BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS104C03

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB61503.1|  hypothetical protein B456_009G362500                    315   3e-101   Gossypium raimondii
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    317   8e-101   Nicotiana tomentosiformis
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    317   1e-100   Nicotiana sylvestris
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    317   2e-100   Solanum lycopersicum
gb|KJB61502.1|  hypothetical protein B456_009G362500                    315   4e-100   Gossypium raimondii
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            315   6e-100   Morus notabilis
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            314   2e-99    Theobroma cacao [chocolate]
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    313   2e-99    Glycine max [soybeans]
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    313   5e-99    Nicotiana sylvestris
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             313   5e-99    
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    312   6e-99    Gossypium arboreum [tree cotton]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    313   6e-99    Solanum tuberosum [potatoes]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    312   7e-99    Gossypium raimondii
gb|ACJ11756.1|  rhamnose synthase                                       312   7e-99    Gossypium hirsutum [American cotton]
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    312   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    312   1e-98    Glycine max [soybeans]
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   1e-98    Fragaria vesca subsp. vesca
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      310   1e-98    
gb|ADB24773.1|  rhamnose synthase                                       311   1e-98    Gossypium hirsutum [American cotton]
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    311   1e-98    Solanum tuberosum [potatoes]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   1e-98    Sesamum indicum [beniseed]
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    311   1e-98    Gossypium arboreum [tree cotton]
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    312   2e-98    Glycine max [soybeans]
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    311   2e-98    Brassica rapa
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    311   2e-98    Nicotiana tomentosiformis
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    312   2e-98    
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             311   2e-98    Prunus persica
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   2e-98    Vitis vinifera
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    311   3e-98    Prunus mume [ume]
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    311   3e-98    Solanum lycopersicum
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   3e-98    Populus euphratica
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    311   3e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    311   3e-98    Eucalyptus grandis [rose gum]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    311   3e-98    
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    310   3e-98    Populus euphratica
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    310   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    310   4e-98    
gb|KJB45830.1|  hypothetical protein B456_007G332000                    302   4e-98    Gossypium raimondii
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    310   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             310   4e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    310   5e-98    Phoenix dactylifera
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    310   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             310   5e-98    Capsella rubella
gb|KJB12930.1|  hypothetical protein B456_002G046100                    301   5e-98    Gossypium raimondii
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        310   5e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                310   7e-98    Erythranthe guttata [common monkey flower]
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       310   7e-98    Medicago truncatula
ref|NP_001151455.1|  RHM1                                               310   8e-98    Zea mays [maize]
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    309   1e-97    Glycine max [soybeans]
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 309   1e-97    Glycine soja [wild soybean]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    309   1e-97    Glycine max [soybeans]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 309   1e-97    Glycine soja [wild soybean]
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    309   2e-97    Cucumis sativus [cucumbers]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    309   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    309   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             308   2e-97    
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    308   2e-97    Elaeis guineensis
dbj|BAJ86835.1|  predicted protein                                      308   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             308   2e-97    Eutrema salsugineum [saltwater cress]
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    308   2e-97    Cucumis melo [Oriental melon]
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             308   2e-97    Capsella rubella
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 308   3e-97    Triticum urartu
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             308   3e-97    Phaseolus vulgaris [French bean]
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    308   3e-97    Cicer arietinum [garbanzo]
emb|CDY25850.1|  BnaA05g14410D                                          301   3e-97    Brassica napus [oilseed rape]
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    308   4e-97    Elaeis guineensis
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       310   5e-97    Medicago truncatula
ref|NP_177978.1|  UDP-L-rhamnose synthase                               307   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    307   6e-97    Sesamum indicum [beniseed]
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    307   8e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg                306   1e-96    Erythranthe guttata [common monkey flower]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    306   1e-96    Setaria italica
emb|CDY35137.1|  BnaA06g11470D                                          306   2e-96    Brassica napus [oilseed rape]
emb|CDY40003.1|  BnaC05g13120D                                          306   2e-96    Brassica napus [oilseed rape]
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    306   2e-96    Brassica rapa
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   3e-96    Elaeis guineensis
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    305   5e-96    Pyrus x bretschneideri [bai li]
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...    305   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45829.1|  hypothetical protein B456_007G332000                    301   6e-96    Gossypium raimondii
gb|KJB45828.1|  hypothetical protein B456_007G332000                    302   6e-96    Gossypium raimondii
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340          304   1e-95    Sorghum bicolor [broomcorn]
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...    304   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             304   1e-95    Capsella rubella
gb|KCW47402.1|  hypothetical protein EUGRSUZ_K01196                     300   1e-95    Eucalyptus grandis [rose gum]
gb|KDP30504.1|  hypothetical protein JCGZ_17141                         304   1e-95    Jatropha curcas
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95    Setaria italica
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg             303   2e-95    Citrus clementina [clementine]
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95    Phoenix dactylifera
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                   303   2e-95    Citrus sinensis [apfelsine]
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95    Phoenix dactylifera
ref|XP_002887744.1|  RHM1/ROL1                                          303   2e-95    
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95    Citrus sinensis [apfelsine]
gb|ABF95280.1|  rhamnose biosynthetic enzyme 1, putative, expressed     300   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|KJB45831.1|  hypothetical protein B456_007G332000                    303   3e-95    Gossypium raimondii
emb|CDX88455.1|  BnaC06g38990D                                          303   4e-95    
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...    302   7e-95    Brassica rapa
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...    302   7e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...    302   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...    302   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002894444.1|  mucilage-modified 4                                301   9e-95    
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...    301   9e-95    Oryza brachyantha
emb|CDY60210.1|  BnaCnng35880D                                          301   1e-94    Brassica napus [oilseed rape]
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    301   1e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    301   1e-94    Gossypium arboreum [tree cotton]
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 301   2e-94    
dbj|BAJ97692.1|  predicted protein                                      301   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    301   2e-94    Oryza brachyantha
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 301   2e-94    Triticum urartu
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    301   2e-94    Brachypodium distachyon [annual false brome]
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg             301   2e-94    Eutrema salsugineum [saltwater cress]
emb|CDP06058.1|  unnamed protein product                                300   2e-94    Coffea canephora [robusta coffee]
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    301   2e-94    Eucalyptus grandis [rose gum]
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    300   3e-94    
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    300   3e-94    Camelina sativa [gold-of-pleasure]
gb|ADB24772.1|  rhamnose synthase                                       300   3e-94    Gossypium hirsutum [American cotton]
ref|NP_001049724.1|  Os03g0278200                                       300   3e-94    
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          300   3e-94    Amborella trichopoda
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                      300   3e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDY45116.1|  BnaC06g06370D                                          299   8e-94    Brassica napus [oilseed rape]
emb|CDY24092.1|  BnaA06g00900D                                          299   9e-94    Brassica napus [oilseed rape]
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...    299   1e-93    Brassica rapa
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220          298   2e-93    Sorghum bicolor [broomcorn]
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    298   2e-93    Fragaria vesca subsp. vesca
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    298   2e-93    Brassica rapa
emb|CDP21573.1|  unnamed protein product                                285   2e-93    Coffea canephora [robusta coffee]
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg             297   5e-93    Prunus persica
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...    297   6e-93    Pyrus x bretschneideri [bai li]
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             297   6e-93    Phaseolus vulgaris [French bean]
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...    296   1e-92    
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    296   1e-92    Glycine max [soybeans]
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 296   1e-92    Glycine soja [wild soybean]
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...    296   1e-92    Prunus mume [ume]
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...    296   2e-92    Malus domestica [apple tree]
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...    295   6e-92    Pyrus x bretschneideri [bai li]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...    294   8e-92    Eucalyptus grandis [rose gum]
ref|XP_001775602.1|  predicted protein                                  293   2e-91    
ref|XP_001775697.1|  predicted protein                                  293   3e-91    
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    293   3e-91    Gossypium arboreum [tree cotton]
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                  294   4e-91    
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...    292   5e-91    Citrus sinensis [apfelsine]
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...    292   5e-91    Malus domestica [apple tree]
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg             292   6e-91    
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                   292   6e-91    Citrus sinensis [apfelsine]
gb|ADB24774.1|  rhamnose synthase                                       291   8e-91    Gossypium hirsutum [American cotton]
emb|CDP18722.1|  unnamed protein product                                291   8e-91    Coffea canephora [robusta coffee]
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1            290   2e-90    Morus notabilis
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...    290   3e-90    Setaria italica
gb|AFW77499.1|  hypothetical protein ZEAMMB73_283149                    285   9e-90    
gb|KJB75445.1|  hypothetical protein B456_012G042300                    289   9e-90    Gossypium raimondii
ref|XP_001766894.1|  predicted protein                                  288   1e-89    
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220          288   2e-89    
gb|ACG33666.1|  RHM1                                                    286   1e-88    Zea mays [maize]
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1                 283   1e-88    Glycine soja [wild soybean]
ref|NP_001130297.1|  uncharacterized protein LOC100191391               286   1e-88    Zea mays [maize]
ref|XP_001779703.1|  predicted protein                                  284   5e-88    
ref|XP_002515360.1|  dtdp-glucose 4,6-dehydratase, putative             275   9e-88    Ricinus communis
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803             283   1e-87    Selaginella moellendorffii
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972             283   1e-87    
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...    283   1e-87    Malus domestica [apple tree]
gb|EMT08126.1|  Putative rhamnose biosynthetic enzyme 1                 271   1e-85    
gb|EMS55907.1|  putative rhamnose biosynthetic enzyme 3                 270   2e-84    Triticum urartu
ref|XP_004172221.1|  PREDICTED: probable rhamnose biosynthetic en...    266   2e-84    
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...    274   6e-84    Pyrus x bretschneideri [bai li]
