KWQTLSG+AP VIARGGFSGLFP+SS  AY FA  TS
Sbjct  3    LNVLLFI--VLLHGAAAAVVSPTKWQTLSGNAPAVIARGGFSGLFPESSQFAYQFAQSTS  60

Query  374  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  553
            L NV+++CD+QLTKDG GIC  D++LDN++ ++ +F   ++TY VNG P   WF IDF  
Sbjct  61   LKNVVLYCDLQLTKDGAGICHSDLRLDNSTTISAVFPKGRTTYSVNGRPVQGWFSIDFTS  120

Query  554  KQL-TLVNLQQGVYSRSSRFDG  616
             QL   V L Q ++SR S FDG
Sbjct  121  DQLYNNVTLIQSIFSRPSVFDG  142



>ref|NP_001142429.1| uncharacterized protein LOC100274608 [Zea mays]
 gb|ACG23909.1| hypothetical protein [Zea mays]
Length=364

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  FNLLLLCSAVTLVAAQGS-TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            F  LL C    +V A G      S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +T
Sbjct  28   FAALLGCVVALVVGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMIT  87

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF  DF 
Sbjct  88   SAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWFVSDFT  147

Query  551  FKQLTLVNLQQGVYSRSSRFDG  616
              +L  V+L Q ++ R+ RFDG
Sbjct  148  IAELQSVSLTQAIWPRTRRFDG  169



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 7/128 (5%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            A +GST     W+TLSGDAP VIA+GGFSGLFPDSS  AYSFA   S  +   WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDAPAVIAKGGFSGLFPDSSDPAYSFAA--SNQDSAQWCDVRLT  78

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDGVGIC PDIK+DN + ++ LF   + TYLVNGV TT WF +D+N   LT V L + + 
Sbjct  79   KDGVGICLPDIKMDNCTTISDLFPKGKKTYLVNGVSTTGWFSVDYNSIDLTNVTLLRAIL  138

Query  593  SRSSRFDG  616
            SR++RFDG
Sbjct  139  SRTNRFDG  146



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 101/141 (72%), Gaps = 5/141 (4%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            + +L+LL   V   A +GS+     W+TL+G+AP +IA+GGFSG+FPDSS  AY FA + 
Sbjct  10   VSSLVLLWLGVAAAAQKGSS-----WKTLNGNAPAIIAKGGFSGIFPDSSEFAYQFALIA  64

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S ++ I++CDV+LTKDG+GIC PDIK+DN +N+   ++    +YLVNGV T  WF +D+N
Sbjct  65   SSSDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGSKSYLVNGVSTAGWFSVDYN  124

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
              +L  V+L+Q ++SR+ RFD
Sbjct  125  GTELGQVSLKQSIFSRTPRFD  145



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  221  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  397
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  398  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN-  574
            DVQLTKD  G+C+PD+KL+N S + +++  ++ +YLVNGVPT  WF IDF+ + L  V+ 
Sbjct  74   DVQLTKDDFGMCYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWFTIDFSLRDLKNVSC  133

Query  575  -LQQGVYSRSSRFDG  616
             L QG+ S++ +  G
Sbjct  134  KLIQGILSQTGKIHG  148



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  248  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  427
            TNST+ W TL+G  PLVIARGGFSG+FPDSS  AY FA  T L N+I WCDVQLTKD  G
Sbjct  31   TNSTT-WNTLTGAPPLVIARGGFSGIFPDSSDLAYIFAVRTGLKNLIAWCDVQLTKDRQG  89

Query  428  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSS  604
            ICFPDIKL+NA+++   F ++  TY VNGVPTTA+F +D+  + L + V L QG YSR++
Sbjct  90   ICFPDIKLENATDINYAFPNRSQTYPVNGVPTTAYFAVDYTLEDLRSYVVLTQGDYSRTN  149

Query  605  RFD  613
             FD
Sbjct  150  LFD  152



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSG AP ++A+GGFSGLFPDSS  AY FA + S  + I++CDV+LTKD +GIC P
Sbjct  29   SSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALVASSPDTILYCDVRLTKDEIGICLP  88

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            DI++DN +N+   +   Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+ RFD
Sbjct  89   DIRMDNCTNIPDFYAQGQKSYLVNGVPTSGWFSVDYNGTELGQVTLKQSINSRTPRFD  146



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW  R++   L     +       ++   S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAPLAALLLLLHALIAIASAQRSAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            S A +T+  +V + CDVQLTKD VGIC PDI L N++ +AT + +  ++YLVNGVP   +
Sbjct  61   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIATTYPNDTTSYLVNGVPIRGY  120

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +D+  KQL+ V L QGVYSR++RFDG
Sbjct  121  FSLDYTMKQLSDVLLTQGVYSRTNRFDG  148



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 9/142 (6%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            +  L L CSA           + S W TL G  PLVIA  GFSGLFP SS  AY+ A +T
Sbjct  15   LLQLSLFCSA---------QKTPSSWLTLDGFPPLVIAHNGFSGLFPPSSSYAYNLAMMT  65

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+ +V++WCDVQLTKD  GICFPDIKLDN+SNV  +++D+  TY V+G     +F IDF 
Sbjct  66   SVPDVVLWCDVQLTKDAAGICFPDIKLDNSSNVNLVYEDRVKTYDVDGASVKGYFAIDFT  125

Query  551  FKQLTLVNLQQGVYSRSSRFDG  616
             ++L+ ++L QG+Y+RS  FDG
Sbjct  126  VEELSNISLTQGIYTRSPDFDG  147



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  290  PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  469
            PLVIA+GGFSG+FPDSS+ AYS A +TS+ +V+ WCDVQLTKDG GIC P +KLDN++++
Sbjct  32   PLVIAKGGFSGIFPDSSYAAYSLALITSVPDVVSWCDVQLTKDGAGICAPSVKLDNSTDI  91

Query  470  ATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            + +FKD+  TY VNG+ T  WF IDF    L  V L QG+YSR+++FDG
Sbjct  92   SNIFKDQSRTYSVNGMDTQGWFSIDFTLNDLANVVLTQGIYSRTNKFDG  140



