BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS104B11

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    223   2e-65   Nicotiana sylvestris
ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    221   5e-65   
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    221   5e-65   
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    222   1e-63   Nicotiana sylvestris
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    221   2e-63   
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      206   2e-63   
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    221   2e-63   
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    221   3e-63   Nicotiana tomentosiformis
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    221   3e-63   Nicotiana tomentosiformis
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                220   8e-63   Erythranthe guttata [common monkey flower]
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    216   9e-63   Nicotiana tomentosiformis
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    217   6e-62   Solanum tuberosum [potatoes]
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    216   1e-61   Solanum lycopersicum
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    212   1e-61   Nicotiana sylvestris
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    214   4e-61   Nicotiana tomentosiformis
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    215   4e-61   Nicotiana tomentosiformis
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    214   4e-61   Nicotiana tomentosiformis
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    213   1e-60   
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    213   2e-60   Sesamum indicum [beniseed]
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    202   4e-60   
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    212   4e-60   Nicotiana tomentosiformis
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             211   6e-60   Prunus persica
emb|CDY67345.1|  BnaCnng54600D                                          205   7e-60   Brassica napus [oilseed rape]
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    211   1e-59   Prunus mume [ume]
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    211   1e-59   Prunus mume [ume]
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    210   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_004307322.2|  PREDICTED: uncharacterized protein LOC101300392    195   3e-59   Fragaria vesca subsp. vesca
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    209   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    209   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    209   5e-59   Fragaria vesca subsp. vesca
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             197   6e-59   
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    203   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    205   9e-59   
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             208   9e-59   Capsella rubella
emb|CDY09021.1|  BnaC01g30700D                                          208   1e-58   Brassica napus [oilseed rape]
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    202   1e-58   Populus euphratica
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             208   1e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    206   1e-58   Brassica rapa
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    208   1e-58   
emb|CBI23694.3|  unnamed protein product                                208   1e-58   Vitis vinifera
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    208   1e-58   
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    208   1e-58   
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...    207   2e-58   Solanum lycopersicum
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg             207   2e-58   
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    207   2e-58   Citrus sinensis [apfelsine]
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    207   2e-58   Solanum lycopersicum
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    207   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    201   3e-58   Populus euphratica
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    207   3e-58   
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    204   3e-58   Glycine max [soybeans]
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    203   3e-58   Vitis vinifera
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    203   4e-58   Cucumis melo [Oriental melon]
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         200   5e-58   Solanum tuberosum [potatoes]
emb|CDX77513.1|  BnaA07g06510D                                          206   5e-58   
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    202   7e-58   
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    206   8e-58   Brassica rapa
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g            204   1e-57   Phaseolus vulgaris [French bean]
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    205   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_011470580.1|  PREDICTED: sterol 24-C-methyltransferase-like      194   1e-57   Fragaria vesca subsp. vesca
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...    205   1e-57   Camelina sativa [gold-of-pleasure]
emb|CDX85109.1|  BnaC07g07970D                                          205   1e-57   
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    205   1e-57   
emb|CDX77504.1|  BnaA07g06420D                                          205   1e-57   
gb|KHN01041.1|  Putative fatty acid methyltransferase                   204   2e-57   Glycine soja [wild soybean]
dbj|BAB01742.1|  unnamed protein product                                204   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       192   3e-57   Cucumis sativus [cucumbers]
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...    203   3e-57   
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    204   3e-57   Glycine max [soybeans]
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  193   3e-57   Citrus sinensis [apfelsine]
emb|CDO99279.1|  unnamed protein product                                204   3e-57   Coffea canephora [robusta coffee]
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         204   4e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           204   4e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44154.1|  unnamed protein product                                204   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57657.1|  AT3g23510/MEE5_5                                        204   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         203   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    203   4e-57   Cucumis melo [Oriental melon]
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             203   5e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    203   5e-57   Brassica rapa
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    198   6e-57   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX92987.1|  BnaA03g37090D                                          203   6e-57   
gb|KHN30725.1|  Putative fatty acid methyltransferase                   203   6e-57   Glycine soja [wild soybean]
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    203   6e-57   Brassica rapa
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    203   7e-57   Vitis vinifera
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             203   7e-57   
emb|CBI23697.3|  unnamed protein product                                203   7e-57   Vitis vinifera
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    203   7e-57   Glycine max [soybeans]
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  196   9e-57   Citrus sinensis [apfelsine]
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...    202   9e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    202   9e-57   Nelumbo nucifera [Indian lotus]
ref|XP_011470583.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahyd...    197   1e-56   Fragaria vesca subsp. vesca
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    202   1e-56   Solanum tuberosum [potatoes]
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       202   1e-56   Cucumis sativus [cucumbers]
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    196   1e-56   Arabis alpina [alpine rockcress]
gb|EPS65744.1|  cyclopropane fatty acid synthase                        199   1e-56   Genlisea aurea
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    202   2e-56   
emb|CDX77514.1|  BnaA07g06520D                                          201   2e-56   
emb|CDX94854.1|  BnaC03g43340D                                          202   2e-56   
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    201   3e-56   
emb|CDY09025.1|  BnaC01g30660D                                          186   3e-56   Brassica napus [oilseed rape]
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         196   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...    199   6e-56   Nicotiana tomentosiformis
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    197   7e-56   Populus euphratica
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    200   8e-56   Nicotiana tomentosiformis
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    200   8e-56   Nicotiana tomentosiformis
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    200   9e-56   Theobroma cacao [chocolate]
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    197   1e-55   
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           199   1e-55   Medicago truncatula
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    199   1e-55   Populus euphratica
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    199   1e-55   Populus euphratica
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    199   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             194   2e-55   
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    199   2e-55   
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             193   3e-55   
emb|CAN68017.1|  hypothetical protein VITISV_025151                     198   3e-55   Vitis vinifera
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    197   3e-55   Citrus sinensis [apfelsine]
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    190   4e-55   
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...    197   5e-55   
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...    197   6e-55   Populus euphratica
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    197   7e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    197   7e-55   Populus euphratica
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    197   8e-55   Populus euphratica
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      197   8e-55   
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             192   8e-55   
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    192   9e-55   Solanum lycopersicum
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             188   9e-55   
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       187   1e-54   Cucumis sativus [cucumbers]
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             191   2e-54   
ref|XP_002528810.1|  methyltransferase, putative                        196   2e-54   Ricinus communis
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    193   2e-54   
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    187   3e-54   
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    194   3e-54   Citrus sinensis [apfelsine]
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         195   4e-54   Jatropha curcas
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    195   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    195   4e-54   Citrus sinensis [apfelsine]
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    195   4e-54   
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    194   5e-54   
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    194   5e-54   Populus euphratica
gb|KJB38367.1|  hypothetical protein B456_006G251800                    195   5e-54   Gossypium raimondii
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    195   6e-54   Tarenaya hassleriana [spider flower]
gb|KJB38366.1|  hypothetical protein B456_006G251800                    194   6e-54   Gossypium raimondii
gb|KHG28468.1|  putative fatty acid methyltransferase                   194   8e-54   Gossypium arboreum [tree cotton]
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   187   8e-54   
gb|AAT74602.1|  cyclopropane fatty acid synthase                        194   8e-54   Gossypium hirsutum [American cotton]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    194   9e-54   Gossypium raimondii
emb|CDY18120.1|  BnaA01g23810D                                          189   9e-54   Brassica napus [oilseed rape]
gb|KHG28467.1|  putative fatty acid methyltransferase                   194   9e-54   Gossypium arboreum [tree cotton]
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    187   1e-53   
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    194   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    193   3e-53   Eucalyptus grandis [rose gum]
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             188   3e-53   
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             192   5e-53   
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    189   1e-52   