ref|XP_008351771.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    263   2e-83    
ref|XP_011082935.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    263   6e-83    Sesamum indicum [beniseed]
gb|EYU29575.1|  hypothetical protein MIMGU_mgv1a008395mg                262   7e-83    Erythranthe guttata [common monkey flower]
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg             269   3e-82    
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...    269   4e-82    
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                   269   4e-82    Citrus sinensis [apfelsine]
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...    267   1e-81    Nelumbo nucifera [Indian lotus]
emb|CAN62061.1|  hypothetical protein VITISV_001928                     266   2e-81    Vitis vinifera
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...    266   3e-81    Cucumis melo [Oriental melon]
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...    266   4e-81    
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    266   4e-81    Vitis vinifera
gb|AFW66842.1|  hypothetical protein ZEAMMB73_620875                    258   7e-81    
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    264   2e-80    Populus euphratica
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg             264   2e-80    Prunus persica
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g             263   4e-80    Populus trichocarpa [western balsam poplar]
emb|CDX97601.1|  BnaA05g24780D                                          262   1e-79    
emb|CDX98494.1|  BnaC05g38810D                                          261   1e-79    
ref|XP_007011619.1|  Rhamnose biosynthesis 1                            260   4e-79    
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...    260   6e-79    Prunus mume [ume]
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...    259   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...    259   1e-78    Nicotiana sylvestris
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...    258   4e-78    
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...    257   7e-78    Nicotiana tomentosiformis
emb|CDY32340.1|  BnaC01g36590D                                          256   2e-77    Brassica napus [oilseed rape]
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...    256   2e-77    Solanum tuberosum [potatoes]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...    255   3e-77    
emb|CDY20084.1|  BnaA01g29180D                                          254   6e-77    Brassica napus [oilseed rape]
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...    251   8e-76    Glycine max [soybeans]
ref|XP_003566438.1|  PREDICTED: probable rhamnose biosynthetic en...    240   4e-74    Brachypodium distachyon [annual false brome]
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    247   7e-74    Fragaria vesca subsp. vesca
ref|XP_003588651.1|  Rhamnose synthase                                  246   7e-74    Medicago truncatula
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...    244   4e-73    Cicer arietinum [garbanzo]
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g             244   6e-73    Phaseolus vulgaris [French bean]
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1                 244   9e-73    Glycine soja [wild soybean]
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...    244   9e-73    
ref|XP_010531915.1|  PREDICTED: LOW QUALITY PROTEIN: trifunctiona...    238   3e-72    Tarenaya hassleriana [spider flower]
ref|XP_003569141.1|  PREDICTED: probable rhamnose biosynthetic en...    232   3e-71    Brachypodium distachyon [annual false brome]
gb|EPS62084.1|  hypothetical protein M569_12709                         222   5e-65    Genlisea aurea
ref|XP_001701714.1|  NAD-dependent epimerase/dehydratase                214   7e-65    Chlamydomonas reinhardtii
ref|XP_002953659.1|  hypothetical protein VOLCADRAFT_82358              211   3e-63    Volvox carteri f. nagariensis
ref|XP_011401987.1|  putative rhamnose biosynthetic enzyme 3            205   1e-60    Auxenochlorella protothecoides
gb|AGE49559.1|  GDP-L-fucose synthase 2                                 204   2e-60    Acanthocystis turfacea Chlorella virus Can0610SP
gb|AGE60164.1|  GDP-L-fucose synthase 2                                 204   2e-60    Acanthocystis turfacea Chlorella virus WI0606
ref|XP_005648752.1|  NAD-dependent epimerase/dehydratase                204   3e-60    Coccomyxa subellipsoidea C-169
ref|XP_005644844.1|  NAD(P)-binding protein                             203   5e-60    Coccomyxa subellipsoidea C-169
ref|XP_007508076.1|  predicted protein                                  210   5e-60    Bathycoccus prasinos
ref|XP_003057320.1|  predicted protein                                  209   8e-60    Micromonas pusilla CCMP1545
gb|AGE57039.1|  GDP-L-fucose synthase 2                                 202   9e-60    Acanthocystis turfacea Chlorella virus NE-JV-3
ref|YP_001427025.1|  hypothetical protein ATCV1_Z544R                   202   1e-59    Acanthocystis turfacea chlorella virus 1
gb|AGE50238.1|  GDP-L-fucose synthase 2                                 202   1e-59    Acanthocystis turfacea Chlorella virus Canal-1
gb|AGE59831.1|  GDP-L-fucose synthase 2                                 202   1e-59    Acanthocystis turfacea Chlorella virus TN603.4.2
ref|XP_011401232.1|  DEAD-box ATP-dependent RNA helicase 20             209   1e-59    Auxenochlorella protothecoides
gb|AGE55724.1|  GDP-L-fucose synthase 2                                 202   1e-59    Acanthocystis turfacea Chlorella virus MN0810.1
gb|AGE59487.1|  GDP-L-fucose synthase 2                                 201   1e-59    Acanthocystis turfacea Chlorella virus OR0704.3
ref|XP_002500589.1|  predicted protein                                  208   3e-59    Micromonas commoda
gb|AGE53603.1|  GDP-L-fucose synthase 2                                 200   5e-59    Acanthocystis turfacea Chlorella virus GM0701.1
gb|AGE56041.1|  GDP-L-fucose synthase 2                                 200   7e-59    Acanthocystis turfacea Chlorella virus MO0605SPH
gb|AGE56705.1|  GDP-L-fucose synthase 2                                 199   8e-59    Acanthocystis turfacea Chlorella virus NE-JV-2
gb|KDD76685.1|  NAD dependent epimerase/dehydratase                     200   1e-58    Helicosporidium sp. ATCC 50920
gb|KJB27003.1|  hypothetical protein B456_004G271200                    205   1e-58    Gossypium raimondii
ref|XP_007514013.1|  predicted protein                                  206   1e-58    Bathycoccus prasinos
ref|XP_005854661.1|  dTDP-glucose 4,6-dehydratase                       199   2e-58    Nannochloropsis gaditana CCMP526
emb|CBN76510.1|  conserved unknown protein                              199   2e-58    Ectocarpus siliculosus
gb|AGE57735.1|  GDP-L-fucose synthase 2                                 198   4e-58    Acanthocystis turfacea Chlorella virus NTS-1
gb|KDD73904.1|  NAD dependent epimerase/dehydratase                     198   5e-58    Helicosporidium sp. ATCC 50920
gb|EWM28017.1|  rhamnose biosynthetic enzyme expressed                  199   6e-58    Nannochloropsis gaditana
ref|XP_002181238.1|  predicted protein                                  199   1e-57    Phaeodactylum tricornutum CCAP 1055/1
gb|AGE49233.1|  GDP-L-fucose synthase 2                                 196   1e-57    Acanthocystis turfacea Chlorella virus Br0604L
gb|EWM30544.1|  dTDP-glucose 4,6-dehydratase                            197   2e-57    Nannochloropsis gaditana
ref|XP_005781167.1|  hypothetical protein EMIHUDRAFT_442934             196   5e-57    Emiliania huxleyi CCMP1516
ref|XP_002291084.1|  dtdp-glucose 4,6-dehydratase                       195   6e-57    Thalassiosira pseudonana CCMP1335
ref|XP_005778340.1|  hypothetical protein EMIHUDRAFT_367182             195   7e-57    Emiliania huxleyi CCMP1516
ref|XP_005757838.1|  hypothetical protein EMIHUDRAFT_433184             195   8e-57    Emiliania huxleyi CCMP1516
ref|XP_004336227.1|  dTDPD-glucose 4,6-dehydratase                      195   1e-56    Acanthamoeba castellanii str. Neff
ref|XP_005845105.1|  hypothetical protein CHLNCDRAFT_7301               192   2e-56    Chlorella variabilis
ref|XP_001422283.1|  putative NAD-dependent epimerase/dehydratase       190   5e-55    Ostreococcus lucimarinus CCE9901
ref|XP_001422288.1|  predicted protein                                  190   7e-55    Ostreococcus lucimarinus CCE9901
ref|XP_005850348.1|  hypothetical protein CHLNCDRAFT_142172             189   2e-54    Chlorella variabilis
ref|XP_005536953.1|  dTDP-glucose 4,6-dehydratase                       186   3e-53    Cyanidioschyzon merolae strain 10D
ref|XP_005537192.1|  dTDP-glucose 4,6-dehydratase                       186   4e-53    Cyanidioschyzon merolae strain 10D
ref|XP_005535008.1|  dTDP-glucose 4,6-dehydratase                       186   4e-53    Cyanidioschyzon merolae strain 10D
ref|XP_004256510.1|  DTDP-glucose 4,6-dehydratase, putative             183   2e-52    Entamoeba invadens IP1
emb|CBK22816.2|  unnamed protein product                                186   3e-52    Blastocystis hominis
gb|EJK47833.1|  hypothetical protein THAOC_33424                        183   3e-52    Thalassiosira oceanica
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                    185   4e-51    Ostreococcus tauri
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...    185   5e-51    
ref|XP_006675185.1|  hypothetical protein BATDEDRAFT_18531              179   7e-51    Batrachochytrium dendrobatidis JAM81
ref|XP_001737366.1|  DTDP-glucose 4,6-dehydratase                       178   1e-50    Entamoeba dispar SAW760
ref|XP_001297395.1|  NAD dependent epimerase/dehydratase family p...    177   5e-50    Trichomonas vaginalis G3
ref|XP_004253556.1|  DTDP-glucose 4,6-dehydratase, putative             176   6e-50    Entamoeba invadens IP1
ref|XP_005710308.1|  dTDP-glucose 4,6-dehydratase                       176   1e-49    Chondrus crispus [carageen]
ref|NP_001054887.1|  Os05g0203400                                       171   2e-49    
ref|XP_004184621.1|  DTDP-glucose 4,6-dehydratase, putative             174   6e-49    Entamoeba invadens IP1
gb|EMS11387.1|  dTDP-D-glucose 4,6-dehydratase                          167   1e-48    Entamoeba histolytica HM-3:IMSS
ref|XP_009035289.1|  hypothetical protein AURANDRAFT_23143              172   2e-48    Aureococcus anophagefferens
ref|XP_005707656.1|  dTDP-glucose 4,6-dehydratase                       172   4e-48    Galdieria sulphuraria
gb|EPB88805.1|  dTDP-glucose 4,6-dehydratase                            171   1e-47    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN06126.1|  DTDPD-glucose 4,6-dehydratase                          171   2e-47    Mucor ambiguus
gb|AGM32522.1|  NAD dependent epimerase/dehydratase family protein      169   2e-47    Coptotermes formosanus
ref|XP_005704072.1|  dTDP-glucose 4,6-dehydratase                       170   3e-47    Galdieria sulphuraria
ref|XP_001741245.1|  DTDP-glucose 4,6-dehydratase                       169   3e-47    Entamoeba dispar SAW760
ref|XP_656509.1|  dTDP-D-glucose 4,6-dehydratase                        169   3e-47    Entamoeba histolytica HM-1:IMSS
emb|CDH53780.1|  dtdp-glucose-dehydratase                               169   1e-46    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS02810.1|  hypothetical protein LRAMOSA00214                      169   1e-46    Lichtheimia ramosa
ref|XP_002839554.1|  hypothetical protein                               169   1e-46    Tuber melanosporum Mel28
ref|XP_652489.1|  dTDP-D-glucose 4,6-dehydratase                        167   1e-46    Entamoeba histolytica HM-1:IMSS
ref|XP_009031751.1|  hypothetical protein HELRODRAFT_104422             166   6e-46    Helobdella robusta
ref|XP_004346522.1|  rhamnose biosynthetic enzyme 3, putative           167   8e-46    Acanthamoeba castellanii str. Neff
gb|ERZ94801.1|  hypothetical protein GLOINDRAFT_72734                   163   9e-45    
gb|EXX68145.1|  bifunctional UDP-glucose 4-epimerase/aldose 1-epi...    163   2e-44    Rhizophagus irregularis DAOM 197198w
ref|XP_001628519.1|  predicted protein                                  161   8e-44    Nematostella vectensis
ref|XP_001267087.1|  dtdp-glucose 4,6-dehydratase                       162   9e-44    Aspergillus fischeri NRRL 181
gb|EXL51746.1|  dTDP-glucose 4,6-dehydratase                            160   2e-43    Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EPY35950.1|  dTDP-glucose 4,6-dehydratase                            158   9e-43    
gb|EXA35093.1|  dTDP-glucose 4,6-dehydratase                            158   1e-42    
dbj|BAB27693.1|  unnamed protein product                                157   2e-42    
gb|EDL00564.1|  TDP-glucose 4,6-dehydratase, isoform CRA_a              157   2e-42    
ref|NP_083854.3|  dTDP-D-glucose 4,6-dehydratase                        157   2e-42    
gb|AAH21419.1|  TDP-glucose 4,6-dehydratase                             157   2e-42    
gb|EDL00567.1|  TDP-glucose 4,6-dehydratase, isoform CRA_d              157   2e-42    
gb|EWZ30418.1|  dTDP-glucose 4,6-dehydratase                            157   4e-42    
gb|EDM02523.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    152   5e-42    
gb|EXM20830.1|  dTDP-glucose 4,6-dehydratase                            156   5e-42    
gb|EXK35799.1|  dTDP-glucose 4,6-dehydratase                            156   7e-42    
ref|XP_007677510.1|  hypothetical protein BAUCODRAFT_48602              156   7e-42    
ref|XP_008595173.1|  dTDP-D-glucose 4,6-dehydratase                     157   7e-42    
gb|KGQ08679.1|  putative rhamnose biosynthetic enzyme 2                 157   9e-42    
gb|EWY82941.1|  dTDP-glucose 4,6-dehydratase                            156   9e-42    
gb|EDM02522.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    152   1e-41    
ref|XP_001512139.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          155   1e-41    
gb|ENH75981.1|  Putative rhamnose biosynthetic enzyme 1                 155   1e-41    
ref|XP_005818916.1|  hypothetical protein GUITHDRAFT_98705              154   2e-41    
emb|CEJ87410.1|  Putative dTDP-D-glucose 4,6-dehydratase                156   4e-41    
ref|XP_005355717.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   5e-41    
gb|EGU75304.1|  hypothetical protein FOXB_14183                         154   5e-41    
ref|XP_006927417.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   5e-41    
ref|XP_003477586.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   5e-41    
ref|XP_010587692.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   5e-41    
dbj|GAM86455.1|  hypothetical protein ANO11243_044690                   154   5e-41    
ref|XP_004371454.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   6e-41    
ref|XP_007101813.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   6e-41    
emb|CCG81052.1|  Dtdp-glucose 4,6-dehydratase                           153   6e-41    
ref|XP_003131096.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    153   6e-41    
ref|XP_005882453.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   7e-41    
dbj|GAM29125.1|  hypothetical protein SAMD00019534_123010               154   7e-41    
ref|XP_006089900.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   7e-41    
emb|CEJ93891.1|  Putative dTDP-D-glucose 4,6-dehydratase                154   8e-41    
ref|XP_008825221.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   8e-41    
ref|XP_004884841.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   8e-41    
ref|XP_011106233.1|  hypothetical protein H072_241                      154   9e-41    