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGIFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++ K L+ V+L QGV+SR+ +FD 
Sbjct  100  ELTINNGTNIQVVYSQGEKNYLVNGVPTSGWFSVDYSIKDLSQVSLIQGVFSRTDKFDA  158



>tpg|DAA63616.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=364

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  194  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF  DF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWFVSDF  146

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
               +L  V+L Q ++ R+ RFDG
Sbjct  147  TIAELQSVSLTQAIWPRTRRFDG  169



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGVFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++ K L+LV+L Q V+SR+ +FD 
Sbjct  100  ELTINNGTNIQVVYPQGEKNYLVNGVPTSGWFSVDYSIKDLSLVSLLQDVFSRTDKFDA  158



>gb|AAV64200.1| unknown [Zea mays]
 tpg|DAA63617.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=382

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  194  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF  DF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWFVSDF  146

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
               +L  V+L Q ++ R+ RFDG
Sbjct  147  TIAELQSVSLTQAIWPRTRRFDG  169



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +2

Query  248  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  427
            T S+S W TL+G+ P+VIARGGFSG+FPDSS  AY  A +TS  NV +WCD+QL KD +G
Sbjct  23   TTSSSSWLTLNGEPPVVIARGGFSGMFPDSSIVAYDSATVTSTPNVTLWCDLQLAKDDIG  82

Query  428  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
             CFP +  +N SN+  +F  ++ +Y+VNGVP+  WFP+D+   +L  + L Q +YSR   
Sbjct  83   FCFPHLSFENGSNIEYVFPGQKKSYIVNGVPSKGWFPVDYTIDELFTLTLTQDIYSRPPI  142

Query  608  FD  613
            FD
Sbjct  143  FD  144



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +2

Query  272  TLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL-TSLTNVIMWCDVQLTKDGVGICFPDIK  448
            TLSGDAPLVIA GGFSGLF DSS+ AY  A L TSL NVI+WCDVQLTK+ V +CFPD+K
Sbjct  3    TLSGDAPLVIAXGGFSGLFLDSSYEAYIMAILETSLPNVIIWCDVQLTKNEVDMCFPDLK  62

Query  449  LDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            LDN S++   +K+ +S YL+N V T  WF IDF+F  L  V  +QGVY R  +FD
Sbjct  63   LDNTSDIDAYYKNNKSKYLMNIVLTQGWFSIDFDFNDLMHVTSKQGVYFRIEKFD  117



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSGDAP VIA+GGFSGLFPDSS  AY FA   S  +   WCDV+LTKDGVGIC P
Sbjct  31   SAWKTLSGDAPAVIAKGGFSGLFPDSSDPAYLFAA--SNQDSAQWCDVRLTKDGVGICLP  88

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            DIK+DN + ++ LF   + TY VNGV TT WF +D+N   LT V L + + SR++RFDG
Sbjct  89   DIKMDNCTTISDLFPKGKKTYRVNGVSTTGWFSVDYNSIDLTNVTLLRAILSRTNRFDG  147



>gb|AAV64238.1| unknown [Zea mays]
Length=382

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  194  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRLPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF  DF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWFVSDF  146

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
               +L  V+L Q ++ R+ RFDG
Sbjct  147  TIAELQSVSLTQAIWPRTRRFDG  169



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 99/153 (65%), Gaps = 8/153 (5%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  343
            M     +F L +L SAV LVAAQ    S N+TS WQTL G+APLVIA+GGFSG+FPDSS 
Sbjct  1    MTTSHPLFLLFVLHSAV-LVAAQSYRASKNTTSPWQTLHGNAPLVIAKGGFSGIFPDSSI  59

Query  344  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQST---YLVNG  514
            +AY  + L  L+NVI+WCDVQLTKDG GICFP + LDN+S++     +       Y VNG
Sbjct  60   DAYE-STLLLLSNVILWCDVQLTKDGAGICFPYLNLDNSSDITFYIPNDSKNNRIYYVNG  118

Query  515  VPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
             P    F +DF    L    L QG++SRS+ FD
Sbjct  119  QPMQGHFSVDFTLNDLKNFFLVQGIFSRSNVFD  151



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            MW  R++F+ L    A+       + +  S W TL+G+ PLV+A GGFSG+FP SS  AY
Sbjct  1    MWTPRALFSTL----ALLFHLLHSARSDRSPWNTLTGNPPLVVAHGGFSGVFPQSSEVAY  56

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            + A +TS   V +WCDVQLTKD VGIC P++ LDN++ ++ +F +K +TY VN VPT  +
Sbjct  57   NLAVMTSGPEVSIWCDVQLTKDEVGICLPNVILDNSTFISYIFPNKSTTYNVNNVPTNGY  116

Query  533  FPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            F +D+  K L+ V L+Q VYSRS  FDG
Sbjct  117  FSLDYTLKDLSNVPLKQVVYSRSPVFDG  144



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = +2

Query  245  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  424
            +  ++S W+TLSG++P +IA+GGFSGLFPDSSF AY    L S  +  +WCDV+LTKD V
Sbjct  26   TARTSSAWRTLSGNSPAIIAKGGFSGLFPDSSFYAYKSVSLFSANDTTLWCDVRLTKDSV  85

Query  425  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSS  604
            GIC PDIKLDN + +   F   + TY+VNG  T+ WF +D++   L  V L Q +YSR+ 
Sbjct  86   GICLPDIKLDNCTTIQYYFDKGKKTYVVNGANTSGWFSVDYSISDLAPVTLTQAIYSRTY  145

Query  605  RFD  613
            RFD
Sbjct  146  RFD  148



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 6/141 (4%)
 Frame = +2

Query  206  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + 
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF +DF 
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWFALDFT  137

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
              +L  V+L Q ++SR+ RFD
Sbjct  138  KDELQSVSLTQAIWSRTYRFD  158



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D+   QL   V L Q +YSR S FDG
Sbjct  114  FALDYTSDQLFNNVTLTQSIYSRPSLFDG  142



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D+   QL   V L Q +YSR S FDG
Sbjct  114  FALDYTSDQLFNNVTLTQSIYSRPSLFDG  142



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            LV AQ    S   WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+
Sbjct  32   LVTAQTPKGS---WQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVR  88