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    191   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    187   1e-52   Brassica rapa
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          191   2e-52   
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             190   2e-52   
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         184   3e-52   
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         185   3e-52   
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    182   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    184   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338    189   3e-52   
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    188   4e-52   Phoenix dactylifera
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    188   4e-52   
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    189   5e-52   
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   189   5e-52   Citrus sinensis [apfelsine]
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    188   8e-52   
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    184   8e-52   Tarenaya hassleriana [spider flower]
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    184   8e-52   Eucalyptus grandis [rose gum]
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    188   1e-51   
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    188   1e-51   Phoenix dactylifera
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    188   1e-51   Citrus sinensis [apfelsine]
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       188   2e-51   Cucumis sativus [cucumbers]
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    188   2e-51   
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    184   3e-50   
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    182   7e-50   Elaeis guineensis
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    183   8e-50   Eucalyptus grandis [rose gum]
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    182   1e-49   Elaeis guineensis
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     181   2e-49   Eucalyptus grandis [rose gum]
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   182   5e-49   
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...    180   7e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           180   7e-49   Medicago truncatula
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    176   9e-49   
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    180   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    170   2e-48   Nicotiana sylvestris
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    174   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    174   3e-48   
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    179   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    172   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_002883432.1|  predicted protein                                  167   3e-46   
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    173   3e-46   
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                172   4e-46   Erythranthe guttata [common monkey flower]
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          169   5e-46   
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          171   7e-46   
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    174   8e-46   
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         171   2e-45   Sterculia foetida
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   167   3e-45   
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   168   1e-44   
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    165   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         165   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ABG37642.1|  cyclopropane fatty acid synthase                        171   1e-44   Populus trichocarpa [western balsam poplar]
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase           168   1e-44   Gossypium arboreum [tree cotton]
ref|NP_001066537.1|  Os12g0267200                                       168   2e-44   
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  167   2e-44   Citrus sinensis [apfelsine]
dbj|BAJ91247.1|  predicted protein                                      162   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC78767.1|  hypothetical protein OsI_18995                          169   3e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001059618.1|  Os07g0474600                                       162   4e-44   
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    163   4e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12590.1|  hypothetical protein B456_002G025800                    167   5e-44   Gossypium raimondii
gb|AAT74601.1|  cyclopropane fatty acid synthase                        167   7e-44   Gossypium hirsutum [American cotton]
gb|KJB12595.1|  hypothetical protein B456_002G026100                    167   8e-44   Gossypium raimondii
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    166   1e-43   Populus euphratica
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    166   1e-43   Sesamum indicum [beniseed]
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    165   2e-43   
gb|EPS70161.1|  hypothetical protein M569_04599                         166   2e-43   Genlisea aurea
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    165   2e-43   
dbj|BAK04927.1|  predicted protein                                      154   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   165   3e-43   Zea mays [maize]
gb|AAT74600.1|  cyclopropane fatty acid synthase                        165   3e-43   Gossypium hirsutum [American cotton]
gb|KJB70811.1|  hypothetical protein B456_011G092100                    164   7e-43   Gossypium raimondii
gb|EEE67149.1|  hypothetical protein OsJ_24210                          162   8e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    164   1e-42   Setaria italica
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           162   2e-42   Triticum urartu
dbj|BAJ95828.1|  predicted protein                                      161   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE62857.1|  hypothetical protein OsJ_17660                          162   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82010.1|  hypothetical protein OsI_25960                          162   3e-42   Oryza sativa Indica Group [Indian rice]
dbj|BAJ93367.1|  predicted protein                                      162   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           161   6e-42   
ref|XP_004296401.1|  PREDICTED: uncharacterized protein LOC101310979    158   7e-42   Fragaria vesca subsp. vesca
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             161   9e-42   Selaginella moellendorffii
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    158   1e-41   
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    159   3e-41   
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    159   4e-41   Sesamum indicum [beniseed]
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    159   4e-41   Sesamum indicum [beniseed]
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    159   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    154   2e-39   Oryza brachyantha
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           152   3e-39   Triticum urartu
ref|XP_001769171.1|  predicted protein                                  152   1e-38   
dbj|BAJ86532.1|  predicted protein                                      144   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             144   3e-37   
gb|EMT01203.1|  Cyclopropane-fatty-acyl-phospholipid synthase           140   3e-37   
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           145   1e-36   Triticum urartu
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          146   2e-36   Sorghum bicolor [broomcorn]
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           142   1e-35   Triticum urartu
dbj|BAK05892.1|  predicted protein                                      144   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05129.1|  predicted protein                                      144   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    144   2e-35   
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    141   8e-35   Zea mays [maize]
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    141   8e-35   Zea mays [maize]
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    140   2e-34   Setaria italica
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    140   2e-34   
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    140   2e-34   Setaria italica
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    134   2e-33   
ref|NP_188988.2|  S-adenosyl-L-methionine-dependent methyltransfe...    132   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KJB70810.1|  hypothetical protein B456_011G092100                    135   2e-32   Gossypium raimondii
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    135   2e-32   Zea mays [maize]
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           132   9e-32   Triticum urartu
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           132   1e-31   
gb|KDO40251.1|  hypothetical protein CISIN_1g042963mg                   124   1e-31   Citrus sinensis [apfelsine]
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           130   9e-31   Triticum urartu
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          129   2e-30   
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             120   8e-30   
gb|KJB28509.1|  hypothetical protein B456_005G052800                    122   5e-29   Gossypium raimondii
gb|KFK39644.1|  hypothetical protein AALP_AA3G270300                    122   5e-29   Arabis alpina [alpine rockcress]
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   115   2e-27   Citrus sinensis [apfelsine]
ref|XP_005717868.1|  unnamed protein product                            117   3e-27   Chondrus crispus [carageen]
ref|WP_043771147.1|  hypothetical protein                               116   6e-27   
ref|WP_038097960.1|  cyclopropane-fatty-acyl-phospholipid synthase      114   2e-26   
gb|ADW18290.1|  Cyclopropane-fatty-acyl-phospholipid synthase           116   4e-26   Desulfobulbus propionicus DSM 2032
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      115   5e-26   Desulfomicrobium baculatum
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      114   1e-25   Desulfomicrobium escambiense
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|WP_028573790.1|  cyclopropane-fatty-acyl-phospholipid synthase      113   3e-25   Desulfonatronovibrio hydrogenovorans
ref|WP_043101704.1|  cyclopropane-fatty-acyl-phospholipid synthase      111   3e-25   Oleiagrimonas soli
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      110   5e-25   
ref|XP_003289116.1|  hypothetical protein DICPUDRAFT_48369              110   6e-25   Dictyostelium purpureum
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      110   7e-25   
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      110   9e-25   Cellvibrio sp. BR
ref|WP_009852233.1|  cyclopropane-fatty-acyl-phospholipid synthase      109   1e-24   beta proteobacterium KB13
emb|CDX85102.1|  BnaC07g08040D                                          106   2e-24   
ref|WP_008107386.1|  cyclopropane-fatty-acyl-phospholipid synthase      108   2e-24   
ref|WP_022973428.1|  cyclopropane-fatty-acyl-phospholipid synthase      108   3e-24   
gb|KFA00082.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   4e-24   
ref|WP_039423507.1|  cyclopropane-fatty-acyl-phospholipid synthase      108   4e-24   
ref|WP_029148983.1|  cyclopropane-fatty-acyl-phospholipid synthase      108   4e-24   
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      107   1e-23   
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      107   1e-23   
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      106   1e-23   
ref|WP_005993583.1|  cyclopropane-fatty-acyl-phospholipid synthase      106   2e-23   
ref|WP_017011088.1|  cyclopropane-fatty-acyl-phospholipid synthase      106   2e-23   
ref|WP_028380038.1|  cyclopropane-fatty-acyl-phospholipid synthase      106   2e-23   
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          106   2e-23   
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      106   2e-23   
ref|WP_007236107.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   3e-23   
ref|WP_010547514.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   3e-23   
ref|WP_034225625.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   3e-23   
ref|WP_015487921.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   3e-23   
ref|WP_019837887.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   4e-23   
ref|WP_004799086.1|  hypothetical protein                               105   4e-23   
ref|WP_020209621.1|  hypothetical protein                               105   5e-23   
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   6e-23   
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   6e-23   
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   6e-23   
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  107   6e-23   
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   6e-23   
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               105   7e-23   
ref|WP_032019166.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   7e-23   