ref|XP_006156670.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   1e-40    
gb|EQL02570.1|  dTDP-D-glucose 4,6-dehydratase                          153   1e-40    
ref|XP_007456437.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   1e-40    
ref|XP_005317101.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   1e-40    
ref|XP_001746636.1|  hypothetical protein                               152   1e-40    
ref|XP_006191479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   1e-40    
ref|XP_002918693.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   1e-40    
ref|XP_008683235.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   1e-40    
ref|XP_004313346.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    152   1e-40    
gb|ERE88474.1|  dTDP-D-glucose 4,6-dehydratase-like protein             151   1e-40    
ref|XP_002713048.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   1e-40    
ref|XP_007101808.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40    
gb|ERE88473.1|  dTDP-D-glucose 4,6-dehydratase-like protein             151   2e-40    
ref|XP_008154704.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   2e-40    
ref|XP_010628993.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   2e-40    
gb|EKG22293.1|  hypothetical protein MPH_00360                          157   2e-40    
ref|XP_007196914.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40    
ref|XP_008057635.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   2e-40    
gb|ELT91052.1|  hypothetical protein CAPTEDRAFT_223439                  152   2e-40    
ref|XP_001377580.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40    
ref|XP_003980524.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40    
ref|XP_003409363.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40    
ref|XP_005079467.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   2e-40    
ref|XP_010957996.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_007101807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_006211070.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   3e-40    
ref|XP_010957995.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_006692796.1|  dtdp-glucose 4,6-dehydratase-like protein          153   3e-40    
ref|XP_005882452.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_007586615.1|  putative dtdp-d-glucose -dehydratase protein       152   3e-40    
ref|XP_006978807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   3e-40    
ref|XP_005374169.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40    
gb|AAH05284.1|  TGDS protein                                            150   3e-40    
ref|XP_006743512.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   3e-40    
gb|EMD93896.1|  hypothetical protein COCHEDRAFT_1129846                 152   3e-40    
ref|XP_006156669.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_006089899.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   3e-40    
ref|XP_004408787.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   4e-40    
ref|XP_542640.3|  PREDICTED: dTDP-D-glucose 4,6-dehydratase             151   4e-40    
ref|XP_005037773.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   4e-40    
ref|XP_005586151.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   4e-40    
ref|XP_004884840.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   4e-40    
ref|XP_007689960.1|  hypothetical protein COCMIDRAFT_100591             152   4e-40    
ref|XP_007196913.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   4e-40    
ref|XP_011393834.1|  dTDP-D-glucose 4,6-dehydratase, variant 1          154   4e-40    
ref|XP_003789623.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   4e-40    
ref|XP_006769641.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   4e-40    
gb|EGZ71579.1|  NAD(P)-binding protein                                  154   4e-40    
ref|XP_009002779.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   5e-40    
ref|XP_003928247.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   5e-40    
ref|XP_005516855.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   5e-40    
ref|XP_002742523.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   5e-40    
ref|XP_011393833.1|  dTDP-D-glucose 4,6-dehydratase                     154   5e-40    
ref|XP_003765842.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   6e-40    
gb|EWG55513.1|  dTDP-glucose 4,6-dehydratase                            150   6e-40    
ref|XP_005374168.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40    
ref|XP_005586149.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40    
ref|XP_010809203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40    
ref|NP_055120.1|  dTDP-D-glucose 4,6-dehydratase isoform 1              150   6e-40    
ref|XP_004355810.1|  putative dTDP-D-glucose 4,6-dehydratase            148   6e-40    
gb|KDB17974.1|  dtdp-glucose 4,6-dehydratase                            152   6e-40    
ref|XP_003832071.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40    
ref|XP_001491790.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   7e-40    
ref|XP_522697.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    150   7e-40    
ref|XP_004709829.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   7e-40    
ref|XP_004423167.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   7e-40    
ref|XP_007942199.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   7e-40    
ref|XP_002824410.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   7e-40    
ref|XP_005909299.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   8e-40    
ref|NP_001094629.1|  dTDP-D-glucose 4,6-dehydratase                     150   8e-40    
ref|XP_006080395.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   8e-40    
ref|XP_003257436.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   8e-40    
ref|XP_005687758.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   8e-40    
ref|NP_001270865.1|  uncharacterized protein LOC101926513               150   9e-40    
ref|XP_010628984.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   9e-40    
ref|XP_006913872.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   9e-40    
ref|XP_004054696.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   9e-40    
ref|XP_006879634.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   9e-40    
ref|XP_011353793.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   9e-40    
gb|EHH58661.1|  dTDP-D-glucose 4,6-dehydratase                          150   9e-40    
ref|XP_004604078.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   1e-39    
ref|XP_007526909.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   1e-39    
ref|XP_002939327.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    148   1e-39    
ref|XP_006639064.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase-like     150   1e-39    
ref|XP_004746205.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    150   1e-39    
ref|XP_004457791.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   1e-39    
ref|XP_009899796.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   1e-39    
gb|KFY70636.1|  hypothetical protein V499_09028                         150   1e-39    
ref|XP_007715776.1|  hypothetical protein COCCADRAFT_39769              151   1e-39    
ref|XP_010357203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   1e-39    
ref|XP_008083851.1|  NAD(P)-binding Rossmann-fold containing protein    151   1e-39    
ref|XP_009225668.1|  dTDP-D-glucose 4,6-dehydratase                     150   1e-39    
ref|XP_009190350.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    149   1e-39    
ref|XP_007701224.1|  hypothetical protein COCSADRAFT_119751             151   1e-39    
gb|AEH41993.1|  UDP-glucose-4,6-dehydratase                             150   1e-39    
ref|XP_003717261.1|  dTDP-D-glucose 4,6-dehydratase                     150   2e-39    
ref|XP_009653544.1|  dTDP-D-glucose 4,6-dehydratase                     150   2e-39    
ref|XP_003852374.1|  hypothetical protein MYCGRDRAFT_93541              150   2e-39    
ref|XP_008569757.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   2e-39    
ref|XP_005970989.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   2e-39    
ref|XP_010628976.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   2e-39    
ref|XP_004273708.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    149   2e-39    
emb|CCF46678.1|  dTDP-D-glucose 4,6-dehydratase                         144   2e-39    
ref|XP_002196929.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   2e-39    
gb|KIM94721.1|  hypothetical protein OIDMADRAFT_45648                   150   2e-39    
ref|XP_007599732.1|  dTDP-glucose 4,6-dehydratase                       150   2e-39    
ref|XP_005487541.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   2e-39    
emb|CCC10630.1|  unnamed protein product                                152   3e-39    
ref|XP_003839159.1|  hypothetical protein LEMA_P028320.1                150   3e-39    
ref|XP_001908195.1|  hypothetical protein                               146   3e-39    
ref|XP_011126737.1|  hypothetical protein AOL_s00188g187                149   3e-39    
dbj|GAD98335.1|  dTDP-D-glucose 4,6-dehydratase-like protein            149   3e-39    
ref|XP_001938042.1|  dTDP-D-glucose 4,6-dehydratase                     149   4e-39    
ref|XP_416988.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    148   4e-39    
ref|XP_005305067.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    147   4e-39    
ref|XP_004650848.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   4e-39    
ref|XP_009311908.1|  GDP-mannose 4,6 dehydratase                        149   4e-39    
ref|XP_004626312.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          148   5e-39    
ref|XP_004012251.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          148   6e-39    
gb|KFY20012.1|  hypothetical protein V493_07767                         149   6e-39    
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1                 150   6e-39    
ref|XP_006832128.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    148   6e-39    
ref|XP_007912472.1|  putative dtdp-d-glucose -dehydratase protein       149   6e-39    
gb|KFZ04490.1|  hypothetical protein V502_10111                         149   6e-39    
ref|XP_001598557.1|  conserved hypothetical protein                     149   7e-39    
gb|EXK77722.1|  dTDP-glucose 4,6-dehydratase                            148   7e-39    
gb|KFY82818.1|  hypothetical protein V500_10312                         149   7e-39    
gb|KDB11057.1|  dtdp-glucose 4,6-dehydratase                            149   7e-39    
ref|XP_005144815.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   7e-39    
gb|ELR02481.1|  dTDP-glucose 4,6-dehydratase                            149   8e-39    
gb|ESZ93043.1|  dTDP-D-glucose 4,6-dehydratase                          149   8e-39    
ref|XP_010185292.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   1e-38    
gb|EXK76107.1|  dTDP-glucose 4,6-dehydratase                            146   1e-38    
gb|EWC48070.1|  hypothetical protein DRE_02649                          148   1e-38    
gb|KFQ37860.1|  dTDP-D-glucose 4,6-dehydratase                          147   1e-38    
ref|XP_007834293.1|  hypothetical protein PFICI_07521                   148   1e-38    
ref|XP_005014901.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   1e-38    
ref|XP_816514.1|  GDP-mannose 4,6 dehydratase                           147   1e-38    
gb|KHJ33395.1|  putative dtdp-d-glucose -dehydratase                    148   1e-38    
ref|XP_009632893.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   1e-38    
ref|XP_007296149.1|  dTDP-glucose 4,6-dehydratase                       148   1e-38    
gb|KFX91512.1|  hypothetical protein O988_07719                         148   1e-38    
gb|KEY69402.1|  hypothetical protein S7711_05716                        148   1e-38    
ref|XP_001554971.1|  conserved hypothetical protein                     148   2e-38    
ref|XP_008023470.1|  hypothetical protein SETTUDRAFT_168049             148   2e-38    
emb|CCD44816.1|  hypothetical protein BofuT4_P051650.1                  148   2e-38    
ref|XP_006270243.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   2e-38    
gb|KFY39353.1|  hypothetical protein V495_06000                         148   2e-38    
ref|XP_003003224.1|  dTDP-D-glucose 4,6-dehydratase                     147   2e-38    
ref|NP_001088301.1|  dTDP-glucose 4,6-dehydratase                       146   2e-38    
gb|EFX02603.1|  dtdp-glucose -dehydratase                               147   2e-38    
ref|XP_005305066.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    146   2e-38    
ref|XP_007098479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   2e-38    
ref|XP_007275549.1|  dtdp-glucose -dehydratase                          147   2e-38    
dbj|GAM88310.1|  hypothetical protein ANO11243_063430                   146   2e-38    
gb|EPE08996.1|  dtdp-d-glucose -dehydratase                             147   3e-38    
ref|XP_003218711.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          146   3e-38    
gb|EFQ25012.1|  dTDP-glucose 4,6-dehydratase                            147   3e-38    
gb|KFA63530.1|  hypothetical protein S40285_00334                       147   3e-38    
gb|KIM94915.1|  hypothetical protein OIDMADRAFT_206707                  147   3e-38    
emb|CCF46206.1|  dTDP-glucose 4,6-dehydratase                           147   3e-38    
gb|KID89209.1|  dTDP-D-glucose 4,6-dehydratase                          147   4e-38    
gb|ERS98048.1|  dTDP-glucose 4,6-dehydratase                            146   4e-38    
gb|KIE00314.1|  dTDP-D-glucose 4,6-dehydratase                          147   4e-38    
ref|XP_003044521.1|  hypothetical protein NECHADRAFT_45636              146   5e-38    
gb|KFG80826.1|  dTDP-D-glucose 4,6-dehydratase                          147   5e-38    
gb|EXA38893.1|  dTDP-glucose 4,6-dehydratase                            147   5e-38    
ref|XP_007795374.1|  putative dtdp-glucose -dehydratase protein         146   5e-38    
ref|XP_004577690.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   5e-38    
gb|EXK94947.1|  dTDP-glucose 4,6-dehydratase                            147   5e-38    
gb|ENH81005.1|  dtdp-glucose -dehydratase                               147   5e-38    
gb|EWY86757.1|  dTDP-glucose 4,6-dehydratase                            147   5e-38    
gb|KID73157.1|  dTDP-D-glucose 4,6-dehydratase                          147   5e-38    
gb|KHO00791.1|  dTDP-D-glucose 4,6-dehydratase                          147   5e-38    
ref|XP_009254933.1|  hypothetical protein FPSE_03539                    147   5e-38    
gb|ENH73142.1|  Putative rhamnose biosynthetic enzyme 2                 147   6e-38    
gb|EWG46674.1|  dTDP-glucose 4,6-dehydratase                            147   6e-38    
gb|EGU76750.1|  hypothetical protein FOXB_12771                         147   6e-38    
ref|XP_011324006.1|  hypothetical protein FGSG_05467                    147   6e-38    
emb|CCT71341.1|  related to dTDP-glucose 4,6-dehydratase                147   6e-38    
ref|XP_807120.1|  GDP-mannose 4,6 dehydratase                           145   7e-38    
gb|KFH41770.1|  rhamnose biosynthetic enzyme-like protein               146   7e-38    
gb|KDN69228.1|  putative dTDP-glucose 4,6-dehydratase                   146   7e-38    
gb|EFA77295.1|  putative dTDP-D-glucose 4,6-dehydratase                 143   8e-38    