Query  407  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  586
            LTKDGVG+C P++ ++N +N+  ++   +  Y VNGVPT+ WF +D++   L+ V L QG
Sbjct  89   LTKDGVGVCLPELTINNGTNIDVVYPQGKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQG  148

Query  587  VYSRSSRFDG  616
            V SR++RFD 
Sbjct  149  VLSRTNRFDA  158



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 6/141 (4%)
 Frame = +2

Query  206  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + 
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF +DF 
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWFALDFT  137

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
              +L  V+L Q ++SR+ RFD
Sbjct  138  KDELQSVSLTQAIWSRTYRFD  158



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = +2

Query  200  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  379
              L    + LV A+  T+++S+WQTLSG AP +IARGGFSGLFPDSS +A+ F    S  
Sbjct  64   FFLAVQHLGLVTAK--TSNSSRWQTLSGRAPAIIARGGFSGLFPDSSLDAFLFGVSVSSN  121

Query  380  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  559
            +  +WC+VQLTKD VGIC PDIKLDN +N+A ++  ++  Y+VNGV T  WF +D+   +
Sbjct  122  DSFLWCNVQLTKDNVGICVPDIKLDNCTNIANVYPGREKVYVVNGVRTPGWFSVDYKATE  181

Query  560  LTL-VNLQQGVYSRSSRFD  613
            L   V+L Q +YSR+  FD
Sbjct  182  LAQSVSLIQAIYSRTFVFD  200



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            +  KW TLSG+AP +IA+GGFSGLF DSS+NAY    L S ++  +WCDV+LTKDGVGIC
Sbjct  26   TAQKWLTLSGNAPAIIAKGGFSGLFADSSYNAYKSVSLFSSSDTTLWCDVRLTKDGVGIC  85

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
             PDI L+N +++   +   + +Y+VNGVPT+ WF +D++  +L  V + Q +YSR++ FD
Sbjct  86   LPDITLNNCTDIQYSYPQGKKSYMVNGVPTSGWFSVDYDKNELAQVTVTQAIYSRTNAFD  145



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +2

Query  242  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  421
             +    S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG
Sbjct  24   AAAQKASTWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDG  83

Query  422  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  601
             GIC PDI++DN +N+A ++   + TY VNGV T  WF +D++   L+ VNL Q ++SR 
Sbjct  84   AGICLPDIRMDNCTNIANVYPKGKKTYSVNGVSTPGWFSVDYDSTGLSKVNLVQSLFSRV  143

Query  602  SRFDG  616
              +DG
Sbjct  144  PYYDG  148



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 4/122 (3%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S ++TL GDAPLVIA+GGFSG+FPDSS+ A+SFA L S  +  +WCDVQLTKDGVGIC  
Sbjct  42   SSYKTLRGDAPLVIAKGGFSGVFPDSSYYAFSFALLASAPDTSLWCDVQLTKDGVGICLR  101

Query  440  DIKLDNASNVATLF---KDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSR  607
            DI + N +N A ++     K++ Y+++GVP T +F +DF   ++ T ++L QG+YSR+ R
Sbjct  102  DINMSNCTNAAQVYPVKNKKEAKYVIDGVPKTGYFSLDFTLSEIQTTLSLTQGIYSRTER  161

Query  608  FD  613
            FD
Sbjct  162  FD  163



>gb|EAY86479.1| hypothetical protein OsI_07859 [Oryza sativa Indica Group]
Length=709

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +2

Query  242  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  421
             +    S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLT+DG
Sbjct  24   AAAQKASTWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTRDG  83

Query  422  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  601
             GIC PDI++DN +N+A ++   + TY VNGV T  WF +D++   L+ VNL Q ++SR 
Sbjct  84   AGICLPDIRMDNCTNIANVYPKGKKTYSVNGVSTPGWFSVDYDSTGLSKVNLVQSLFSRV  143

Query  602  SRFDG  616
              +DG
Sbjct  144  PYYDG  148



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I WCDV+LTKDGVGIC P
Sbjct  42   SAWQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLVGSSDTISWCDVRLTKDGVGICLP  101

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++   L+ V L Q V SR+ +FD 
Sbjct  102  ELTINNGTNIQMVYPQGKKNYLVNGVPTSGWFSVDYSINDLSQVLLTQEVLSRTDKFDA  160



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = +2

Query  236  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  415
            AQG     S ++TL+GD PLVIA+GGFSG+FPDSS +A++FA L S  +  +WCDVQLTK
Sbjct  42   AQG-IRRPSSYKTLTGDVPLVIAKGGFSGVFPDSSQDAFAFALLASAPDTSLWCDVQLTK  100

Query  416  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYS  595
            DGVGIC PDI + N +++A ++  ++S Y+V+G P T WFP+DFNF +   V L Q ++S
Sbjct  101  DGVGICLPDINMQNCTDIAQVYSARKSKYVVHGAPKTGWFPVDFNFSEFQGVILTQRIWS  160

Query  596  RSSRFD  613
            R+ +FD
Sbjct  161  RTDKFD  166



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ L N++N+  +F +K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG
Sbjct  87   NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDG  145



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            A +GST     W+TLSG AP++IA+GGFSGLFPDSS  AY F  + S  +  + CDV+LT
Sbjct  27   AQKGST-----WKTLSGKAPVIIAKGGFSGLFPDSSDLAYQFVPIASSPDTALLCDVRLT  81

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDG GIC P+IK+DN + ++ +F   +STY VNGV TT WF +DF    L  V L+Q ++
Sbjct  82   KDGAGICLPNIKMDNCTFISDVFPQGKSTYNVNGVSTTGWFSVDFTSTDLQNVTLRQSIF  141

Query  593  SRSSRFDG  616
            SR S FDG
Sbjct  142  SRPSYFDG  149



>dbj|BAD17454.1| glycerophosphoryl diester phosphodiesterase 2 precursor-like 
protein [Oryza sativa Japonica Group]
Length=136

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLP  89

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ  580
            DI++DN +N+A ++   + TY VNGV T  WF +D++   L+ VN +
Sbjct  90   DIRMDNCTNIANVYPKGKKTYSVNGVSTPGWFSVDYDSTGLSKVNCK  136