ref|WP_025258609.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   7e-23   
ref|WP_039574900.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   9e-23   
ref|WP_017171442.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_002146706.1|  cyclopropane-fatty-acyl-phospholipid synthas...  99.8    1e-22   
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...  97.1    1e-22   
ref|WP_017163033.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_017168650.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_039433432.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_024940524.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|WP_039514269.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|WP_017160022.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|WP_034211777.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
emb|CEL43918.1|  Putative cyclopropane-fatty-acyl-phospholipid sy...    102   1e-22   
ref|WP_039442644.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|XP_005537745.1|  probable mycolic acid methyl transferase           107   1e-22   
ref|WP_010366079.1|  cyclopropane-fatty-acyl-phospholipid synthase      104   1e-22   
ref|WP_017155651.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_016903512.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
gb|KGK59141.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   1e-22   
ref|WP_011408294.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_011258655.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_006451778.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_037337739.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_014503964.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_002814454.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_012012891.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_040987124.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    103   1e-22   
ref|WP_004758028.1|  hypothetical protein                               103   1e-22   
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    103   1e-22   
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   1e-22   
ref|WP_040352724.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
ref|WP_044236782.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
gb|EKO15287.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   1e-22   
gb|EAQ78945.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   1e-22   
ref|WP_003485448.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   1e-22   
gb|AAW75168.1|  cyclopropane-fatty-acyl-phospholipid synthase           106   1e-22   
ref|WP_023903310.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_040151432.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   2e-22   
ref|WP_028630133.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
gb|EDL61239.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   2e-22   
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_024744102.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_043298452.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_004760109.1|  hypothetical protein                               103   2e-22   
ref|WP_027331136.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_041479999.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_016987210.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_026295196.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_004976984.1|  hypothetical protein                               102   2e-22   
ref|WP_037413108.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   2e-22   
ref|WP_011346862.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_024682685.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_024665589.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_003421694.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_004419129.1|  Cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_017277944.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
dbj|BAC83502.1|  putative cyclopropane synthase                         105   3e-22   
ref|WP_016567259.1|  Cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_005911656.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    103   3e-22   
ref|WP_044311961.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_003415046.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_032658908.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
gb|EGH44451.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   3e-22   
ref|WP_003479409.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      105   3e-22   
ref|WP_024691823.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
ref|WP_010380444.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_003408647.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
gb|EGH32293.1|  cyclopropane-fatty-acyl-phospholipid synthase           102   3e-22   
gb|EGH75650.1|  cyclopropane-fatty-acyl-phospholipid synthase           102   3e-22   
ref|WP_005924870.1|  cyclopropane-fatty-acyl-phospholipid synthase      103   3e-22   
ref|WP_024775005.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
ref|WP_011050875.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    103   3e-22   
ref|WP_016850267.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
ref|WP_011734078.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
ref|WP_040280933.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
ref|WP_039580557.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   3e-22   
gb|AAM36246.1|  cyclopropane-fatty-acyl-phospholipid synthase           103   3e-22   
ref|WP_027272263.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_011036521.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_019301959.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_019304527.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
gb|EPN68324.1|  cyclopropane-fatty-acyl-phospholipid synthase         99.0    4e-22   
ref|WP_003365609.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_004406950.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_003433715.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_010428686.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_008025867.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    102   4e-22   
ref|WP_007951699.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_012916972.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_024652616.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_024073307.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_032615929.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_004981573.1|  hypothetical protein                               102   4e-22   
ref|WP_011266739.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_024661275.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   4e-22   
ref|WP_017529903.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
gb|AAM40627.1|  cyclopropane-fatty-acyl-phospholipid synthase           102   5e-22   
ref|WP_003182274.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_011758933.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_004653544.1|  hypothetical protein                               102   5e-22   
ref|WP_024710277.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_044319716.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_005733596.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_011167849.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_019742551.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_005746219.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_002552156.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_016773216.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   5e-22   
ref|WP_019825100.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_044343954.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_004582108.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_030138826.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_024014288.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_005177273.1|  hypothetical protein                               102   6e-22   
ref|WP_027925959.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_042609708.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|XP_003087614.1|  hypothetical protein CRE_25039                   99.8    6e-22   
ref|WP_024931234.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
gb|KJB28512.1|  hypothetical protein B456_005G052900                    104   6e-22   
ref|WP_003171617.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   6e-22   
ref|WP_039412333.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   7e-22   
ref|WP_035269391.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   7e-22   
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   7e-22   
ref|WP_007967668.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   7e-22   
ref|WP_010565618.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   7e-22   
ref|WP_008578239.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    102   7e-22   
dbj|BAP41523.1|  cyclopropane-fatty-acyl-phospholipid synthase          101   8e-22   
ref|WP_031421816.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   8e-22   
ref|WP_029819005.1|  cyclopropane-fatty-acyl-phospholipid synthase      102   8e-22   
ref|WP_017221214.1|  hypothetical protein                               102   8e-22   
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   8e-22   
ref|WP_004663912.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   8e-22   
ref|WP_009583767.1|  Cyclopropane-fatty-acyl-phospholipid synthase      102   8e-22   
ref|WP_009472206.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   8e-22   
ref|WP_034118005.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   8e-22   
ref|WP_010458259.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   9e-22   
ref|WP_003208420.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    101   9e-22   
ref|WP_003467054.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   9e-22   
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           101   9e-22   
ref|WP_039591068.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   9e-22   
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_010654249.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_042827312.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   1e-21   
ref|WP_027606877.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_008086166.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              101   1e-21   
ref|WP_005891172.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
gb|EPE84491.1|  cyclopropane-fatty-acyl-phospholipid synthase         99.8    1e-21   
ref|WP_004677376.1|  hypothetical protein                               100   1e-21   
ref|WP_027612228.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
gb|KGP57999.1|  cyclopropane-fatty-acyl-phospholipid synthase           101   1e-21   
ref|WP_029295644.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_017137630.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_005203760.1|  MULTISPECIES: hypothetical protein                 100   1e-21   
ref|WP_026145216.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_017475993.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_010177020.1|  cyclopropane-fatty-acyl-phospholipid synthase      101   1e-21   
ref|WP_034095792.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   1e-21   
ref|WP_034136804.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   1e-21   
emb|CDY54629.1|  BnaCnng27480D                                        99.0    1e-21   
ref|WP_019440999.1|  hypothetical protein                               100   1e-21   
ref|WP_039766323.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_038360934.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
gb|ERB64848.1|  hypothetical protein N779_13070                       99.0    2e-21   
ref|WP_007967311.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_005313764.1|  hypothetical protein                               100   2e-21   
ref|WP_003439811.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    100   2e-21   
ref|WP_017340747.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_024670120.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_016781761.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_007974402.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_034617840.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_016163750.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_004819745.1|  hypothetical protein                               100   2e-21   
dbj|BAP36056.1|  cyclopropane-fatty-acyl-phospholipid synthase          100   2e-21   
ref|WP_022559744.1|  MULTISPECIES: putative cyclopropane-fatty-ac...    100   2e-21   
gb|KGS14301.1|  cyclopropane-fatty-acyl-phospholipid synthase           100   2e-21   
ref|WP_033132833.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_032886130.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_007912863.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    100   2e-21   
ref|WP_034156027.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_016977067.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_007152104.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_005188361.1|  hypothetical protein                               100   2e-21   
ref|WP_042145087.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_020414996.1|  hypothetical protein                               100   2e-21   
ref|WP_019233938.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      100   2e-21   