>gb|KJB61503.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=535

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+ YTPKNILITGAAGFIASHVANRLVRSYPDY IVVLDKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPDYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   313 bits (801),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+ YTPKNILITGAAGFIASHVANRLVRSYP+Y IVVLDKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPEYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLMTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  SGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   312 bits (800),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   312 bits (800),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   312 bits (800),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MAAYNPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY+PKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYSPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M T+TPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS +SPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSNASPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVAN+LVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANKLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  155



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  24   MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  83

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  84   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  143

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  144  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  178



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  23   MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  82

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  83   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  142

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  143  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  177



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M +YTPKNILITGAAGFIASHVANRL+RSYPDY IVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M +YTPKNILITGAAGFIASHVANRL+RSYPDY IVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+TYTPKNILITGAAGFIA HVANRLVRSYPDYKIVVLDKLDYCS+LKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSSLKNLIPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M +YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MPSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA YTPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MANYTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLSPSQSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  155



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGD+GSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB45830.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=403

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGD+GSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MASYEPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSVDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>gb|KJB12930.1| hypothetical protein B456_002G046100 [Gossypium raimondii]
Length=371

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY P+NILITGAAGFIASHV NRL+R+YP YKIV LDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPRNILITGAAGFIASHVTNRLIRNYPSYKIVALDKLDYCSNLKNLHPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FV+GDIGSADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIGSADLVNYLLFTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+T+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS SSPNFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLVRTYPGYKIVVLDKLDYCSNLKNLLPSNSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FV+GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVQGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  13   MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  72

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  73   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  132

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  133  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  167



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDK+DYCSNLKNL PSRSSPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPQYKIVVLDKIDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNIL+TGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCS+LKNL PS+SSPNFK
Sbjct  1    MATYKPKNILVTGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FV+GDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  155



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVRSYP+YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPEYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  155



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATFTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRL+RSYP YKIVVLDK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRL+RSYP YKIVVLDK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MAT+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAIVGNHEASQLLP  155



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS+SS NFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSSNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAIVGNHEASQLLP  155



>emb|CDY25850.1| BnaA05g14410D [Brassica napus]
Length=428

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGA GFIASHVAN L+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAGGFIASHVANCLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   310 bits (795),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVRS+P+YKIVVLDKLDYCSNLKNL PS++SPNFK
Sbjct  131  MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKASPNFK  190

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  191  FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  250

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  251  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  285



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIDSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   307 bits (786),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PSRS PNF+
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPKYKIVVLDKLDYCSNLKNLNPSRSCPNFR  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQ+RRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M+T+TPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLLPSKASANFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSNLKNLNPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            ++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_010916151.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Elaeis guineensis]
Length=673

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FV GDI SAD+VNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVNGDIASADVVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M +YTPKNILITGAAGFIASHVANRL+RSYP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPGYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLV +YP+YKIVVLDKLDYCSNLKNL  SRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVWNYPEYKIVVLDKLDYCSNLKNLNLSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB45829.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=546

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB45828.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=564

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  158



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  158



>gb|KCW47402.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=530

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PSRSSPNF
Sbjct  1    MATAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCSNLKNL PS+ S NFK
Sbjct  1    MATYKPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKLSANFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDIGSADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCS+LKNL PSRSSPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSSLKNLNPSRSSPNLK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_008812156.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHV NRL+R+YP+YKIVVLD+LDYCSNLKNL PS SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVTNRLIRNYPEYKIVVLDRLDYCSNLKNLNPSSSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  155



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA +TPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCSNL N  PSRSSPNFK
Sbjct  1    MAAHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLNNFLPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKL  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+RSYP Y IVVLDKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPHYNIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|ABF95280.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
Length=545

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 160/171 (94%), Gaps = 2/171 (1%)
 Frame = +1

Query  103  YGVILIRIAQ*EISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYC  282
            + +I+ +I +  I  +MA+YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYC
Sbjct  24   WPLIVTKIPK--ILREMASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYC  81

Query  283  SNLKNLTPSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFT  462
            SNLKNL PS++SP+FKFVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFT
Sbjct  82   SNLKNLNPSKNSPSFKFVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFT  141

Query  463  KNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            KNNIYGTHVLLEACKVTGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  142  KNNIYGTHVLLEACKVTGQVRRFIHVSTDEVYGETDEDALVGNHEASQLLP  192



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++SP+FK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+YTPKNILITGAAGFIASHVANRLVR+YPDYK+VVLDKLDYCSNLKNL PS  SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRNYPDYKVVVLDKLDYCSNLKNLHPSLCSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLV++LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVHFLLLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/153 (95%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  158



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 145/153 (95%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TYTPKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  158



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/153 (95%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  6    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  66   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  125

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  126  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  158



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR SPN K
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRPSPNLK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCS LKNL PS+SS NFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSELKNLLPSQSSANFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI+RFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  TGQIKRFIHVSTDEVYGETEEDAVVGNHEASQLLP  155



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPSFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV NR+VRSYPDYKIVVLDKLDYCSNLKNL P+ SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVTNRIVRSYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFVK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPK+ILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL P+ SSPNF
Sbjct  1    MATPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF+FV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA Y P+NILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSN+KNL PS+SSP +K
Sbjct  1    MAPYKPQNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNMKNLLPSQSSPKYK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +G +RRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  SGGVRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PSRSSPNF
Sbjct  1    MATAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M++YTPKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLLP  155



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA+Y PKNILITGAAGFIASHVANRLVR+YP+YKIVVLDKLDYCSN KNL PS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLFPSKLSPSFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MA Y PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNYLL TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNILITGAAGFIASHVANRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSSPNFKFVK
Sbjct  14   YTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFKFVK  73

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  74   GDIASADLVNFLLITEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  133

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            + RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  134  VTRFIHVSTDEVYGETDEDAVVGNHEASQLLP  165



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+R+YPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  5    TYKPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  64

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  65   KGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  124

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  125  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  157



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score =   299 bits (765),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNF
Sbjct  1    MATEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            +FVKGDI S DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   RFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCS+LKNL PSR+S N K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASQNLK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHV NRL+R+YP+Y IVVLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLHPSRSSPNFKFI  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG
Sbjct  64   KGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  123

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  124  QIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHVANRL+RSYPDYKIVVLDKLDYCS+LKNL PS SSPNFKFV
Sbjct  4    TYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S DLV+YLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT 
Sbjct  64   KGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTR  123

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  124  QIRRFIHVSTDEVYGETDEDAAVGNHEASQLLP  156



>emb|CDP21573.1| unnamed protein product, partial [Coffea canephora]
Length=247

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY P+NILITGAAGF+ASHVANRL+R+YP YKIVVLDKLDYCSN KNL PSRSSPNFK
Sbjct  1    MATYKPENILITGAAGFVASHVANRLIRNYPSYKIVVLDKLDYCSNEKNLNPSRSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN++L+TE+IDT+MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTLMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
             G I+RFIHVSTD+VYG TD DAVVGNHEASQLLP
Sbjct  121  AGNIKRFIHVSTDDVYGGTDGDAVVGNHEASQLLP  155



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSS NF
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLHPSKSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_007146360.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
 gb|ESW18354.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
Length=666

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 1/154 (1%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHV NR+VR+YPDYKIVVLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIVVLDKLDYCSNLKNLMPSRSSPNFKFI  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  513
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSG  123

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  157



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHV N LVR+YP YKIVVLDKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVTNCLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_003551914.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006602243.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=660

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 150/154 (97%), Gaps = 1/154 (1%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHV NR+VR+YPDYKI+VLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  513
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  157



>gb|KHN18103.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=660

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 150/154 (97%), Gaps = 1/154 (1%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHV NR+VR+YPDYKI+VLDKLDYCSNLKNL PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  513
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  157



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PSRSS NF
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTRNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TGAAGFIASHV NRL+R+YP YKIVVLDKLDYCSNLKNL PS+SSP FKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLNPSKSSPKFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TGAAGFIASHV NRL+++YP YKIVVLDKLDYCSNLKNL PS+SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score =   294 bits (752),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M +YTPKNILITGAAGFIA HVANRL R++ +YKIVVLDKLDYCSNLKNL PS+S+PNFK
Sbjct  1    MTSYTPKNILITGAAGFIACHVANRLTRNFTEYKIVVLDKLDYCSNLKNLLPSKSAPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FV+GDI SADLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+V
Sbjct  61   FVQGDIASADLVNHLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  148  KMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            K+  Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++S NF
Sbjct  6    KVDAYVPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSKASKNF  65

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDIGSADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  66   KFVKGDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  125

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGET+ +A+VGNHEASQLLP
Sbjct  126  VTGQIKRFIHVSTDEVYGETEAEAIVGNHEASQLLP  161



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PSR+S NFKFVK
Sbjct  6    YEPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSRASKNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  66   GDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLP
Sbjct  126  IKRFIHVSTDEVYGETEAEAIVGNHEASQLLP  157