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  173  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            M++    F+LL+  S     +    T+S +KW+TL+GD P+VIARGGFSG+FPDSS  A 
Sbjct  1    MFRCLLFFSLLIHSSLAQKSSGGSGTSSPTKWKTLNGDKPVVIARGGFSGIFPDSSEFAV  60

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
              A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN +++A +F   + TY VNG     W
Sbjct  61   DMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVFPKGEKTYTVNGQDLKGW  120

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D+   +L   V L Q V SR S FDG
Sbjct  121  FAVDYTSDELFNNVTLVQNVLSRPSLFDG  149



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            ++ L N++N+  +F +K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG
Sbjct  87   NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDG  145



>ref|XP_004979884.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=1128

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = +2

Query  206  LLCSAVTLVAAQGSTNSTSKW-----QTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            LLC    +V A G+  +   W     +TLSGDAP V+A+GGFSG+FPDSS +AYSF  + 
Sbjct  19   LLCCGCVMVLA-GAAAAQGPWLPYAYKTLSGDAPRVVAKGGFSGVFPDSSSDAYSFTLMA  77

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S     +WCDVQLTKDGVG+C  DI +DN +NVA  +  ++ TY+++GV    WF +DF 
Sbjct  78   SAAGTTLWCDVQLTKDGVGVCLRDINMDNCTNVAQAYPARKRTYVIDGVRKNGWFALDFT  137

Query  551  FKQLTLVNLQQGVYSRSSRFD  613
              +L  V L Q ++SR+  FD
Sbjct  138  KDELQSVILTQAIWSRTYSFD  158



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  236  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  415
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  416  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  592
            DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F +D+   +L + V L QG +
Sbjct  85   DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDF  144

Query  593  SRSSRFD  613
            +R+  FD
Sbjct  145  ARNPNFD  151



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQ  TN  S W TL+G+ PLVIA GGFSG+FPDSS  AYS A  TSL +V +WCDVQL
Sbjct  26   VSAQ--TNKRSDWNTLTGNPPLVIAHGGFSGIFPDSSGAAYSLALQTSLPDVALWCDVQL  83

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  589
            TKD  GIC P++ L N++ V+    +K ++Y VNGV T  +F +D+  + L+ V L QGV
Sbjct  84   TKDAAGICLPNVNLLNSTYVSIAIPNKTTSYSVNGVSTRGYFSVDYTLEDLSNVFLSQGV  143

Query  590  YSRSSRFDG  616
            +SRS+  D 
Sbjct  144  FSRSALLDA  152



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +2

Query  245  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  424
            S NST  W+TL+G+AP+VIARGGFSGLFPDSS  A+ F    +L   I WCDVQLTKDG 
Sbjct  29   SRNSTRIWRTLTGNAPVVIARGGFSGLFPDSSTFAFDFPNSLNLPRPISWCDVQLTKDGK  88

Query  425  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT-LVNLQQGVYSRS  601
            G+C P + LDN +N+  +++  + TY VNG   T WF IDF  +QL   V L QG+++R+
Sbjct  89   GVCLPSLLLDNCTNIQEIYQTGKKTYTVNGEILTGWFSIDFTIEQLVNNVTLIQGIFTRT  148

Query  602  SRFDG  616
            + FD 
Sbjct  149  NAFDA  153



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +2

Query  263  KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  442
            KW TLSG+AP VIARGGFSGLFP+SS  A SFA   SL+NV++ C++QLTKDG GIC  D
Sbjct  28   KWATLSGNAPEVIARGGFSGLFPESSDFANSFALSVSLSNVVLLCELQLTKDGRGICRSD  87

Query  443  IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  613
            ++LDN++N+A ++   + TY+VNG P   WF IDF  +QL   V L Q ++SR S FD
Sbjct  88   LRLDNSTNIADVYPHNKKTYIVNGKPLQGWFAIDFLERQLFNKVTLIQNIFSRPSIFD  145



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  236  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  415
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  416  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  592
            DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F +D+   +L + V L QG +
Sbjct  85   DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDF  144

Query  593  SRSSRFD  613
            +R+  FD
Sbjct  145  ARNPNFD  151



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  227  LVAAQGSTNS----TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  394
            +V++Q   NS    TS W TLSG  PLVIA+GGFSGLFPDSS  +Y F+ +    + I W
Sbjct  32   VVSSQSLKNSNLTATSPWLTLSGGTPLVIAKGGFSGLFPDSSSFSYKFSYVAGSPDTISW  91

Query  395  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  574
            CDV+LTKDG G+C PDI LDN +N+  ++ + +  Y+VNGVPT+ WF +D++ + L+ V+
Sbjct  92   CDVRLTKDGNGVCLPDIVLDNCTNIKLVYPEGKMNYIVNGVPTSGWFSVDYDIQNLSQVS  151

Query  575  LQQGVYSRSSRFDG  616
            L Q + SRS++FD 
Sbjct  152  LAQAILSRSNKFDA  165



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 88/128 (69%), Gaps = 7/128 (5%)
 Frame = +2

Query  233  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  412
            A +GST     W+TLSGD P +IA+GGFSGLFPDSS NAY FA ++  + V  WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDPPAIIAKGGFSGLFPDSSENAYLFATISQDSAV--WCDVRLT  78

Query  413  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  592
            KDG GIC PDI++++ ++++  F   + TY VNGV  T WF +D+    L  V L+Q V 
Sbjct  79   KDGSGICLPDIQMESCTSISNAFPKGKKTYNVNGVSVTGWFSVDYKDTDLGKVFLRQSVS  138

Query  593  SRSSRFDG  616
            SRS R+DG
Sbjct  139  SRSERYDG  146



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 6/130 (5%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            VA  GST     W+TLSG AP V+A+GGFSGLFPDSS  AY F G++S  +  +WCDV+L
Sbjct  31   VAQNGST-----WKTLSGKAPAVVAKGGFSGLFPDSSDYAYQFVGISSSPDTTVWCDVRL  85

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQG  586
            TKDG GIC P I +DN + +A++F   + TY VNGV T  WF +D+    L   V+L+Q 
Sbjct  86   TKDGAGICLPSINMDNCTIIASVFPQGKKTYKVNGVSTAGWFSVDYTSTVLLQNVSLKQS  145