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  452  DFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  511

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  512  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  442  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  501

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  502  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  442  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  501

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  502  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  751  DFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  865



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  694  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  753

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  754  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  808



>ref|XP_010109738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
 gb|EXC24409.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
Length=161

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH+E+IGIHY+QTLRCWR NFLE+QS+IL
Sbjct  47   DFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHIENIGIHYHQTLRCWRKNFLEKQSEIL  106

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYK   SA
Sbjct  107  ALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNVAAFRNPYKSFPSA  160



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  688  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  748  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  802



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  751  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  751  DFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH+EDIGIHYYQTLRCWR NFL R S+I 
Sbjct  755  DFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHVEDIGIHYYQTLRCWRENFLNRTSEIK  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGFD+KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPYK +  AY
Sbjct  815  NLGFDEKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYKSVPCAY  869



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  452  DFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  511

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  512  ALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI 
Sbjct  751  DFIKEYIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGL  335
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGV  861



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI 
Sbjct  751  DFIKEYIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNG  860



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QSQI 
Sbjct  429  DFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQSQIR  488

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  489  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  543



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  688  DFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  748  ALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  802



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  751  DFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  811  ALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  865



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI 
Sbjct  694  DFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIH  753

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  754  ALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  808



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS+I 
Sbjct  688  DFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQ  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  748  ALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  802



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS+I 
Sbjct  755  DFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQ  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  815  ALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  869



>ref|XP_004173387.1| PREDICTED: probable fatty acid methyltransferase-like, partial 
[Cucumis sativus]
Length=291

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL
Sbjct  177  DFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKIL  236

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  237  QLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  291



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QSQI 
Sbjct  751  DFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQSQIR  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  865



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL
Sbjct  750  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  810  ALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFADPYKGFPSA  863



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IG+HYYQTLRCWR NFLE Q QI+
Sbjct  339  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGLHYYQTLRCWRKNFLENQKQIM  398

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  399  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL
Sbjct  755  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEIL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  815  ALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  868



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL
Sbjct  750  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  810  ALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  863



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL
Sbjct  750  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  810  ALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_004307322.2| PREDICTED: uncharacterized protein LOC101300392 [Fragaria vesca 
subsp. vesca]
Length=161

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI+EYIFPGGCLPSLSR+T+AMAASSRL VEHLE+IG HYY+TL+ WR  FLE+QS+IL 
Sbjct  48   FIREYIFPGGCLPSLSRLTAAMAASSRLSVEHLENIGSHYYRTLKYWRKKFLEKQSEILA  107

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  108  LGFDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRPGNVALLNDPYKGFPSAY  161



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL
Sbjct  750  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  810  ALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLRCWR NFLERQ QI+
Sbjct  754  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRCWRKNFLERQKQIM  813

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF+++FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN  AFGDPY+   SA+
Sbjct  814  ALGFNEEFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNTAAFGDPYRSFPSAH  868



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAM  SSRLCVEH+E+IGIHYYQTLR WR NFLERQS+IL
Sbjct  751  DFIKEYIFPGGCLPSLSRVTSAMVNSSRLCVEHIENIGIHYYQTLRYWRKNFLERQSEIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  811  ALGFNEKFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNVPAFSNPYKGFPSAY  865



>ref|XP_006420311.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
 gb|ESR33551.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
Length=246

 Score =   197 bits (501),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+ EYIFPGGC+PSLSRVT+AM +SSRLCVEH+E+IGIHYYQTLRCWR NF+E+QS+IL 
Sbjct  131  FLNEYIFPGGCVPSLSRVTAAMTSSSRLCVEHVENIGIHYYQTLRCWRKNFMEKQSEILA  190

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V+AF +PY+GL SAY
Sbjct  191  LGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVSAFSNPYEGLPSAY  244



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+R +QI+
Sbjct  335  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRHNQIM  394

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKG  332
            DLGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV AFG  DP++ 
Sbjct  395  DLGFDDKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVAAFGDDDPFRS  446



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL
Sbjct  441  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEIL  500

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  501  ALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  550



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDEKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL RVTSAMA+SSRLCVE++E+IGIHYYQTLRCWR NFLERQ QI+
Sbjct  689  DFIKEYIFPGGCLPSLGRVTSAMASSSRLCVENVENIGIHYYQTLRCWRKNFLERQKQII  748

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  749  DLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHCFPSA  802



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL
Sbjct  342  DFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKIL  401

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*AHSL  362
             +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY  H L
Sbjct  402  AMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY--HHL  459

Query  363  L  365
            L
Sbjct  460  L  460



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRVWRKNFLERQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+
Sbjct  504  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIM  563

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  564  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  618



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  754  DFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKII  813

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  814  ELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  868



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  767  DFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKII  826

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  827  ELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  881



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  752  DFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKII  811

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  812  ELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  866



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  751  DFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKII  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  811  ELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  865



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +SQI 
Sbjct  688  DFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKSQIR  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  748  SLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  802



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL
Sbjct  688  DFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKIL  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  748  ALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  802



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL
Sbjct  755  DFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKIL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  815  ALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  869



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +SQI 
Sbjct  751  DFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKSQIR  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  811  SLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  865



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL
Sbjct  301  DFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKIL  360

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  361  AMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY  415



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  745  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  804

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  805  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  859



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL
Sbjct  457  DFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEIL  516

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  517  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  565



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  442  DFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKII  501

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  502  ELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  556



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL
Sbjct  443  DFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKIL  502

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  503  QLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  557



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLP+LSRVTSAMAA+SRLCV HLEDIG+HYYQTLRCWR NFL+ +SQI  
Sbjct  325  FINEYIFPGGCLPALSRVTSAMAAASRLCVVHLEDIGVHYYQTLRCWRKNFLKNKSQIHA  384

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK-GLASAY  347
            LGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  385  LGFDDKFIRTWEYYFDYCAAGFKTHTLGDYQIVFSRPGNVATFGDPYNVTMPSAY  439



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+
Sbjct  663  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIM  722

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  723  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  777



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+
Sbjct  457  DFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIM  516

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  517  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  565



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+
Sbjct  756  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIM  815

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  816  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  870



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMA +SRLCVEH+E++GIHYYQTLRCWR NF+ERQ++IL
Sbjct  585  DFIKEYIFPGGCLPSLSRITSAMATTSRLCVEHVENLGIHYYQTLRCWRKNFMERQNEIL  644

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV AFGDPYK
Sbjct  645  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAAFGDPYK  693



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LG D KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_011470580.1| PREDICTED: sterol 24-C-methyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=270

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI+EYI PGGCLPSLSR+T+AMAASSRL VEHLE+IG HYY+TL+ WR NFLE+QS+I  
Sbjct  157  FIREYILPGGCLPSLSRLTAAMAASSRLSVEHLENIGSHYYRTLKYWRKNFLEKQSEIQA  216

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  217  LGFDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRPGNVVLLNDPYKGFPSAY  270



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  686  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  745

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LG D KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  746  ALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  800



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+
Sbjct  751  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  811  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  865



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL
Sbjct  750  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  810  ALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  859



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+
Sbjct  744  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIM  803

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  804  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  858



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL
Sbjct  685  DFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEIL  744

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  745  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  793



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  676  DFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  735

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  736  ALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  790



>gb|KGN61577.1| hypothetical protein Csa_2G172470 [Cucumis sativus]
Length=213

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I+
Sbjct  96   DFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKII  155

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  156  ELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  209



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  570  DFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKII  629

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  630  ELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  684



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL
Sbjct  752  DFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEIL  811

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  812  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  860



>gb|KDO40332.1| hypothetical protein CISIN_1g0240962mg [Citrus sinensis]
Length=272

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL 
Sbjct  157  FIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILA  216

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  217  LGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  270



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSRVTSAMAA+S LCVEHLE+ GIHYY TLR WR NFL +QS+IL
Sbjct  737  DFIREYIFPGGCLPSLSRVTSAMAAASGLCVEHLENFGIHYYHTLRRWRTNFLSKQSEIL  796

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV +FG+  KG+ SAY
Sbjct  797  ELGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQVVFSRPGNVVSFGNLQKGVPSAY  851



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+
Sbjct  725  DFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIM  784

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  785  ALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  839



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRENFLARQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+
Sbjct  750  DFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  750  DFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIM  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  ALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL
Sbjct  751  DFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  811  QLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLR WR NFLERQ  I+
Sbjct  753  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYKTLRLWRKNFLERQKPII  812

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD +FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN+ AF D YKG  SAY
Sbjct  813  ALGFDDQFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNLAAFADSYKGFPSAY  867



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+
Sbjct  753  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIM  812

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF + YKG  SAY
Sbjct  813  ALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFANSYKGFPSAY  867



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I 
Sbjct  343  DFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIH  402

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  403  SLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  452



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI 
Sbjct  761  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQIN  820

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  821  DLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  874



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+
Sbjct  678  DFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIM  737

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  738  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  786



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI 
Sbjct  755  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQIN  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  815  DLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  868



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  751  DFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKII  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  811  ELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  865



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLER+ QI+
Sbjct  740  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRSWRKTFLEREKQIM  799

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  800  DLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHSFPSA  853



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  784  DFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKII  843

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  844  ELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  898



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+
Sbjct  751  DFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  811  ALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  859



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL 
Sbjct  274  FLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILA  333

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V AF +PY+GL SAY
Sbjct  334  LGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVAAFSNPYEGLPSAY  387



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS+IL
Sbjct  662  DFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQSEIL  721

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  722  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  776



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS+IL
Sbjct  751  DFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQSEIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  811  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  865



>ref|XP_011470583.1| PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahydroprotoberberine 
N-methyltransferase-like [Fragaria vesca subsp. vesca]
Length=445

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI EYIFPG C+PSLSRVTSAMA SS+L VEHLE+IGIHYY TL+CW+  FLE Q++IL
Sbjct  331  DFINEYIFPGACIPSLSRVTSAMATSSKLSVEHLENIGIHYYPTLKCWKKIFLENQNEIL  390

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD++FIRTWEYYFDYCAAGF++CTLG+YQIVFSRPGNV   G+P+KG  SAY
Sbjct  391  ALGFDEEFIRTWEYYFDYCAAGFNSCTLGNYQIVFSRPGNVPVLGNPFKGFPSAY  445



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSLSRVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR NF + +SQI  
Sbjct  752  FIKEYIFPGGCLPSLSRVTSAMAATSRLCVVHLEEIGIHYYQTLRCWRKNFQKNKSQIHA  811

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG-LASAY  347
            LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  812  LGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVATFGDPYNDTMPSAY  866



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL
Sbjct  751  DFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  811  QLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TL+ WR NFLE+Q +I+
Sbjct  328  DFIREYIFPGGCLPSLARVTSAMSSSSRLCIESVENIGIHYYHTLKYWRKNFLEKQKEIM  387

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
            DLGF+ KFIRTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AFGDP+
Sbjct  388  DLGFNDKFIRTWEYYFDYCAAGFKTLTLGDYQVVFSRPGNVAAFGDPF  435



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMA +SR CVEHLEDIGIHYY TLRCWR  FL  + +I 
Sbjct  454  DFIKEYIFPGGCLPSLSRVTAAMATASRFCVEHLEDIGIHYYPTLRCWREKFLGSRKEIE  513

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD+KFIRTW YYFDYCAAGF +CTLG+YQIV SRPGNVTAFG+PY  L SA
Sbjct  514  DLGFDEKFIRTWVYYFDYCAAGFKSCTLGNYQIVMSRPGNVTAFGNPYSSLPSA  567



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMAASSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL
Sbjct  744  DFIKEYIFPGGCLPSLTRITSAMAASSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKIL  803

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  804  ALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  858



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+
Sbjct  688  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIM  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  748  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  802



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI 
Sbjct  779  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQIN  838

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP +   SA
Sbjct  839  DLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPSRSFPSA  892



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+
Sbjct  747  DFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIM  806

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  807  DLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  861



>emb|CDY09025.1| BnaC01g30660D [Brassica napus]
Length=137

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAM+ SS+LC+E +E+IGIHYY TLRCWR  FLE Q QI++
Sbjct  20   FITEYIFPGGCLPSLARVTSAMSFSSKLCIEDVENIGIHYYYTLRCWRKRFLENQKQIME  79

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFGDP++   SA
Sbjct  80   LGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGDPFRSFPSA  132



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLRCWR NFLERQ QI+D
Sbjct  343  FITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYHTLRCWRKNFLERQKQIID  402

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKG  332
            LGFD KFIRTWEYYFDYCAAGF T TL  YQIVFSRPGNV AFG  DP++ 
Sbjct  403  LGFDDKFIRTWEYYFDYCAAGFKTLTLRSYQIVFSRPGNVAAFGDDDPFRS  453



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  
Sbjct  634  FIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRV  693

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  694  LGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  746



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL
Sbjct  452  DFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKIL  511

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  512  ALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  566



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  
Sbjct  751  FIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRV  810

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  811  LGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  
Sbjct  751  FIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRV  810

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  811  LGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE+QS+IL
Sbjct  751  DFIKEYIFPGGCLPSLTRITSAMSAASRLCVEHVENIGLHYYQTLRHWRKNFLEKQSKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   +A
Sbjct  811  ALGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYKRFPTA  864



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL 
Sbjct  488  FLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILA  547

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  548  LGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  601



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TS+MA++SRLCVEH+E+ GIHYYQTLR WR NFLERQS+IL
Sbjct  749  DFIKEYIFPGGCLPSLSRITSSMASTSRLCVEHVENFGIHYYQTLRLWRKNFLERQSEIL  808

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNVTAF DPYK
Sbjct  809  ALGFNEKFIRTWEYYFDYCGAGFKSRTLGNYQVVFSRPGNVTAFTDPYK  857



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL
Sbjct  754  DFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREIL  813

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  814  SLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  868



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL
Sbjct  755  DFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREIL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  815  SLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  869



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGC+ SL+R+TSAMA+SSRLC+E +E+IGIHYY+TLRCWR N LERQ +I+
Sbjct  751  DFIKEYIFPGGCILSLARITSAMASSSRLCIEQVENIGIHYYRTLRCWRQNLLERQKRIV  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD+KFIRTWEYYFDY AAGF T TLGDYQ+VFSRPGN   FGDPY+G  SA
Sbjct  811  DLGFDEKFIRTWEYYFDYSAAGFKTLTLGDYQMVFSRPGNAALFGDPYRGFPSA  864



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL
Sbjct  342  DFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKIL  401

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDY +AGF + TL DYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  402  AMGFDEKFIRTWEYYFDYSSAGFKSYTLRDYQVVFSRPGNVEALGNPYKGFPSAY  456



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q + L
Sbjct  755  DFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQRETL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  815  SLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYRGFPSAY  869



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+ GIHYY TLRCWR NFLERQ QI+D
Sbjct  306  FITEYIFPGGCLPSLARVTSAMASSSRLCIENVENFGIHYYHTLRCWRKNFLERQKQIMD  365

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  320
            LGFD KFIRTWEYYFDYCAAGF T TL +YQIVFSRPGN+ AFGD
Sbjct  366  LGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQIVFSRPGNLAAFGD  410



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVT+AMAA+SRLC+EHLE+IGIHYYQTLR WR NFLE QS+I+
Sbjct  738  DFIKEYIFPGGCLPSLSRVTTAMAAASRLCMEHLENIGIHYYQTLRHWRKNFLENQSKII  797

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
            +LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PYK
Sbjct  798  ELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYK  846



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL 
Sbjct  559  FLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILA  618

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  619  LGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_009414043.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+T+AMA SSR C+EHLE+IGIHYYQTLRCWR NF   + +IL
Sbjct  218  DFIKEYIFPGGCLPSLSRITTAMATSSRFCIEHLENIGIHYYQTLRCWRNNFFANKEKIL  277

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KF RTWEYYF Y AAGF +CTLGDYQIVFSRPGN+ AFG+P+  + + 
Sbjct  278  ALGFDEKFFRTWEYYFMYRAAGFKSCTLGDYQIVFSRPGNLRAFGEPFNSIPAT  331



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I 
Sbjct  611  DFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIH  670

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  671  SLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  720



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL
Sbjct  618  DFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKIL  677

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  678  ALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  732



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I 
Sbjct  752  DFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIH  811

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
             LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  812  SLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  861



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL
Sbjct  751  DFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  811  ALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  865



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL
Sbjct  752  DFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKIL  811

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  812  ALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  866



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+ + MAA+SRLCVEH+E+IG++YY TLRCWR NFLE QS+IL
Sbjct  744  DFIKEYIFPGGCLPSLNRIVTGMAAASRLCVEHVENIGMNYYLTLRCWRKNFLENQSKIL  803

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGN  A G PY+G  SAY
Sbjct  804  ALGFDEKFMRTWEYYFDYCAAGFRTYTLGDYQVVFSRPGNYKALGYPYQGFPSAY  858



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F++EYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR  FLE +S+IL 
Sbjct  349  FMREYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKTFLENKSKILA  408

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            +GFD+KFIRTWEYYFDYCAAGF + TLGDYQIVFSRPGNV   G+PYKG  SAY
Sbjct  409  MGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQIVFSRPGNVGVLGNPYKGFPSAY  462



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGG LP+LSRVTSAMA++SRLCV HLEDIG+HYYQTLRCWR NFL  +SQI  
Sbjct  325  FIKEYIFPGGYLPALSRVTSAMASASRLCVVHLEDIGVHYYQTLRCWRKNFLNNKSQIRA  384