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL P+R SPNF
Sbjct  1    MATRYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLNPARLSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDI SADLV ++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIASADLVQFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  VTGQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TGAAGFIASHV NRL+++YP YKIVVLDKLDYCSNLKNL PS+SSPN KF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNLKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSADLVN++L+TENIDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVTGQ
Sbjct  65   GDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT YTPKNILITGAAGFIASHV NRL+ +YP+YKIVVLDKLDYCSNLKNL PSR SPNF
Sbjct  1    MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGD+ SADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDA+VGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAMVGNHEASQLLP  156



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY P+NILITGAAGFIA HVANRL+R+YP YKIVVLDKLDYCSN KNL PS SSPNFK
Sbjct  1    MATYKPENILITGAAGFIACHVANRLIRNYPRYKIVVLDKLDYCSNKKNLDPSCSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TG I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  121  TGNIKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  155



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHV NRL+R+YP+Y IVVLDKLDYCSNLKNL PSRSS N 
Sbjct  1    MATAYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLLPSRSSLNI  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KF+KGDIGSADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFIKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            VTGQI+RFIHVSTDEVYGET+EDAVVGNHEASQLLP
Sbjct  121  VTGQIKRFIHVSTDEVYGETEEDAVVGNHEASQLLP  156



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = +1

Query  151  MAT-YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNF  327
            MAT Y PKNILITGAAGFIASHVA R+ + YPDYKIVVLDKLDYCSNLKNL P  SSPNF
Sbjct  1    MATAYKPKNILITGAAGFIASHVAIRITKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNF  60

Query  328  KFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  507
            KFVKGDI SADLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  61   KFVKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  120

Query  508  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +TGQI+RFIHVSTDEVYGETDEDAVVGN EASQLLP
Sbjct  121  ITGQIKRFIHVSTDEVYGETDEDAVVGNKEASQLLP  156



>gb|AFW77499.1| hypothetical protein ZEAMMB73_283149 [Zea mays]
Length=529

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  166



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNILITGAAGFIASHV NRL+R+YPDYKIVVLDKLDYCS+LKNL  SRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDRSRSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS++S NFKFVK
Sbjct  10   YVPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKASKNFKFVK  69

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  70   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  129

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLP
Sbjct  130  IKRFIHVSTDEVYGETEAEAIVGNHEASQLLP  161



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVA R+ + YPDYKIVVLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRVTKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVN+LL+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC++TGQ
Sbjct  65   GDIASADLVNFLLVTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRITGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  65   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  156



>gb|KHM99622.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=582

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 1/154 (1%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TY PKNILITGAAGFIASHV NR+V++YPDYKI+VLDKLDYCSNLKNL    SSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVQNYPDYKIIVLDKLDYCSNLKNLIHLCSSPNFKFI  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  513
            KGDIGSADLVNY+L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  157



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHVA R+ + YPDYKI+VLDKLDYCSNLKNL P  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLVN+LL+TENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLLP  166



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            + PKNILITGAAGFIASHVANRL+R+YP YKIVVLDKLDYCSNLKNL PS+ S NFKFVK
Sbjct  2    HEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKGSKNFKFVK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  62   GDIASADLVNFLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLLP
Sbjct  122  IKRFIHVSTDEVYGETEVEAIVGNHEASQLLP  153



>ref|XP_002515360.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
 gb|EEF46809.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
Length=369

 Score =   275 bits (702),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S   A Y PK ILITGAAGFIASHV NRL+R+YPDYKIV LDKLDYCS+L+NLTP RSS
Sbjct  1    MSSNHAPYEPKKILITGAAGFIASHVTNRLIRNYPDYKIVALDKLDYCSSLRNLTPCRSS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVKGDI SADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIASADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>ref|XP_002964674.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
 gb|EFJ35007.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
Length=676

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP+NILITGAAGFIASHVANRLVRSYP YKIVVLDKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLLP
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLLP  165



>ref|XP_002989472.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
 gb|EFJ09348.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
Length=675

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP+NILITGAAGFIASHVANRLVRSYP YKIVVLDKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLLP
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLLP  165



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TGAAGFIASHV NRL+R+YPDY IVVLDKLDYCSNLKNL PS SSPNFKF+K
Sbjct  5    YKPKNILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSPNFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GD GSAD VN++L+TENIDTIMHFAAQTHVDNSFGNSF FTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDKGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNIYGTHVLLEACKVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RF+HVSTDEVYGET+E AVVGNHEASQLLP
Sbjct  125  IKRFVHVSTDEVYGETNEGAVVGNHEASQLLP  156



>gb|EMT08126.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=433

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = +1

Query  145  VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  324
            ++MATY PKNILITGAAGFIASHVANRLVR+YP Y IV+LD++DYCS+L+NL PSR SPN
Sbjct  64   LQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPN  123

Query  325  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  504
            FKFV+GDI SADLVN+LL+TE+IDT+MHFAAQTHVDNSF +SFEFTKNN+YGTHVLLEAC
Sbjct  124  FKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSSSFEFTKNNVYGTHVLLEAC  183

Query  505  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            K   +IRRFIHVSTDEVYGETD +AVVGNHE S+LLP
Sbjct  184  KQV-KIRRFIHVSTDEVYGETDLNAVVGNHEESRLLP  219



>gb|EMS55907.1| putative rhamnose biosynthetic enzyme 3 [Triticum urartu]
Length=492

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 144/157 (92%), Gaps = 1/157 (1%)
 Frame = +1

Query  145  VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  324
            ++MATY PKNILITGAAGFIASHVANRLVR+YP Y IV+LD++DYCS+L+NL PSR SPN
Sbjct  90   LQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPN  149

Query  325  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  504
            FKFV+GDI SADLVN+LL+TE+IDT+MHFAAQTHVDNSF  SFEFTKNN+YGTH+LLEAC
Sbjct  150  FKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSCSFEFTKNNVYGTHILLEAC  209

Query  505  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            K   +IRRFIHVSTDEVYGETD +AVVGNHE S+LLP
Sbjct  210  KQV-KIRRFIHVSTDEVYGETDVNAVVGNHEESRLLP  245



>ref|XP_004172221.1| PREDICTED: probable rhamnose biosynthetic enzyme 2-like, partial 
[Cucumis sativus]
Length=354

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLLP  160



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK+IL+TGAAGFIASHV NRL+R+YPDY IVVLDKLDYCSNLKNL PS SS NFKF+K
Sbjct  5    YKPKSILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSANFKFIK  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDIGSAD VN++L+TENIDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLEAC VTGQ
Sbjct  65   GDIGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNICGTHVLLEACNVTGQ  124

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RF+HVSTDEVYGET+EDAVVGN EASQLLP
Sbjct  125  IKRFVHVSTDEVYGETNEDAVVGNPEASQLLP  156



>ref|XP_008351771.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnose biosynthetic 
enzyme 1, partial [Malus domestica]
Length=340

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  175  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  354
            ILITGAAGFI  HV N+L+R+YP+YKI+VLDKLDYCSNLKNL PS SSPN KF+KGDI S
Sbjct  1    ILITGAAGFIGXHVVNQLMRNYPEYKILVLDKLDYCSNLKNLHPSHSSPNLKFIKGDICS  60

Query  355  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI  534
            AD VN +L+ E+IDTIMHFAAQTHVDNSFGNSFEFTKNN+YGT VLLEACKVTGQI+RFI
Sbjct  61   ADFVNSILLNESIDTIMHFAAQTHVDNSFGNSFEFTKNNVYGTQVLLEACKVTGQIKRFI  120

Query  535  HVSTDEVYGETDEDAVVGNHEASQLLP  615
            HVSTDEVYGETDE+AVVGNHEASQLLP
Sbjct  121  HVSTDEVYGETDENAVVGNHEASQLLP  147



>ref|XP_011082935.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Sesamum indicum]
Length=384

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M  Y P+NILITGAAGFIASHVAN L R+Y +Y+I+VLDKLDYCSNLKNL PS+S  NFK
Sbjct  1    MDKYKPRNILITGAAGFIASHVANWLTRNYSEYRIIVLDKLDYCSNLKNLDPSQSHHNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGD+ SADLVNY+L TE+IDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDVCSADLVNYILATEDIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKS  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
             G I+RFIHVSTDEVYGETDE+A VGNHEASQLLP
Sbjct  121  FGHIKRFIHVSTDEVYGETDENATVGNHEASQLLP  155



>gb|EYU29575.1| hypothetical protein MIMGU_mgv1a008395mg [Erythranthe guttata]
Length=375

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M  Y PKNILITG AGFIASHV+N L R+Y  Y IVVLDKLDYCSNLKNL  SRS PNFK
Sbjct  1    MEKYKPKNILITGGAGFIASHVSNWLTRNYSQYIIVVLDKLDYCSNLKNLDSSRSFPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADLVNY+L+TE+IDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDICSADLVNYILVTESIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKA  120

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            + +I+RF+HVSTDEVYGETDE+A VGNHEASQLLP
Sbjct  121  SNRIKRFVHVSTDEVYGETDENAAVGNHEASQLLP  155



>ref|XP_006450198.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
 gb|ESR63438.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
Length=661

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  8    ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  67

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  68   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  127

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLP
Sbjct  128  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLP  161



>ref|XP_006483733.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=681

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  28   ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  87

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  88   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  147

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLP
Sbjct  148  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLP  181



>gb|KDO67325.1| hypothetical protein CISIN_1g035631mg [Citrus sinensis]
Length=684

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A+Y PK ILITGAAGFI SHV NRL+++YPDY+IV LDKLDYCS+LKNL PSR+SPNFKF
Sbjct  8    ASYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKF  67

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            +KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  68   LKGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLT  127

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            GQ++RFIHVSTDEVYGETD ++ +GN EASQLLP
Sbjct  128  GQVKRFIHVSTDEVYGETDMESDIGNPEASQLLP  161



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            TYTPKNIL+TGAAGFIASHV NRL+++YP+Y IV LDKLDYCS++KNL PS+SSPNFKFV
Sbjct  8    TYTPKNILLTGAAGFIASHVTNRLIKNYPNYNIVALDKLDYCSSIKNLLPSQSSPNFKFV  67

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  516
            KGDI S+DLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT 
Sbjct  68   KGDIMSSDLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTR  127

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            QI+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  QIKRFIHVSTDEVYGETDAETDIGNCEASQLLP  160



>emb|CAN62061.1| hypothetical protein VITISV_001928 [Vitis vinifera]
Length=619

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S   A Y P+NILITGAAGFIASHV NRLV+++PDY+IV LDKLDYCSN+KNL PSRSS
Sbjct  1    MSSGPAPYVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
             NFKFVKGDI  ADLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   SNFKFVKGDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKVT +I+RFIHVSTDEVYGETD D  +GN EASQLLP
Sbjct  121  ACKVTKRIKRFIHVSTDEVYGETDLDTDIGNPEASQLLP  159



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  8    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  IKRFIHVSTDEVYGETDLETDIGNPEASQLLP  159



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV NRL+++YP YKIV LDKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLLP  160



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S   A Y P+NILITGAAGFIASHV NRLV+++PDY+IV LDKLDYCSN+KNL PSRSS
Sbjct  1    MSSGPAPYVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
             NFKFVKGDI  ADLVN+LL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   SNFKFVKGDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKVT +I+RFIHVSTDEVYGETD D  +GN EASQLLP
Sbjct  121  ACKVTKRIKRFIHVSTDEVYGETDLDTDIGNPEASQLLP  159