Query  587  VYSRSSRFDG  616
            V SR+  +DG
Sbjct  146  VLSRTPAYDG  155



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS  AY F    SL NVI+WCDVQL
Sbjct  28   VSAQVSNATT--WNTLSGNPPLVIARGGFSGIFPDSSEKAYIFGVTASLKNVIVWCDVQL  85

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  586
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F +D+  K L + V L QG
Sbjct  86   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSVDYTLKDLRSNVFLVQG  145

Query  587  VYSRSS  604
             +SR++
Sbjct  146  DHSRAT  151



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            +LDN++ ++T+F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG
Sbjct  108  RLDNSTTISTVFPKRDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDG  165



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  586
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F  D+  K+L + V L QG
Sbjct  85   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQG  144

Query  587  VYSRSS  604
             YSR +
Sbjct  145  DYSRPT  150



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSG AP+++A+GGFSGLFP+SS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  35   STWKTLSGKAPVIVAKGGFSGLFPESSLYAYQILGSLSSPDTVMWCDVRLTKDGGGICLP  94

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
             I +DN + +A  F   + TY VNGV T  WF +D+    L  V+L+Q V SR+  +DG
Sbjct  95   SIDMDNCTTIANFFPQGKKTYNVNGVSTVGWFSVDYTSTDLLNVSLKQSVLSRTGVYDG  153



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 93/141 (66%), Gaps = 7/141 (5%)
 Frame = +2

Query  212  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL--  376
            C  + LV   AAQG     S ++TLSG APLVIA+GGFSG+FPDSS +AYSFA + S   
Sbjct  132  CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVIAKGGFSGVFPDSSQDAYSFAKVASAPG  190

Query  377  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  556
            T   MWCDVQLTKDGVG+C  DI ++N + V   +  ++ TY+++G+  T WF  DF   
Sbjct  191  TGTAMWCDVQLTKDGVGVCLRDINMNNCTTVGQAYPARKRTYVIDGMHKTGWFVSDFTIA  250

Query  557  QL-TLVNLQQGVYSRSSRFDG  616
            +L + V L Q ++SRS RFD 
Sbjct  251  ELQSAVYLTQAIWSRSERFDA  271



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            +KW+TLSG+APLVIARGGFSG+FP+SS  AY FA  +SL   ++ CD+QLTKDG GIC  
Sbjct  44   AKWKTLSGNAPLVIARGGFSGIFPESSQFAYQFALASSLKETVLLCDLQLTKDGAGICLS  103

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            D+KLDN++ ++++F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG
Sbjct  104  DLKLDNSTTISSVFPKRDTTYSVNGQSLKGWFSVDFTTDELISNVTTIQNIFSRPSLFDG  163



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            +   LLL S V       S +++ KW TL+G+ P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSFVIHATLANSESASKKWLTLNGERPSVIARGGFSGLFPESSDFANQMALGT  60

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+    TY VNG   T WF +DF 
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEKGSKTYKVNGQDLTGWFALDFT  120

Query  551  FKQLTL-VNLQQGVYSRSSRFDG  616
              QL   V+L Q ++SR S FDG
Sbjct  121  ADQLLANVSLVQNIFSRPSAFDG  143



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  586
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F  D+  K+L + V L QG
Sbjct  85   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQG  144

Query  587  VYSRSS  604
             YSR +
Sbjct  145  DYSRPT  150



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            +   LLL S V       S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSLVIHATLANSESASKKWLTLNGQRPSVIARGGFSGLFPESSDFANQMALGT  60

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            S+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+    TY VNG   T WF +DF 
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEKGSKTYKVNGQDLTGWFALDFT  120

Query  551  FKQLTL-VNLQQGVYSRSSRFDG  616
              QL   V+L Q ++SR S FDG
Sbjct  121  ADQLLANVSLVQNIFSRPSAFDG  143



>ref|XP_010474169.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=388

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            +  L GDAP VIARGGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGICFPD+
Sbjct  107  YHYLPGDAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDL  166

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  562
             L NAS V  ++ + Q +Y VNGV T  WF ID   K L
Sbjct  167  NLANASTVQFVYPNGQKSYPVNGVTTQGWFSIDSTLKDL  205



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            +LDN++ ++T+F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG
Sbjct  108  RLDNSTTISTVFPKRDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDG  165



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +2

Query  275  LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  454
            + G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+LTKDGVG+C P++ ++
Sbjct  10   IEGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVRLTKDGVGVCLPELTIN  69

Query  455  NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            N +N+  ++   +  Y VNGVPT+ WF +D++   L+ V L QGV SR++RFD 
Sbjct  70   NGTNIDVVYPQGKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQGVLSRTNRFDA  123



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = +2

Query  248  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  427
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  428  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
            ICFP++ LDNASNV  ++ + +            W  + F +K+L+ V L+QGV+SR   
Sbjct  79   ICFPNLNLDNASNVKDVYPNHKE-----------WLSVGFTWKELSTVTLEQGVFSRLQI  127

Query  608  FD  613
            FD
Sbjct  128  FD  129



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = +2

Query  248  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  427
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  428  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
            ICFP++ LDNASNV  ++ + +            W  + F +K+L+ V L+QGV+SR   
Sbjct  79   ICFPNLNLDNASNVKDVYPNHKE-----------WLSVGFTWKELSTVTLEQGVFSRLQI  127

Query  608  FD  613
            FD
Sbjct  128  FD  129



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  236  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  415
            AQ +  ++ KW TLSG+ P+V+ARGGFSGLFP+SS  A   A  T +++V+++C++QLTK
Sbjct  17   AQKAPETSPKWLTLSGEQPIVVARGGFSGLFPESSSFANQIAVSTGMSDVVVFCNLQLTK  76

Query  416  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-LTLVNLQQGVY  592
            DG+G+C PDI++DN++ +++++   Q +Y VNG     WF +DF   + L  V L Q ++
Sbjct  77   DGIGVCLPDIRIDNSTTISSIYPKGQKSYNVNGQNLRGWFTLDFTSDELLNNVTLTQNIF  136