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYK  329
            LGFD+KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGD PY 
Sbjct  385  LGFDEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVATFGDHPYN  433



>ref|XP_006420313.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
 gb|ESR33553.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
Length=296

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQT RCWR N +E+QS+IL 
Sbjct  184  FITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTRRCWRTNLMEKQSEILA  243

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFS P NV AF +P++   SA
Sbjct  244  LGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSHPSNVAAFSNPHESFPSA  296



>gb|KGN61575.1| hypothetical protein Csa_2G171960 [Cucumis sativus]
Length=273

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++
Sbjct  157  FMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIE  216

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  217  LGFDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  269



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL
Sbjct  346  DFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKIL  405

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  406  AMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  460



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+T+AMAAS+RLCVEH+E+IGIHYYQTLR WR NF+E +S+I+
Sbjct  751  DFIKEYIFPGGCLPSLTRITTAMAASTRLCVEHVENIGIHYYQTLRYWRKNFVENKSKIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PYK   +A
Sbjct  811  ALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYKEFPAA  864



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I+
Sbjct  460  DFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKII  519

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  520  ELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  573



>ref|XP_004173332.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acid methyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL
Sbjct  211  EFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKIL  270

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  271  QLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  325



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL 
Sbjct  559  FIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILA  618

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  619  LGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  672



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+ SAM+A+SRLC+EH+E+IGIHYYQTLR WR NFL+ Q +IL
Sbjct  755  DFIKEYIFPGGCLPSLTRIASAMSAASRLCMEHVENIGIHYYQTLRYWRKNFLDNQGKIL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGN+ A G+P++G  SAY
Sbjct  815  ALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVLSRPGNIAALGNPFQGFPSAY  869



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLRCWR NF ERQ +I  
Sbjct  751  FITEYIFPGGCLPSLTRVTSAMASSSRLCIEHVENIGIHYYKTLRCWRQNFKERQEEIKA  810

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +GFD+KFIR WEYYFDYCAAGF T T+GDYQ+VFSRPGN   FGDPY    SA
Sbjct  811  IGFDEKFIRKWEYYFDYCAAGFKTLTVGDYQVVFSRPGNTATFGDPYMNFPSA  863



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL 
Sbjct  756  FIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILA  815

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  816  LGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  869



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLC--VEHLEDIGIHYYQTLRCWRANFLERQSQ  176
            DFIKEYIFPGGCLPSLSR+TSAMA++S+LC  VEH+E++GIHYYQTLR WR NFLERQS+
Sbjct  751  DFIKEYIFPGGCLPSLSRITSAMASTSKLCCSVEHVENMGIHYYQTLRWWRKNFLERQSE  810

Query  177  ILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
            ILDLGF++KFIRTWEYYFDYC  GF + TLG+YQ+VFSRPGNVT F DPYK
Sbjct  811  ILDLGFNEKFIRTWEYYFDYCGGGFKSRTLGNYQVVFSRPGNVTTFSDPYK  861



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL 
Sbjct  664  FIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILA  723

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  724  LGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  777



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL
Sbjct  308  DFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKIL  367

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDYCAAGF + TL +YQIVFSRPGNV   G+PYKG  SAY
Sbjct  368  AMGFDEKFIRTWEYYFDYCAAGFKSYTLWNYQIVFSRPGNVGVLGNPYKGFPSAY  422



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+
Sbjct  751  DFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  811  SLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  859



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKE+IFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGI+YY+TLRCWR NFLERQ Q+ 
Sbjct  753  DFIKEHIFPGGCLPSLARVTSAMASSSRLCIEHVENIGINYYKTLRCWRHNFLERQEQVK  812

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIR WEYY DY AAGF T TLGDYQ+VFSRPGN   FGDPY    SA
Sbjct  813  ALGFDEKFIRKWEYYLDYFAAGFKTLTLGDYQVVFSRPGNTAVFGDPYMSFPSA  866



>gb|KJB38366.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=802

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+
Sbjct  688  DFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIM  747

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  748  SLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  796



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+
Sbjct  714  DFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIM  773

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  774  SLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  822



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL 
Sbjct  260  FVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILA  319

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G  SAY
Sbjct  320  LGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPSAY  373



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS+I 
Sbjct  751  DFIKEYIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQSKIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  811  ALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS+I 
Sbjct  751  DFIKEYIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQSKIH  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  811  ALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++
Sbjct  343  FITEYIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIME  402

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFGDP+    SA
Sbjct  403  LGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGDPFHSFPSA  455



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+
Sbjct  719  DFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIM  778

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  779  SLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  827



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            D IKEYIFPG C+PSL+R+T AMAAS+RLCVEH+E+IG+HYYQTLR WR NFLE +S+I 
Sbjct  259  DVIKEYIFPGTCVPSLTRITIAMAASTRLCVEHVENIGMHYYQTLRLWRKNFLESKSKIT  318

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PY    +A
Sbjct  319  ALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYNEFPAA  372



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NFLE++ +IL 
Sbjct  752  FMKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFLEKKRKILA  811

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGF+++FIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF DPY G  S+
Sbjct  812  LGFNEEFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNDAAFADPYVGFLSS  864



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NF+E++ +IL
Sbjct  751  DFIKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFMEKKRKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF+++FIRTWEYYFDYCAAGF   TLG+YQIVFSRPGN  AF DPY    S+
Sbjct  811  ALGFNEEFIRTWEYYFDYCAAGFKLHTLGNYQIVFSRPGNDDAFADPYVSFPSS  864



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG C+PSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL
Sbjct  342  DFIKEYIFPGACVPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKIL  401

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  402  AMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHYYQTLRCWR NFLE+QS+IL 
Sbjct  698  FIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQSKILA  757

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  758  LGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  810



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+D
Sbjct  320  FITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIID  379

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKGLA  338
            LGFD+KF+RTWEYYFDYCAAGF T TL +YQIVFSRPGNV AFG  DP+   A
Sbjct  380  LGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQIVFSRPGNVAAFGNDDPFHSSA  432



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  444  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  503

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  504  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  557



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIF GGCLPSL+R+TSAMA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+ QI+
Sbjct  758  DFIKEYIFHGGCLPSLARLTSAMASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRQIM  817

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            DLGFD+KFIRTWEYYFDYC+AGF T TLG+YQ+VFSR G+ +AFGDPY+   SAY
Sbjct  818  DLGFDEKFIRTWEYYFDYCSAGFRTFTLGNYQMVFSRLGSTSAFGDPYRSFPSAY  872



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++
Sbjct  343  FITEYIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIME  402

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFG P+    SA
Sbjct  403  LGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGHPFHSFPSA  455



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS SR+TSAMAA S+LCVEH+E+IGIHYYQTL  WR NF+  +S+I+
Sbjct  751  DFIKEYIFPGGCLPSFSRLTSAMAAVSKLCVEHVENIGIHYYQTLIKWRDNFMANKSKIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
            +LGFD+KFIRTWEYYF YCAAGF +CTL DYQ+VFSRPGNV AFG+PYK
Sbjct  811  ELGFDEKFIRTWEYYFIYCAAGFKSCTLEDYQVVFSRPGNVNAFGNPYK  859



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGGCLPSL+RVTSAMA+SSRLCVE++E+IG HYY+TLR WR NFLE + QI+
Sbjct  754  DFVREYIFPGGCLPSLARVTSAMASSSRLCVENVENIGNHYYKTLRSWRKNFLENEKQIM  813

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            DLGFD KFIRTWEYYFDY AA   T T+ DYQ+VFSRPGNV A GDP++   SA
Sbjct  814  DLGFDDKFIRTWEYYFDYSAAALKTLTIADYQVVFSRPGNVAALGDPFRSFPSA  867



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL 
Sbjct  297  FVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILA  356

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  357  LGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  410



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL 
Sbjct  318  FVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILA  377

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  378  LGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  431



>ref|XP_009388106.1| PREDICTED: uncharacterized protein LOC103974927, partial [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL R+T+AM ASSR C+EHLE+IGIHY QTLRCWR N    + +IL
Sbjct  226  DFIKEYIFPGGCLPSLGRITTAMVASSRFCIEHLENIGIHYNQTLRCWRNNIFANKEKIL  285