>gb|AFW66842.1| hypothetical protein ZEAMMB73_620875 [Zea mays]
Length=407

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP--NFKF  333
            Y PK ILITGAAGFIASHVA R+V  YP+YK+VVLDKLDYCSNLKNL P   S   NFKF
Sbjct  7    YKPKRILITGAAGFIASHVAIRIVNRYPEYKVVVLDKLDYCSNLKNLLPVMGSGGNNFKF  66

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VKGDI SADLV+++L TE IDT+MHFAAQTHVDNSFGNS EFTKNNIYGTHVLLE+C+  
Sbjct  67   VKGDIASADLVSFILATEGIDTVMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLESCRTA  126

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
             QIRRFIHVSTDEVYGETD DAVVGNHEASQLLP
Sbjct  127  AQIRRFIHVSTDEVYGETDGDAVVGNHEASQLLP  160



>ref|XP_011031381.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=660

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S   A Y P+ ILITGAAGFIASHV  RL++ YPDYKIV LDKLDYCSNLKNL   R S
Sbjct  1    MSSDPAPYAPRKILITGAAGFIASHVTRRLIKDYPDYKIVALDKLDYCSNLKNLAKCRGS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVKGDI  ADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>ref|XP_007225132.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
 gb|EMJ26331.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
Length=660

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFI SHV NRL+++YP YKIV LDKLDYCS+ KNL PSR+SPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKLDYCSSFKNLRPSRASPNFKFVK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI  ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT Q
Sbjct  68   GDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQQ  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>ref|XP_006382137.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
 gb|ERP59934.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
Length=660

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S   A Y P+ ILITGAAGFIASHV  RL++ YPDYKIV LDKLDYCSNLKNL   R S
Sbjct  1    MSSDPAPYAPRKILITGAAGFIASHVIRRLIKDYPDYKIVALDKLDYCSNLKNLATCRGS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVKGDI  ADLVN+LLI E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKVT +I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKVTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 132/155 (85%), Gaps = 19/155 (12%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  136



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 132/155 (85%), Gaps = 19/155 (12%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  136



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S + A Y PK ILITGAAGFIASHV +RL+ +YP+YKIV LDKLDYCS+LKNL P  SS
Sbjct  1    MSSEPAPYAPKKILITGAAGFIASHVTSRLINNYPEYKIVALDKLDYCSSLKNLQPCFSS  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVKGDI   DL+NYLL+ E+IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKGDIICTDLLNYLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACKV+ QI+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKVSKQIKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>ref|XP_008220004.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=660

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFI SHV N+L+++YP Y IV LDKLDYCS+ KNL PSR+SPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNQLIKNYPSYNIVALDKLDYCSSFKNLRPSRASPNFKFVK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI  ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT Q
Sbjct  68   GDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQQ  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLLP  159



>ref|XP_009363628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009367987.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=660

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFI SHV NRL+++YP YKIV LDK+DYCS+ KNL P RSSPNFKFVK
Sbjct  8    YAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFVK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI  ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQR  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  VKRFIHVSTDEVYGETDMETNIGNPEASQLLP  159



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A Y PKNILITGAAGFI SHV NRL + YPDY+IV LDKLDYCS+LKNL PS SSPNFKF
Sbjct  5    APYVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKF  64

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  65   VKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLT  124

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
              I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  125  KSIKRFIHVSTDEVYGETDLETDIGNPEASQLLP  158



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK+ILITGAAGFI SHV NRL+++YP YKIV LDK+DYCS+ KNL P RSSPNFKFVK
Sbjct  8    YAPKSILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFVK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI  ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTQR  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  128  VKRFIHVSTDEVYGETDMETNIGNPEASQLLP  159



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFI SHV NRL + YPDY+IV LDKLDYCS+LKNL PS SSPNFKFVK
Sbjct  7    YVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKFVK  66

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
             DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T  
Sbjct  67   ADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLTKS  126

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  127  IKRFIHVSTDEVYGETDLETDIGNPEASQLLP  158



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 130/155 (84%), Gaps = 19/155 (12%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YP YKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPHYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI S DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  136



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S + A Y PKN+LITGAAGFI SHV NRL + YP+Y+IV LDKLDYCS+LKNL PS S 
Sbjct  1    MSSEPAPYVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSC  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACK+T  I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKLTKSIKRFIHVSTDEVYGETDLETDIGNPEASQLLP  159



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +S + A Y PKN+LITGAAGFI SHV NRL + YP+Y+IV LDKLDYCS+LKNL PS S 
Sbjct  1    MSSEPAPYVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSC  60

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLE
Sbjct  61   PNFKFVKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLE  120

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ACK+T  I+RFIHVSTDEVYGETD +  +GN EASQLLP
Sbjct  121  ACKLTKCIKRFIHVSTDEVYGETDLETDIGNPEASQLLP  159



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 131/156 (84%), Gaps = 20/156 (13%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATY PKNILITGAAGFIASHVANRLVR+YPDYKIVVLDKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI S DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  511  TG-QIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TG QIRRFIHVSTDEVYGETDEDA VGNHEASQLLP
Sbjct  102  TGQQIRRFIHVSTDEVYGETDEDASVGNHEASQLLP  137



>ref|XP_003545554.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
 gb|KHN14574.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  RL+ SYP YKIV LDK+DYCS  KNL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDSYPSYKIVALDKVDYCSTFKNLQSCASSPNFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD +A +GNHEASQLLP
Sbjct  122  VKRFIHVSTDEVYGETDLEADIGNHEASQLLP  153



>ref|XP_003566438.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=370

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 6/156 (4%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A Y PKNILITGAAGFIASHVANRLVR YP Y+I+ LDKLDYC++L NL P+ +SPNF+F
Sbjct  16   AEYVPKNILITGAAGFIASHVANRLVRDYPWYRILALDKLDYCASLNNLAPALASPNFRF  75

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            V+ D+ SADLV +LL  E IDT+MHFAAQTHVD    NSFEFTKNN+ GTHVLLEAC+  
Sbjct  76   VRADVASADLVLHLLNGERIDTVMHFAAQTHVD----NSFEFTKNNVLGTHVLLEACRRA  131

Query  514  --GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
              G +RRF+HVSTDEVYGETD+DA VGNHEASQLLP
Sbjct  132  GPGAVRRFVHVSTDEVYGETDKDAAVGNHEASQLLP  167



>ref|XP_004292875.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
 ref|XP_011459027.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
Length=660

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFI SHV +RL+++YP+Y IV LDKLDYCS+ KNL   ++S NFKF+K
Sbjct  8    YAPKNILITGAAGFIGSHVTSRLIKNYPNYNIVALDKLDYCSSFKNLHACKASHNFKFIK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI  ADLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT +
Sbjct  68   GDIACADLVNHLLMVEEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVTKR  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            I+RFIHVSTDEVYGETD  + +GN EASQLLP
Sbjct  128  IKRFIHVSTDEVYGETDMGSDIGNPEASQLLP  159



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  R++  YP YKIV LDKLDYCS  KNL    SSP FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRIINKYPSYKIVALDKLDYCSTFKNLQSCTSSPKFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S D+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASVDIVNHVLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD DA +GNHE SQLLP
Sbjct  122  VKRFIHVSTDEVYGETDLDANIGNHETSQLLP  153



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL P  SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTKRLINKYPSYKIVALDKLDYCSTFKNLEPCTSSQKFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SAD+VN+LLI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASADIVNHLLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD D  +GN E SQLLP
Sbjct  122  VKRFIHVSTDEVYGETDLDTDIGNIETSQLLP  153



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  +L+  YP YKIV LDKLDYCS  +NL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTKLINKYPSYKIVALDKLDYCSTFRNLKSCISSPNFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHVLIEEKIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTDC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD +  +GNHEAS+LLP
Sbjct  122  VKRFIHVSTDEVYGETDLEDDIGNHEASRLLP  153



>gb|KHN30780.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL    SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD DA +GNHEASQLLP
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLLP  153



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITGAAGFIASHV  RL+  YP YKIV LDKLDYCS  KNL    SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI +AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFIHVSTDEVYGETD DA +GNHEASQLLP
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLLP  153



>ref|XP_010531915.1| PREDICTED: LOW QUALITY PROTEIN: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=487

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 132/157 (84%), Gaps = 8/157 (5%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            M  YTPK ILI GAAGFIASHVANRL+R     K VVL+KLD C NL    PS+SS NFK
Sbjct  1    MVFYTPKTILIIGAAGFIASHVANRLIRIT---KTVVLEKLDSCLNL---NPSKSSSNFK  54

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHV--DNSFGNSFEFTKNNIYGTHVLLEAC  504
            FVKGDI SADLVNYLLITE IDTIMHFAAQTH   DNSFGNSF+ TK+NIYGTHVLLEAC
Sbjct  55   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHATGDNSFGNSFQLTKDNIYGTHVLLEAC  114

Query  505  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            K+T +IRR IHVSTDEVYG+TDEDA+VGNHEASQLLP
Sbjct  115  KMTDRIRRSIHVSTDEVYGQTDEDAIVGNHEASQLLP  151



>ref|XP_003569141.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=361

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +1

Query  157  TYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFV  336
            +Y PKNILITGAAGFI SHVANRLVRSYP Y ++VLDK+DYCS+LKNL PSR SPNFKFV
Sbjct  4    SYEPKNILITGAAGFIGSHVANRLVRSYPHYNVLVLDKMDYCSSLKNLDPSRGSPNFKFV  63

Query  337  KGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGN-SFEFTKNNIYGTHVLLEACKVT  513
            +GDI S  LV  LL+  +IDT+MHFAAQTHVD+SFG+ S EFTKNN++ THVLLEACK  
Sbjct  64   EGDIASPGLVRRLLVDNSIDTVMHFAAQTHVDSSFGDGSLEFTKNNVHCTHVLLEACKQV  123

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
             +I+RFIHVSTDEVYGE++ DAV G  E S+LLP
Sbjct  124  -KIKRFIHVSTDEVYGESEADAVAGKREDSRLLP  156



>gb|EPS62084.1| hypothetical protein M569_12709, partial [Genlisea aurea]
Length=617

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  289  LKNLTPSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN  468
            LKNL PS++SPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN
Sbjct  1    LKNLIPSKASPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN  60

Query  469  NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP
Sbjct  61   NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  109



>ref|XP_001701714.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
 gb|EDP06689.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
Length=328

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITG AGFIASHV  R+ ++YP YK+VVLDKLDYC++LKNL    + PNF+F+K
Sbjct  15   YEPKNILITGGAGFIASHVVIRITKNYPQYKVVVLDKLDYCASLKNLGSVANLPNFRFIK  74

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G+
Sbjct  75   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEAARMHGR  134

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFI+VSTDEVYGET      G  E+S L P
Sbjct  135  IRRFINVSTDEVYGETSLGKTTGLVESSHLDP  166



>ref|XP_002953659.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
 gb|EFJ45283.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
Length=366

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNILITG AGFIASHV  R+   YP+YK+VVLDKLDYC+++ NL+     PNF+ +K
Sbjct  14   YTPKNILITGGAGFIASHVVIRIATRYPEYKVVVLDKLDYCASVNNLSCLADKPNFRLIK  73

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G 
Sbjct  74   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEASRMAGT  133

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFI+VSTDEVYGET      G  E+S L P
Sbjct  134  IRRFINVSTDEVYGETSLGKTTGLVESSHLDP  165



>ref|XP_011401987.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
 gb|KFM28938.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
Length=372

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP+NIL+TG AGFI SHV  RLV+ YP Y++VV D LDYC+ L NL   + +PNFKF+K
Sbjct  7    YTPRNILVTGGAGFIGSHVVVRLVQRYPQYRVVVFDCLDYCATLHNLQAVKDAPNFKFIK  66