Query  593  SRSSRFDG  616
            SRSS FDG
Sbjct  137  SRSSLFDG  144



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            ++TLSG+AP+VIA GGFSG+FPDSS NAY FA  ++  + ++WC+VQLTKDGVGIC  D+
Sbjct  46   YKTLSGNAPIVIAEGGFSGVFPDSSKNAYVFALSSTSGDTVLWCNVQLTKDGVGICLRDL  105

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
             +DN ++++  ++  +  YLVNG     WFPID+    L  V L Q ++SR+ +FD
Sbjct  106  LMDNCTSISQAYRAGKKAYLVNGEEKKGWFPIDYTMSSLQSVILTQAIWSRTDKFD  161



>tpg|DAA47913.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=607

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +2

Query  212  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  382
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  383  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-  559
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   + 
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V L Q ++SR+ R DG
Sbjct  154  LQSVYLTQAIWSRTERMDG  172



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 12/132 (9%)
 Frame = +2

Query  221  VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  400
            V LV+A   + +TS+WQTL G  PLVIARGGFSGLFP SS  AY F   TS+ +V++WCD
Sbjct  22   VALVSADKDS-TTSQWQTLKGKPPLVIARGGFSGLFPGSSSVAYDFTLSTSVPDVLLWCD  80

Query  401  VQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ  580
            VQLTK+G GICFPD+ L N+S+V  ++     TY            ID+  K L  V++ 
Sbjct  81   VQLTKEGAGICFPDLLLSNSSDVDIIYPKTVKTYT-----------IDYTLKDLANVSVT  129

Query  581  QGVYSRSSRFDG  616
            QG+YSR  RFDG
Sbjct  130  QGIYSRIDRFDG  141



>gb|AFW72078.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=360

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDG  616
             I +DN + +  +F + + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG
Sbjct  93   SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDG  152



>ref|XP_010488033.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5-like 
[Camelina sativa]
Length=266

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 11/119 (9%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S W+TLSG  P VIARGGFSG+FPDSS  AY    +T+  ++ +WC++QLTKDGVGICF
Sbjct  22   SSSWRTLSGKPPAVIARGGFSGIFPDSSIQAYELVNITTSPDITLWCELQLTKDGVGICF  81

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            P++ L N S V   + + + T           F +DF +K+L+ V L QGVYSR+  FD
Sbjct  82   PNLNLQNGSTVKKFYPNYKET-----------FSVDFTWKELSSVTLSQGVYSRTPIFD  129



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 93/144 (65%), Gaps = 1/144 (1%)
 Frame = +2

Query  185  RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  364
            R  F + L   +          +   KW TL+GD PLVIARGGFSG+FP+SS  AY FA 
Sbjct  3    RCFFFIFLFIHSALAQKHVEDPSQNQKWLTLNGDRPLVIARGGFSGVFPESSQFAYQFAL  62

Query  365  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  544
             TS+++V+++CD+QLTKDG GIC  +++LDN++ ++  + + + TY VNG   + WF +D
Sbjct  63   STSISDVVLFCDLQLTKDGNGICQTELRLDNSTTISAYYPEGEKTYNVNGKNISGWFAVD  122

Query  545  FNFKQL-TLVNLQQGVYSRSSRFD  613
            F  ++L   + L Q VYSR+S FD
Sbjct  123  FTVEELFNNITLSQNVYSRASIFD  146



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +2

Query  212  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  382
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  383  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-  559
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   + 
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V L Q ++SR+ R DG
Sbjct  154  LQSVYLTQAIWSRTERMDG  172



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +2

Query  239  QGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKD  418
            QG    T+ ++TL GDAPLVIA+GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKD
Sbjct  38   QGIRRPTA-YKTLRGDAPLVIAQGGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKD  96

Query  419  GVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSR  598
            GVG+C  DI + N +N A ++  K+  Y+++GVP T +F +DFN+ ++    L QG YSR
Sbjct  97   GVGVCLRDINMANCTNAALVYPAKKKKYVIDGVPKTGYFSLDFNYSEVQTTYLTQGFYSR  156

Query  599  SSRFD  613
            + RFD
Sbjct  157  TDRFD  161



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +2

Query  212  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  382
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  383  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-  559
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   + 
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  560  LTLVNLQQGVYSRSSRFDG  616
            L  V L Q ++SR+ R DG
Sbjct  154  LQSVYLTQAIWSRTERMDG  172



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S WQTLSG  P+VIARGGFSG+FPDSS  AY  A +T+ T+V +WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPVVIARGGFSGIFPDSSIQAYQLASITTSTDVTLWCDLQLTKDGVGICF  81

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            P++ LDN SNV  ++ + + +           F IDF  K+L+ V   Q V SRS+ FD
Sbjct  82   PNLNLDNGSNVMNVYPNYKES-----------FSIDFTKKELSRVGCAQSVPSRSNIFD  129



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 11/121 (9%)
 Frame = +2

Query  254  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  433
            S S WQTLSG  P+VIARGGFSG+FPDSS  AY    +T+  N+ +WCD+QLTKDGVGIC
Sbjct  151  SASSWQTLSGKPPVVIARGGFSGVFPDSSSKAYELVSVTTSLNLALWCDLQLTKDGVGIC  210

Query  434  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            FP++ L N S+V  ++ +K             WF +DF +K L+ VNL Q V SRS  FD
Sbjct  211  FPNLNLYNDSDVKDVYPNKNE-----------WFSVDFTWKDLSDVNLVQNVKSRSGVFD  259

Query  614  G  616
            G
Sbjct  260  G  260



>ref|XP_004506009.1| PREDICTED: uncharacterized protein LOC101491157 [Cicer arietinum]
Length=391

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  230  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  409
            V+AQ  TN    W TL G+ PLVIA GGFSG+FPDSS  AY  A  TSL NV +WCDVQL
Sbjct  23   VSAQ--TNKRYDWNTLIGNPPLVIAHGGFSGIFPDSSGAAYGLALETSLPNVALWCDVQL  80

Query  410  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  589
            TKD  GIC  ++ L N++ ++    +K + Y VNGV T  +F +D+  K L+ V L QGV
Sbjct  81   TKDAAGICLSNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYFFVDYTLKDLSNVFLSQGV  140