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KF RTWEYYF YCAAGF +CTL +YQIVFSRPGN+ AFG P+  + + 
Sbjct  286  ALGFDEKFFRTWEYYFMYCAAGFKSCTLANYQIVFSRPGNLRAFGGPFNSIPAT  339



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ ++  
Sbjct  272  FITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQEEVKA  331

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  332  IGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  384



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++
Sbjct  684  FMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIE  743

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  744  LGFDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  796



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  569  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  628

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  629  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  682



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  570  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  629

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  630  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  683



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL 
Sbjct  753  FITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILA  812

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
            LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP NV AF +P++
Sbjct  813  LGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSNVAAFSNPHE  860



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL 
Sbjct  738  FITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILA  797

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP  V AF +P++   SA
Sbjct  798  LGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA  850



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  697  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  756

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  757  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  810



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ ++  
Sbjct  323  FITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQEEVKA  382

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  383  IGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  435



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL
Sbjct  344  DFIKEYIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKIL  403

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  404  ALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  451



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  751  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  811  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  864



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL
Sbjct  750  DFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  810  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  863



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHY+QTLRCWR NFLE+QS+I  
Sbjct  752  FIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYFQTLRCWRKNFLEKQSKIRA  811

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  812  LGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  864



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL
Sbjct  751  EFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  811  QLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  865



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPGGCLPSL R+TSAM  +SRLC+EH+E+IG +YY TL+CWR NFL+ + +IL
Sbjct  751  DFLKEYIFPGGCLPSLYRITSAMRTASRLCMEHVENIGSNYYLTLKCWRKNFLKNKEKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             +GFD+KFIRTWEYYFDYCAAGF + TL DYQIVFSRPGN+ A G+PYKG  SAY
Sbjct  811  AMGFDEKFIRTWEYYFDYCAAGFKSYTLLDYQIVFSRPGNIAALGNPYKGFPSAY  865



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +F+KEYIFPG C PSL+R+T+AMA+S+RLC+EH+E+IGIHYYQTLR WR NFLE +S+IL
Sbjct  695  EFLKEYIFPGLCAPSLTRITTAMASSTRLCMEHVENIGIHYYQTLRYWRKNFLENKSKIL  754

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF++KFIRTWEYYFDYCA+GF T TLGDYQ+V SRP NV A G+PY   A+A
Sbjct  755  ALGFNEKFIRTWEYYFDYCASGFKTRTLGDYQVVLSRPRNVAALGNPYDEFAAA  808



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL
Sbjct  569  DFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKIL  628

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  629  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  676



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL
Sbjct  751  DFIKEYIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKIL  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
             LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  811  ALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  858



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL
Sbjct  750  DFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKIL  809

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
             LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  810  ALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  857



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRVTSAMA++SRL VEH+++IGIHY+QTLRCWR NF+E+Q +IL
Sbjct  693  DFIKEYIFPGGCLPSLSRVTSAMASASRLSVEHVDNIGIHYHQTLRCWRKNFMEKQRKIL  752

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
              GF++KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  753  APGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  800



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F KEYIFPGGCL SL+R+ SAM A SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL 
Sbjct  802  FAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILA  861

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRP N  A GDPY+G  SAY
Sbjct  862  LGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPSNFAALGDPYQGFPSAY  915



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I 
Sbjct  676  DFMREYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIR  735

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  736  SLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  790



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +FIKEYIFPG C+PSLSRVT AMAA+SRLCVEH E+IGIHYY TLR WR NF+E  S+IL
Sbjct  713  EFIKEYIFPGCCIPSLSRVTLAMAAASRLCVEHAENIGIHYYPTLRWWRKNFMENHSKIL  772

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  341
             LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  773  ALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  825



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI 
Sbjct  337  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQIT  396

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  284
            DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ+ 
Sbjct  397  DLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQVT  430



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I 
Sbjct  755  DFMREYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIR  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGFD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  815  SLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  869



>ref|XP_009758040.1| PREDICTED: uncharacterized protein LOC104210742, partial [Nicotiana 
sylvestris]
Length=251

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGGCLP+LSRVTSAMAA+S+LCV HLE+IGIHYYQTLRCWR NFLE QSQI  
Sbjct  158  FIKEYIFPGGCLPALSRVTSAMAAASKLCVVHLEEIGIHYYQTLRCWRKNFLENQSQIRA  217

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  281
            LGFD KFIRTWEYYFDYCAAGF T T+GDYQ+
Sbjct  218  LGFDDKFIRTWEYYFDYCAAGFKTRTIGDYQV  249



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI 
Sbjct  337  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQIT  396

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  278
            DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  397  DLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI 
Sbjct  337  DFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQIT  396

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  278
            DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  397  DLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+ EYIFPGGCLPSLSR+TSAM ++SRLCVEH+E+IGIHY QTLRCWR NFLE  S+I  
Sbjct  761  FVYEYIFPGGCLPSLSRITSAMVSASRLCVEHVENIGIHYGQTLRCWRKNFLENHSKIRS  820

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            LGFD+KF+R WEYYFDY A+ F T  LGDYQIVFSR GN+ AF DPY+ ++S+
Sbjct  821  LGFDEKFMRAWEYYFDYTASAFKTRALGDYQIVFSRLGNLVAFSDPYETISSS  873



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPG C PSL+RVTSAMA+SS   +EH+E+IGIHY++TLRCWR NFL+RQ ++  
Sbjct  323  FITEYIFPGACHPSLARVTSAMASSS--SIEHVENIGIHYHKTLRCWRQNFLKRQEEVKA  380

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
            +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  381  IGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  433



>ref|XP_002883432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59691.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAM++SSRLC+E++E+IGIHYYQTLR WR NFLERQ QI+
Sbjct  235  DFIKEYIFPGGCLPSLARVTSAMSSSSRLCIENVENIGIHYYQTLRLWRKNFLERQKQII  294

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  281
            DLGFD KFIR WEYYFDYCAAGF T TLG +++
Sbjct  295  DLGFDDKFIRIWEYYFDYCAAGFKTLTLGPWRL  327



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 96/118 (81%), Gaps = 10/118 (8%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRL----------CVEHLEDIGIHYYQTLRCWRA  152
            DFIKEYIFPGGCLPSLSRVTSAMA++SRL           VEH+++IGIHY+QTLRCWR 
Sbjct  717  DFIKEYIFPGGCLPSLSRVTSAMASASRLRYNCITSSAQSVEHVDNIGIHYHQTLRCWRK  776

Query  153  NFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
            NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  777  NFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  834



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGG LPSLSR+TS MA++SRLCV H EDIG HYYQTLRCWR NFL  Q +I+ 
Sbjct  699  FIKEYIFPGGFLPSLSRITSTMASASRLCVVHAEDIGSHYYQTLRCWRENFLRNQRKIMA  758

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG-DP  323
            LGFD+KFIRTWEYYF Y AAGF    +G+YQIVF+RPG+V AFG DP
Sbjct  759  LGFDEKFIRTWEYYFSYTAAGFKMSIMGNYQIVFTRPGDVAAFGNDP  805



>ref|XP_002460494.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
 gb|EER97015.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
Length=490

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGC+PSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL
Sbjct  371  DFIKEYIFPGGCIPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMVNKDAIL  430

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  344
             LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  ++  GDPY    +A
Sbjct  431  ALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLSNNGDPYASFPAA  486



>ref|XP_002467653.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
 gb|EER94651.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
Length=685

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+EH+E+IG HYY TL CWR NF+  + ++L
Sbjct  583  DFIKEYIFPGGCLPSLARITSAMSNASRLCIEHVENIGYHYYTTLMCWRDNFMTHRDKVL  642

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
             +GFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGNV
Sbjct  643  AIGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNV  683



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 4/119 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL
Sbjct  672  EFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKIL  731

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN----VTAFGDPYKGLASAY  347
             LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGN    V   G    GL SA+
Sbjct  732  QLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAMKVAVVGGGISGLVSAF  790


 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 79/115 (69%), Gaps = 27/115 (23%)
 Frame = +3

Query  3     DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
             DFIKEYIFPGGCLP LSR+T+AMA +SRLC                           +IL
Sbjct  1524  DFIKEYIFPGGCLPCLSRLTTAMANASRLC---------------------------KIL  1556

Query  183   DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
              LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  1557  QLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  1611