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ Y++ TE IDT+MHFAAQTHVD+SFGNS  FT NN+YGTHVLLEA +  GQ
Sbjct  67   GDIKSGDLLYYVMETEKIDTVMHFAAQTHVDHSFGNSVSFTINNMYGTHVLLEAARRYGQ  126

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            + RFI+VSTDEVYGET      G  E S+L P
Sbjct  127  VHRFINVSTDEVYGETSFGLAAGLVEKSRLEP  158



>gb|AGE49559.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Can0610SP]
Length=350

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>gb|AGE60164.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
WI0606]
Length=350

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>ref|XP_005648752.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24208.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
Length=363

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK+IL+TG AGFIASHV  RL   YP+ K+VVLDKLDYC+++ NL   +  PNFKFVK
Sbjct  25   YVPKSILLTGGAGFIASHVVIRLCSRYPNTKVVVLDKLDYCASMHNLDAVKDLPNFKFVK  84

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADL++++L  +NIDT+MHFAAQTHVDNSFGNS  FT NN +GTHVLLEA +V G 
Sbjct  85   GDIQSADLISFVLKEDNIDTVMHFAAQTHVDNSFGNSLAFTMNNTHGTHVLLEAARVYGG  144

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFI VSTDEVYGET      G  E S L P
Sbjct  145  IRRFIAVSTDEVYGETSVGRDSGCTETSTLEP  176



>ref|XP_005644844.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20300.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=361

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            + PK IL+TG AGFI SHVA  L R YP YK++V DKLDYC   KNL     +PNFKF+K
Sbjct  8    FVPKVILVTGGAGFIGSHVAVCLTRKYPQYKVIVFDKLDYCGTQKNLASLMDAPNFKFIK  67

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GD+ S DL+NY+L  EN+DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC++ G 
Sbjct  68   GDLQSGDLLNYILRRENVDTVLHFAAQTHVDNSFGNSLAFTVNNTYGTHVLLEACRMFGG  127

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRF++VSTDEVYGE+      G  E S L P
Sbjct  128  IRRFVNVSTDEVYGESSYGKDKGVGEDSTLEP  159



>ref|XP_007508076.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20795.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITG AGFIASH A  L + YP  KIVVLDKLDYC+N+K+L+      NFKF+ 
Sbjct  3    YEPKNILITGGAGFIASHAAILLAKKYPHCKIVVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLV+Y+L  ENIDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLE+CK+ G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTKNNILGTHVLLESCKMLGT  122

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  612
            I+RF+HVSTDEVYGE+  +    N E + LL
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLL  153



>ref|XP_003057320.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58965.1| predicted protein [Micromonas pusilla CCMP1545]
Length=691

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y P+N+LITG AGFIASHVA R  + YP Y +VV+DKLDYC+NL NL    + PNFKFVK
Sbjct  23   YVPQNVLITGGAGFIASHVALRFAKRYPRYNVVVVDKLDYCANLNNLREIAALPNFKFVK  82

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG-  516
             D+GSADL+ Y++  E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  83   ADVGSADLMTYVMREEQIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKSLGD  142

Query  517  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  612
            QI+RF+HVSTDEVYGE+  +    N EA+ LL
Sbjct  143  QIKRFLHVSTDEVYGESSYELDKANVEAASLL  174



>gb|AGE57039.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-3]
Length=350

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>ref|YP_001427025.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
 gb|ABT16678.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
Length=350

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>gb|AGE50238.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Canal-1]
Length=359

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK++LITG AGFIAS V  +LVR YP+ K+VVLDKLDYC+ L NL   R +PNFKF+K
Sbjct  15   YQPKSVLITGGAGFIASWVTIKLVRRYPECKVVVLDKLDYCATLNNLATIRDAPNFKFIK  74

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S+DL+ ++L  E +DTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  75   GDIQSSDLITHILQQEEVDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLHGG  134

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  135  VQRFINVSTDEVYGESSLGKTEGLDEHSSLEP  166



>gb|AGE59831.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
TN603.4.2]
Length=347

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV  YP+ K+VV+DK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVHRYPECKVVVIDKMDYCATLNNLATVRDAPNFKFVK  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  154



>ref|XP_011401232.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
 gb|KFM28219.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
Length=746

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ISVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSS  318
            +++ +  Y P++ILITG AGFIASHV  +LV+ YP  K+VVLDKLDYC+ L+NL   R  
Sbjct  390  VAMAVEEYVPRSILITGGAGFIASHVTIKLVKRYPHVKVVVLDKLDYCATLENLKSIRDC  449

Query  319  PNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  498
            PNFKFVKG+I S DL+ ++L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLE
Sbjct  450  PNFKFVKGEIQSTDLIVHILETEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYGTHVLLE  509

Query  499  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            + ++ G+IRRF++VSTDEVYGET      G  EAS L P
Sbjct  510  SARLYGKIRRFLNVSTDEVYGETSLGKAEGLSEASALEP  548



>gb|AGE55724.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MN0810.1]
Length=353

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP ++LITG AGFIAS V  +LV+ YP+ K+VVLDKLDYC+ L NL   R +PNFKFVK
Sbjct  7    YTPTSVLITGGAGFIASWVTIKLVKRYPECKVVVLDKLDYCATLNNLAAVRDAPNFKFVK  66

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADL+ ++L  ENIDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++   
Sbjct  67   GDIQSADLITHVLEQENIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYVG  126

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  127  VQRFINVSTDEVYGESSLGKAEGLDEHSSLEP  158



>gb|AGE59487.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
OR0704.3]
Length=350

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>ref|XP_002500589.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61847.1| predicted protein [Micromonas sp. RCC299]
Length=682

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y  KN+LITG AGFIASHVA    + YP YK+VV+DKLDYC+NL NL       NFKFVK
Sbjct  12   YEAKNVLITGGAGFIASHVAILFAKKYPQYKVVVVDKLDYCANLNNLRSIAGLLNFKFVK  71

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GD+GSADL+ Y++ +E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  72   GDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKTLGT  131

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  612
            I+RF+HVSTDEVYGE+  +    N EA+ LL
Sbjct  132  IKRFLHVSTDEVYGESSYEKDEANVEAASLL  162



>gb|AGE53603.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
GM0701.1]
Length=347

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YT K++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTLKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            IRRFI+VSTDEVYGE+      G  E S L P
Sbjct  123  IRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  154



>gb|AGE56041.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MO0605SPH]
Length=350

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>gb|AGE56705.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-2]
Length=347

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  122

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  154



>gb|KDD76685.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=376

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
             +Y P+NIL+TG AGFI SHV   L+R +P Y+++VLDKLDYC++L NL     +P+FKF
Sbjct  19   GSYIPRNILVTGGAGFIGSHVVRYLLRHHPTYRVIVLDKLDYCASLFNLEELEGNPSFKF  78

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            +KGDI S DL+ Y+L TENIDTI+HFAAQTHVDNSFGNS  FT NNI GTHVLLEA +  
Sbjct  79   IKGDILSGDLLIYILATENIDTILHFAAQTHVDNSFGNSLAFTMNNICGTHVLLEAARTY  138

Query  514  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            G +RR I+VSTDEVYGET      G  E+S + P
Sbjct  139  GLVRRLINVSTDEVYGETSVGLAQGLPESSPMAP  172



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 114/155 (74%), Gaps = 31/155 (20%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            MATYTPKNILIT  A FIASHVANRL+R+Y  YKIV                     NFK
Sbjct  1    MATYTPKNILITRVARFIASHVANRLIRNYLSYKIV---------------------NFK  39

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
            FVKGDI SA LVNYLL+ E+IDTIMHFAAQTH          FTKNNIYGTHVLLEACKV
Sbjct  40   FVKGDISSAGLVNYLLVAESIDTIMHFAAQTH----------FTKNNIYGTHVLLEACKV  89

Query  511  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            TGQIRRFIHVS DEVYG+TDEDA+VGNHEA QLLP
Sbjct  90   TGQIRRFIHVSIDEVYGDTDEDAIVGNHEAFQLLP  124



>ref|XP_007514013.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15450.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKN+LITG AGFIASHVA    + YP  K++VLDKLDYC+N+K+L+      NFKF+ 
Sbjct  3    YEPKNVLITGGAGFIASHVAILFAKKYPHCKVIVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI SADLV+Y+L  ENIDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+CK  G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTENNILGTHVLLESCKTLGT  122

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  612
            I+RF+HVSTDEVYGE+  +    N E + LL
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLL  153



>ref|XP_005854661.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
 gb|EKU21695.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
Length=358

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  142  SVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP  321
            S   A YTPKNIL+TG AGFIASHV   LV+ +P YKIV LD+LDYCS L+NL   +   
Sbjct  10   SAPEAEYTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYK  69

Query  322  NFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  501
            N+KFVKG+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+
Sbjct  70   NYKFVKGNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLES  129

Query  502  CKVTGQIRRFIHVSTDEVYGETDED  576
             KV   I+RFIHVSTDEVYGE   D
Sbjct  130  AKVH-NIKRFIHVSTDEVYGEGAAD  153



>emb|CBN76510.1| conserved unknown protein [Ectocarpus siliculosus]
Length=381

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  154  ATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKF  333
            A YTP+NILITG AGFIASH+   LV  YP Y IVV D+LDYC+ L+NL      PN+KF
Sbjct  19   AHYTPQNILITGGAGFIASHLVILLVEKYPQYNIVVFDRLDYCACLENLDCIAQKPNYKF  78

Query  334  VKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  513
            VKG+I S+D+V Y+L  E IDTI+HFAAQTHVDNSFGNSF+FT+NNIYGTHVLLE+ K  
Sbjct  79   VKGNICSSDMVTYVLREEKIDTILHFAAQTHVDNSFGNSFQFTQNNIYGTHVLLESAKKV  138

Query  514  GQIRRFIHVSTDEVYGETDED  576
            G I+RF+HVSTDEVYGE + D
Sbjct  139  G-IKRFVHVSTDEVYGEGEHD  158



>gb|AGE57735.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NTS-1]
Length=350

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPK++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  66   GDIQSTDLLAHVLKQEKIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            ++RFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VQRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>gb|KDD73904.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=365

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 117/162 (72%), Gaps = 10/162 (6%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK+IL+TG AGFIASHV  +LV+ YP  KIVVLDKLDYC+ L NLT  +   NFKFVK
Sbjct  6    YNPKSILVTGGAGFIASHVTIKLVQQYPGCKIVVLDKLDYCATLNNLTSVKDCSNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNI----------YGTHV  489
            GDI SADL+ ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN           YGTHV
Sbjct  66   GDIQSADLLVHILEQEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYVVGHVERVEYGTHV  125

Query  490  LLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            LLE+C++ G+IRRF++VSTDEVYGE+      G  E S L P
Sbjct  126  LLESCRLYGRIRRFVNVSTDEVYGESSLGKEEGLQETSPLEP  167



>gb|EWM28017.1| rhamnose biosynthetic enzyme expressed [Nannochloropsis gaditana]
Length=403

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  142  SVKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSP  321
            S   A YTPKNIL+TG AGFIASHV   LV+ +P YKIV LD+LDYCS L+NL   +   
Sbjct  55   SAPEAEYTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYK  114

Query  322  NFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  501
            N+KFVKG+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+
Sbjct  115  NYKFVKGNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLES  174

Query  502  CKVTGQIRRFIHVSTDEVYGETDED  576
             KV   I+RFIHVSTDEVYGE   D
Sbjct  175  AKVH-NIKRFIHVSTDEVYGEGAAD  198



>ref|XP_002181238.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47161.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=437

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP+NIL+TG AGFIASHVA  L + YP YKIVV D LDYC+ L NL      PNFKFVK
Sbjct  78   YTPENILVTGGAGFIASHVAILLCKKYPQYKIVVYDCLDYCACLANLQELFDLPNFKFVK  137