Query  590  YSRSSRFDG  616
            +SRS   D 
Sbjct  141  FSRSPLLDA  149


 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 86/136 (63%), Gaps = 8/136 (6%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGL------FPDSSFNAYSFAGLTSLTNVI  388
            LV+AQ  TN    W TL+G+ PLVIA GGFSG+      FPDSS  AY  A  TSL +V 
Sbjct  218  LVSAQ--TNKRYDWNTLAGNPPLVIAHGGFSGIGGFSGIFPDSSGAAYGLALETSLPDVA  275

Query  389  MWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL  568
            +WCDVQLTKD  GI  P++ L N++ ++    +K + Y VNGV T  +F +D+  K L+ 
Sbjct  276  LWCDVQLTKDAAGIFLPNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYFSMDYTLKDLSN  335

Query  569  VNLQQGVYSRSSRFDG  616
            V L QGV+SRS+  D 
Sbjct  336  VFLSQGVFSRSTLLDA  351



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  182  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            LRS  IF+L L  C A     A  +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPKTPAAVAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D++   + + V+L Q ++SR S FDG
Sbjct  122  FALDYSADTIFSNVSLVQNIFSRPSIFDG  150



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDG  616
             I +DN + +  +F + + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG
Sbjct  93   SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDG  152



>ref|XP_008679540.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW65195.1| hypothetical protein ZEAMMB73_432164 [Zea mays]
Length=790

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 89/143 (62%), Gaps = 1/143 (1%)
 Frame = +2

Query  188  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  367
            S F  LLL  AV   AAQG     S ++TLSG APLV+A GGFSGLFPDSS  AY+FA  
Sbjct  21   SSFAALLLGCAVVSAAAQGP-RLPSDYKTLSGAAPLVVAEGGFSGLFPDSSEGAYAFAVA  79

Query  368  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  547
             S     MWCDVQLTKDGVG+C  DI + N + V   F  ++ T++++GV  T WF  DF
Sbjct  80   ASAPGTAMWCDVQLTKDGVGVCLRDINMKNCTTVDQAFPARRRTHVIDGVRKTGWFAPDF  139

Query  548  NFKQLTLVNLQQGVYSRSSRFDG  616
               +L  V L Q ++SR+ R D 
Sbjct  140  TIAELQSVYLTQAIWSRTDRLDA  162



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2    IKNVLLVFLVIHATLA-NSESASKKWLTLNGRRPCVIARGGFSGLFPESSDFANQMALAT  60

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            SL++V++ C +QLTKDGVGIC  D++LDN  N+A +F+    TY VNG   T WF IDF 
Sbjct  61   SLSDVVVLCHLQLTKDGVGICQGDVRLDNTKNIAMVFEKGSRTYKVNGQDLTGWFAIDFT  120

Query  551  FKQLTL-VNLQQGVYSRSSRFDG  616
              QL   V+L Q ++SR S FD 
Sbjct  121  ADQLLANVSLVQNIFSRPSAFDA  143



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            ++TLSG+ PLVIA+GGFSG+FPDSS NA++FA  ++ +   +WCDVQLTKDGVGIC  D+
Sbjct  50   YKTLSGNPPLVIAKGGFSGVFPDSSSNAFTFALTSTSSATTLWCDVQLTKDGVGICLRDL  109

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
             ++N +++   +   + TY+VNG     WFPID+    L  V L Q ++SR  +FD
Sbjct  110  LMNNCTSIDQTYPQGKKTYIVNGKKQDGWFPIDYTMSSLQSVILTQAIWSRPDKFD  165



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 81/122 (66%), Gaps = 17/122 (14%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  437  PDIKLDNASNVATL---FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
            P++KLDN SNV  +   +K++              F +DF +K+L+ V L QGV SR   
Sbjct  82   PNLKLDNGSNVIRIDPHYKER--------------FSVDFTWKELSDVKLAQGVVSRPYI  127

Query  608  FD  613
            FD
Sbjct  128  FD  129



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 81/122 (66%), Gaps = 17/122 (14%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  437  PDIKLDNASNVATL---FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
            P++KLDN SNV  +   +K++              F +DF +K+L+ V L QGV SR   
Sbjct  82   PNLKLDNGSNVIRIDPHYKER--------------FSVDFTWKELSDVKLAQGVVSRPYI  127

Query  608  FD  613
            FD
Sbjct  128  FD  129



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = +2

Query  173  MWKLRSIFNLLL-LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M +    F+L + LC A     A  +   T KW TL+G  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIFFSLFIHLCVAAPKTPASAAAVPTKKWLTLNGQEPAVVARGGFSGLFPESSAPA  60

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ +++LF   Q TY VNG     
Sbjct  61   NDMAISTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISSLFPKAQKTYKVNGQDLKG  120

Query  530  WFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            WF +D++   + + V+L Q ++SR S FDG
Sbjct  121  WFVLDYDADTIFSNVSLVQNIFSRPSIFDG  150



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            W+TLSG+APLVIARGG+SG+FP+SS  AY FA  TSL   ++ CD+QL+KDG GIC  ++
Sbjct  36   WKTLSGNAPLVIARGGYSGIFPESSQFAYQFALATSLKETVLLCDLQLSKDGAGICHSNL  95

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT-LVNLQQGVYSRSSRFDG  616
            KLDN++ ++T F  + +TY VNG     WF +DF   +L   V   Q ++SR S FDG
Sbjct  96   KLDNSTTISTAFPKRDTTYSVNGQSLHGWFSVDFTSDELLGNVTTIQNIFSRPSIFDG  153



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = +2

Query  248  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  427
            T S S WQTLSG+ P+VIARGGFSGLFPDSS  AY    LT+  +V +WCD+QLTKDGVG
Sbjct  19   TASASSWQTLSGNPPVVIARGGFSGLFPDSSEYAYELVNLTTSEDVTLWCDLQLTKDGVG  78

Query  428  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  607
            ICFP++ LDN S+V  ++ + +             F +DF +K+L+ V L Q + SR + 
Sbjct  79   ICFPNLNLDNGSDVVDVYPNHKEI-----------FSVDFTWKELSNVTLVQNIVSRQAI  127

Query  608  FD  613
            FD
Sbjct  128  FD  129



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 90/150 (60%), Gaps = 2/150 (1%)
 Frame = +2

Query  173  MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  349
            M +   IF+L +  C       A        KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIIFSLFIHSCVGAPRTPAAAVAVPGKKWLTLSGQEPAVVARGGFSGLFPESSAPA  60

Query  350  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  529
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF   Q TY VNG     
Sbjct  61   NDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFPKAQKTYKVNGQDLKG  120

Query  530  WFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            WF ID++ + + + V+L Q ++SR S FDG
Sbjct  121  WFVIDYDAETIFSNVSLIQNIFSRPSIFDG  150



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            S ++TL GDAPLVIA+GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKDGVGIC  
Sbjct  45   SAYKTLRGDAPLVIAQGGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKDGVGICLR  104

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            DI + N +N AT +  K+  Y+++GVP T  F +DF + ++    L QG YSR+ RFD
Sbjct  105  DINMANCTNAATAYPAKKKKYVIDGVPKTGHFSLDFTYSEVQNTYLTQGFYSRTDRFD  162



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  227  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  406
            LV AQ  TN    W TL+G+ PLVIA GGFSG+FPDSS  AY  A  TSL +V +WCDVQ
Sbjct  26   LVFAQ--TNKRYDWNTLAGNPPLVIAHGGFSGIFPDSSGAAYGLALETSLPDVALWCDVQ  83

Query  407  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  586
            LTKD  GI  P++ L N++ ++    +K + Y VNGV T  +F +D+  K L+ V L QG
Sbjct  84   LTKDASGIFLPNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYFSVDYTLKDLSNVLLSQG  143

Query  587  VYSRSSRFDG  616
            V+SRS+  D 
Sbjct  144  VFSRSTLLDA  153



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSSQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            P++ LDN S+V T++ + +             F +DF +K+L+ V L +GV SR + FD
Sbjct  82   PNLNLDNGSDVMTIYPNYKER-----------FSVDFTWKELSDVKLARGVLSRPNIFD  129



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +2

Query  191  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  370
            I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2    IKNVLLVFLVIHATLAN-SESASKKWLTLNGRRPSVIARGGFSGLFPESSDFANQMALAT  60

Query  371  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  550
            SL+ V + C++QLTK+GVGIC  DI+LDN +N+A +F+    TY VNG   T WF IDF 
Sbjct  61   SLSGVAVLCNLQLTKEGVGICQGDIRLDNTTNIAMVFEKGSRTYKVNGQDITGWFAIDFT  120

Query  551  FKQLTL-VNLQQGVYSRSSRFDG  616
              QL   V+L Q ++SR S FD 
Sbjct  121  ADQLLANVSLLQNIFSRPSAFDA  143



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = +2

Query  221  VTLVAAQG--STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  394
            + L+ AQ   +  +   W TL+G+ P VIARGGFSGLFPDSS  AY F G  SL + I++
Sbjct  12   IGLITAQKPPANPAPPSWLTLNGERPAVIARGGFSGLFPDSSRFAYDFVGQVSLPDSILY  71

Query  395  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  574
            CD+QLTKDGVG C  ++KLDN++N+A LF   Q +Y VNG     WF ID+    L L N
Sbjct  72   CDLQLTKDGVGFCQSELKLDNSTNIALLFPKGQKSYNVNGKDVRGWFAIDYLADAL-LPN  130

Query  575  L--QQGVYSRSSRFDG  616
            L   Q V +R + FDG
Sbjct  131  LTSAQNVLTRPNAFDG  146



>emb|CDX82243.1| BnaA03g35780D [Brassica napus]
Length=275

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 11/120 (9%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            TS WQTLSG  P+VIARG FSG+FPDSS  AY +  +T+  NV +WCD+QLTKDGVGICF
Sbjct  152  TSSWQTLSGKPPVVIARGWFSGVFPDSSSKAYQWVSVTTSPNVALWCDLQLTKDGVGICF  211

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  616
            P+  L N S+   ++ + +            WF +DF +K L+ VNL Q V SRS  FDG
Sbjct  212  PNPNLYNYSDDKDVYPNNKE-----------WFSVDFTWKDLSDVNLVQNVKSRSGVFDG  260



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 11/119 (9%)
 Frame = +2

Query  257  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  436
            +S W+TLSG  P VIARGGFSG+FPDSS  AY    +T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWKTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPEVMLWCDLQLTKDGVGICF  81

Query  437  PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            P++ L N SNV +++ + +             F +DF +K+L+ V L QGV SR   FD
Sbjct  82   PNLNLHNGSNVISIYPNYKER-----------FSVDFTWKELSDVKLAQGVISRPEIFD  129



>emb|CDX71386.1| BnaC04g16210D [Brassica napus]
Length=189

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  260  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  439
            +KW TL+G  P V+ARGGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  
Sbjct  28   TKWLTLNGQEPAVVARGGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLS  87

Query  440  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            DI+LDNA+ ++TLF   Q TY V G     WF +D++   + + V+L Q ++SR S FDG
Sbjct  88   DIRLDNATTISTLFPKAQKTYKVYGQDLKGWFVLDYSADTIFSNVSLVQNIFSRPSIFDG  147



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  182  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D++   + + V+L Q ++SR S F+G
Sbjct  122  FALDYSADTIFSNVSLVQNIFSRPSIFNG  150



>gb|EMT22700.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Aegilops 
tauschii]
Length=799

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  266  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  445
            W TLSG  PLVIARGG SG+ P+SS  AYS A   SL  V+++CD+Q + DGVG C   +
Sbjct  29   WLTLSGHRPLVIARGGLSGVVPESSQLAYSMAMGGSLCEVVLFCDLQFSSDGVGFCHGSL  88

Query  446  KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  613
            +LDN+SN+A +F D+ STY VNG     WF +DF  ++L  V L Q V SRS+ FD
Sbjct  89   RLDNSSNIAEMFADRGSTYQVNGRDVQGWFSLDFKSEELHRVLLLQNVLSRSNTFD  144



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  182  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  352
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  353  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  532
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  533  FPIDFNFKQL-TLVNLQQGVYSRSSRFDG  616
            F +D++   + + V+L Q ++SR S F+G
Sbjct  122  FALDYSADTIFSNVSLVQNIFSRPSIFNG  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090