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLV+Y+L  E IDTI+HFAAQTHVDNSFGNSF FT+ NIYGTHVLLE+ K    
Sbjct  138  GDIASPDLVSYVLREEKIDTILHFAAQTHVDNSFGNSFAFTQTNIYGTHVLLESAKCCDT  197

Query  520  IRRFIHVSTDEVYGETDE  573
            +RRF+HVSTDEVYGE ++
Sbjct  198  LRRFVHVSTDEVYGEGED  215



>gb|AGE49233.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Br0604L]
Length=350

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTP ++L+TG AGFI SHV  +LV+ YP+ K+VVLDK+DYC+ L NL   R +PNFKFVK
Sbjct  6    YTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  65

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  66   GDIRSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  125

Query  520  IRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            +RRFI+VSTDEVYGE+      G  E S L P
Sbjct  126  VRRFINVSTDEVYGESSLGKKEGLDEHSSLEP  157



>gb|EWM30544.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana]
Length=423

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            YTPKNIL+TG AGFI SHVA  L   YP YKIVVLDKLDYC++L+NL       NFKFVK
Sbjct  18   YTPKNILVTGGAGFIGSHVAILLAHRYPKYKIVVLDKLDYCASLENLADVTRRRNFKFVK  77

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            G+I S+DLVN++L  E IDTI+H AAQTHVDNSFGNSF FT+NNI GTHVLLE+ KV G 
Sbjct  78   GNICSSDLVNFVLEEEEIDTIVHLAAQTHVDNSFGNSFSFTQNNILGTHVLLESAKVHG-  136

Query  520  IRRFIHVSTDEVYGE  564
            IRRF+HVSTDEVYGE
Sbjct  137  IRRFVHVSTDEVYGE  151



>ref|XP_005781167.1| hypothetical protein EMIHUDRAFT_442934 [Emiliania huxleyi CCMP1516]
 gb|EOD28738.1| hypothetical protein EMIHUDRAFT_442934 [Emiliania huxleyi CCMP1516]
Length=378

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  324
            V +  YTP NIL+TG AGFIASHV   LV  YP YK+V LDK+DYCS+L NL   +  PN
Sbjct  20   VDVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPN  79

Query  325  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  504
            F+ VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ GTHVL+EA 
Sbjct  80   FRMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLGTHVLVEAA  139

Query  505  KVTGQIRRFIHVSTDEVYGET  567
            K  G IRRFIHVSTDEVYG +
Sbjct  140  KKAG-IRRFIHVSTDEVYGSS  159



>ref|XP_002291084.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
 gb|EED91191.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNIL+TG AGFI SHVA  L + YP Y IVV DKLDYCS L NL       NFKFVK
Sbjct  11   YIPKNILLTGGAGFIGSHVAILLAKKYPHYNIVVYDKLDYCSCLANLDEVSRLKNFKFVK  70

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLV+Y+++ E+IDT+MHFAAQTHVDNSFGNSF FT++NIYGTHV+LEA K    
Sbjct  71   GDITSPDLVSYVMVEEDIDTVMHFAAQTHVDNSFGNSFNFTQSNIYGTHVMLEAAKCHRG  130

Query  520  IRRFIHVSTDEVYGETD  570
            ++RFIHVSTDEVYGE +
Sbjct  131  MKRFIHVSTDEVYGEGE  147



>ref|XP_005778340.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 ref|XP_005784020.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
 gb|EOD25911.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 gb|EOD31591.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
Length=378

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  151  MATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFK  330
            +  YTP NIL+TG AGFIASHV   LV  YP YK+V LDK+DYCS+L NL   +  PNFK
Sbjct  22   VGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPNFK  81

Query  331  FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  510
             VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ GTHVL+EA K 
Sbjct  82   MVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLGTHVLVEAAKK  141

Query  511  TGQIRRFIHVSTDEVYGET  567
             G IRRFIHVSTDEVYG +
Sbjct  142  AG-IRRFIHVSTDEVYGSS  159



>ref|XP_005757838.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
 gb|EOD05409.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
Length=378

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  VKMATYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPN  324
            V +  YTP NIL+TG AGFIASHV   LV  YP YK+V LDK+DYCS+L NL   +  PN
Sbjct  20   VDVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPN  79

Query  325  FKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  504
            F+ VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ GTHVL+EA 
Sbjct  80   FRMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLGTHVLVEAA  139

Query  505  KVTGQIRRFIHVSTDEVYGET  567
            K  G IRRFIHVSTDEVYG +
Sbjct  140  KKAG-IRRFIHVSTDEVYGSS  159



>ref|XP_004336227.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14214.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
Length=386

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y+PKNILITG AGFI SHV + LV  YPDYKIV  DKLDYCS+LKN+   +S PN++FV+
Sbjct  5    YSPKNILITGGAGFIGSHVVSLLVNKYPDYKIVNYDKLDYCSSLKNIASLQSKPNYRFVE  64

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            G+I SA+LV+++L  E IDTI+HFAAQTHVDNSFGNSF+FT+ N+ GTHVLLEA K+ G 
Sbjct  65   GNILSAELVSFILEEEQIDTIVHFAAQTHVDNSFGNSFQFTETNVLGTHVLLEAAKLAG-  123

Query  520  IRRFIHVSTDEVYGETD  570
            I+RFIHVSTDEV GE +
Sbjct  124  IKRFIHVSTDEVKGENE  140



>ref|XP_005845105.1| hypothetical protein CHLNCDRAFT_7301, partial [Chlorella variabilis]
 gb|EFN53003.1| hypothetical protein CHLNCDRAFT_7301 [Chlorella variabilis]
Length=327

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +1

Query  181  ITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDI-GSA  357
            +TG AGFI SHVA RL++ Y  YK+VVLDKLDYC+++ NL  ++  P FKFV+GDI G  
Sbjct  1    VTGGAGFIGSHVAIRLLKRY-SYKVVVLDKLDYCASMHNLREAQDHPRFKFVRGDITGGL  59

Query  358  DLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIH  537
            DLV Y+L  E +DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC+V G++RRFI+
Sbjct  60   DLVQYVLREEGVDTVLHFAAQTHVDNSFGNSLAFTANNTYGTHVLLEACRVYGRVRRFIN  119

Query  538  VSTDEVYGETDEDAVVGNHEASQLLP  615
            VSTDEVYG+T    + G  E+S L P
Sbjct  120  VSTDEVYGDTSHSLLAGLPESSSLAP  145



>ref|XP_001422283.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 ref|XP_001422349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00600.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = +1

Query  175  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  354
            IL+TG AGFI SHVA RL   +P+Y IV+LDKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVILDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  355  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  528
             DL++Y+L +E IDT+MHFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC      +IRR
Sbjct  63   FDLLSYVLQSERIDTVMHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQKTEIRR  122

Query  529  FIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            F+HVSTDEVYGE   D+      AS L P
Sbjct  123  FLHVSTDEVYGENLMDS--NTEHASLLTP  149



>ref|XP_001422288.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00605.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = +1

Query  175  ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVKGDIGS  354
            IL+TG AGFI SHVA RL   +P+Y IVVLDKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVVLDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  355  ADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  528
             DL++Y+L +E IDT++HFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC    T +IRR
Sbjct  63   FDLLSYVLQSERIDTVVHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQTTEIRR  122

Query  529  FIHVSTDEVYGETDEDAVVGNHEASQLL  612
            F+HVSTDEVYGE   D+   N E + LL
Sbjct  123  FLHVSTDEVYGENLMDS---NTEHAALL  147



>ref|XP_005850348.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
 gb|EFN58246.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
Length=377

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 114/164 (70%), Gaps = 12/164 (7%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKI------------VVLDKLDYCSNLKNLT  303
            Y PKNILITG AGFIAS V  +LV+  P+ K+            +VLDKLDYC+ L NL 
Sbjct  12   YQPKNILITGGAGFIASWVVIKLVKQRPECKVGSRVTLGVVGAVIVLDKLDYCATLNNLA  71

Query  304  PSRSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT  483
              R  PNFKF+KGDI S+DLV ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN YGT
Sbjct  72   AVRDLPNFKFIKGDIQSSDLVVHILEQEQIDTVMHFAAQTHVDNSFGNSMAFTMNNTYGT  131

Query  484  HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLP  615
            HVLLE  ++ G+++RFI+VSTDEVYGE+      G  E S L P
Sbjct  132  HVLLECSRLYGKVQRFINVSTDEVYGESSLGKTEGLKEHSPLEP  175



>ref|XP_005536953.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80917.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  520  IRRFIHVSTDEVYG  561
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_005537192.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81156.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  520  IRRFIHVSTDEVYG  561
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_005535008.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005536685.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005537980.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80401.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80649.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81944.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            + P+NIL+TG AGFIASHV  RLV  YP Y++ VLDKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  520  IRRFIHVSTDEVYG  561
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_004256510.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP89739.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=342

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 105/144 (73%), Gaps = 6/144 (4%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PK ILITG AGFIASHV    V  YP YKIVV+DKLDYC++LKNL   + +PNFKF  
Sbjct  3    YEPKVILITGGAGFIASHVVIHFVTQYPQYKIVVVDKLDYCASLKNLDAVKGAPNFKFFI  62

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
             DI  A  +  +   E +DT+MHFAAQTHVDNSFGNSF+FT NNI+GTHVLLE  K    
Sbjct  63   ADITDAHTMQKIFEMEKVDTVMHFAAQTHVDNSFGNSFQFTHNNIFGTHVLLEVAK-NAN  121

Query  520  IRRFIHVSTDEVYGETDEDAVVGN  591
            +RRFIHVSTDEVYG+     V+GN
Sbjct  122  VRRFIHVSTDEVYGQ-----VIGN  140



>emb|CBK22816.2| unnamed protein product [Blastocystis hominis]
Length=464

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +1

Query  160  YTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSRSSPNFKFVK  339
            Y PKNILITG AGFIASHV   LV  YP YKIV LD LDYC  L NL    + PN+KFV+
Sbjct  7    YVPKNILITGGAGFIASHVVTLLVNKYPQYKIVNLDCLDYCGTLNNLKEVENKPNYKFVE  66

Query  340  GDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  519
            G+I S+  V Y+L +E IDT++HFAAQ+HVDNS+GNS  FT NN+ GTHV+LEAC++ G 
Sbjct  67   GNIMSSCFVRYVLKSEEIDTVIHFAAQSHVDNSYGNSLTFTYNNVVGTHVMLEACRLHG-  125

Query  520  IRRFIHVSTDEVYGETDE  573
            I+RFIHVSTDEVYGE  +
Sbjct  126  IKRFIHVSTDEVYGEQQD  143



>gb|EJK47833.1| hypothetical protein THAOC_33424 [Thalassiosira oceanica]
Length=369

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 106/146 (73%), Gaps = 9/146 (6%)
 Frame = +1

Query  160  YTPKNILITGAAG---------FIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLTPSR  312
            Y P+NIL+TG AG         FI SH A  L + YP Y ++V DKLDYCS L NL    
Sbjct  13   YIPRNILLTGGAGPLIIAETLGFIGSHAAILLAKKYPQYNVIVYDKLDYCSCLANLDEIS  72

Query  313  SSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVL  492
               NFKFVKGDI S DLV+Y++  E++DT+MHFAAQTHVDNSFGNSF FT++NIYGTHVL
Sbjct  73   RLKNFKFVKGDICSPDLVSYVMREEDVDTVMHFAAQTHVDNSFGNSFNFTQSNIYGTHVL  132

Query  493  LEACKVTGQIRRFIHVSTDEVYGETD  570
            LE+ K    IRRFIHVSTDEVYGE +
Sbjct  133  LESAKNHKTIRRFIHVSTDEVYGEGE  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090