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA+SR  VEH+E+IGI YY TLR WR NFL  +S++L 
Sbjct  746  FLKEYIFPGGTLLSLDRTLSAMAAASRFSVEHVENIGISYYHTLRWWRKNFLANESKVLA  805

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN  A GDPY G  SAY
Sbjct  806  LGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFAALGDPYIGFPSAY  859



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F KEYIFPG CL SL+R+ SAMA +SRL VEH+E+IG +Y QTL+ WR NFL+ +S+IL 
Sbjct  346  FAKEYIFPGACLLSLTRILSAMATASRLSVEHVENIGSNYVQTLKGWRKNFLKNKSKILA  405

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF RTWEY+FDY AAGF + TL  YQ+VFSRPGN  A GDPY+G  SAY
Sbjct  406  LGFDEKFTRTWEYFFDYAAAGFKSRTLETYQVVFSRPGNFAALGDPYQGFPSAY  459



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 95/123 (77%), Gaps = 10/123 (8%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRL----------CVEHLEDIGIHYYQTLRCWRA  152
            +FIKEYIFPG C+PSLSRVT AMAA+SRL           VEH E+IGIHYY TLR WR 
Sbjct  671  EFIKEYIFPGCCIPSLSRVTLAMAAASRLWYMLYFNTANNVEHAENIGIHYYPTLRWWRK  730

Query  153  NFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  332
            NF+E  S+IL LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K 
Sbjct  731  NFMENHSKILALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKK  790

Query  333  LAS  341
            +AS
Sbjct  791  MAS  793



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+D
Sbjct  330  FITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIID  389

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  308
            LGFD+KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  390  LGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  430



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+D
Sbjct  341  FITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIID  400

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  308
            LGFD+KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  401  LGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  441



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL
Sbjct  668  DFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREIL  727

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVF-SRPGNVTAFGDPYKGLA  338
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ++   RPG  T   DP   +A
Sbjct  728  SLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQLLNPDRPGGSTR--DPVDPVA  778


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 60/93 (65%), Gaps = 27/93 (29%)
 Frame = +3

Query  3     DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
             DFIKEYIFPGGCLPSLSR+TSAM  +SRLC                           +IL
Sbjct  1273  DFIKEYIFPGGCLPSLSRITSAMGVASRLC---------------------------KIL  1305

Query  183   DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  281
              +GFD+KFIRTWEYYFDY +AGF + TLGDYQ+
Sbjct  1306  AMGFDEKFIRTWEYYFDYSSAGFKSYTLGDYQL  1338


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 58/92 (63%), Gaps = 27/92 (29%)
 Frame = +3

Query  3     DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
             DFIKEYIFPGGCLPSLSR+TSAM  +SRLC                           +IL
Sbjct  1560  DFIKEYIFPGGCLPSLSRITSAMGVASRLC---------------------------KIL  1592

Query  183   DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  278
              +GFD+KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1593  AMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L 
Sbjct  681  FLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLA  740

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFDKKF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  741  LGFDKKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  794



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL
Sbjct  731  DFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKIL  790

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
             LGFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  791  ALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  831



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+ +SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL
Sbjct  693  DFIKEYIFPGGCLPSLSRITSAMSVASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKIL  752

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  278
             LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ
Sbjct  753  ALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQ  784



>dbj|BAJ91247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL
Sbjct  210  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAIL  269

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  270  ALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  325



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  3     DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
             DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL
Sbjct  1323  DFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKIL  1382

Query  183   DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
              LGFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  1383  ALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  1423


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  128
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  575  DFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I 
Sbjct  274  DFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIK  333

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  334  SLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  390



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIFPGG L SLSRVTSAM  +S+L VEH+E+IG HYYQTLRCWR NFLE QS+IL 
Sbjct  323  FIPEYIFPGGHLFSLSRVTSAMGTASKLSVEHVENIGEHYYQTLRCWRKNFLENQSKILS  382

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGF++KFI+TWEYYFDYCAAGF    L +YQIVFSR G  TAF DP   + SA+
Sbjct  383  LGFNEKFIQTWEYYFDYCAAGFKMRFLKNYQIVFSRRG--TAFNDPSATIPSAH  434



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L 
Sbjct  755  FLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLA  814

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  815  LGFDEKFMRTWEYYFDYCAAGFKTGTLTDYQVVFSRAGNFGTLGDPYKGFRSAY  868



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L 
Sbjct  747  FLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLA  806

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  807  LGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L 
Sbjct  747  FLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLA  806

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  807  LGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL
Sbjct  755  DFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREIL  814

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  281
             LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  815  SLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQV  847



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGC PSLS V S MAA+SRL   HLE+IG HY+ TLR WR N L+  S+IL 
Sbjct  752  FVKEYIFPGGCTPSLSHVISCMAAASRLSAVHLEEIGCHYFHTLRRWRENLLKNHSKILA  811

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYKGLASAY  347
            +GF++KFIRTWEYYFDYCAAGF  C LGDYQIVFSRPG+V AF + PY  +   Y
Sbjct  812  MGFNEKFIRTWEYYFDYCAAGFKYCILGDYQIVFSRPGDVAAFSNKPYNAVPGDY  866



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+ASSRLC+EHLE+IG HYY TL  WR NF+  + +I 
Sbjct  648  DFIKEYIFPGGCLPSLSRITSAMSASSRLCIEHLENIGYHYYPTLIRWRDNFMVNREEIS  707

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  +  F D PY    +A
Sbjct  708  ALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLMPFADNPYTTFPAA  764



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FI EYIF G C+PSLS VTSAM A+SR  VEHLEDIG+HYY  LRCWR NFL  ++QI  
Sbjct  744  FISEYIFQGSCIPSLSYVTSAMGAASRFWVEHLEDIGVHYYPALRCWRDNFLRNRNQIEA  803

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  326
            LGFD KF+R +EYYFDYCA+ F TC +G+YQ+V SRPGNV  FGDPY
Sbjct  804  LGFDDKFVRMFEYYFDYCASAFKTCAIGNYQLVLSRPGNVAIFGDPY  850



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL
Sbjct  691  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAIL  750

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  751  ALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  790



>dbj|BAK04927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+E+IG HYY TL  WR NF+  + Q+L
Sbjct  50   DFIKEYIFPGGCLPSLGRVMSAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVL  109

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WE+Y  Y AAGF + T+GDYQ+VFSRPGN
Sbjct  110  ALGFDEKFIRIWEFYLIYSAAGFKSRTVGDYQVVFSRPGN  149



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL
Sbjct  761  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAIL  820

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  821  ALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  860



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FL+  S++L 
Sbjct  755  FLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLKNTSKVLA  814

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  815  LGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  868



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPGG L S +   SAMAA+S  CVEH+E+IG  YY TLR WR NFLE  S++L 
Sbjct  747  FIKEYIFPGGMLLSFNTHLSAMAAASGFCVEHVENIGSSYYHTLRWWRKNFLENTSKVLA  806

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
            LGFD KF+RTWEYYFDYCAAGF T TL DYQ+VFSR  N    GDPYKG  SAY
Sbjct  807  LGFDDKFMRTWEYYFDYCAAGFKTGTLLDYQVVFSRADNFATLGDPYKGFPSAY  860



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I 
Sbjct  603  DFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIK  662

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  663  SLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  719



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  I 
Sbjct  761  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIRWRDNFMANKDAIS  820

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGDPYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN      DPY    +A
Sbjct  821  ALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLGDNDPYASFPAA  875



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL
Sbjct  711  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYSTLIRWRDNFMANKDAIL  770

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +PY  L +A
Sbjct  771  ALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLACADNPYASLPAA  826



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL
Sbjct  634  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAIL  693

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  694  ALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  749



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 7/108 (6%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL
Sbjct  683  DFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKIL  742

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ-------IVFSRPGNV  305
             LGFD+KFIRTWEYYF YCAAGF + TLGDYQ       IVFSRPGN 
Sbjct  743  ALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQASTVLLYIVFSRPGNT  790



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I 
Sbjct  774  DFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIK  833

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  834  SLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  890



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL
Sbjct  757  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAIL  816

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  817  ALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  872



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+E +E+IG HYY TL  WR NF+  +  IL
Sbjct  714  DFIKEYIFPGGCLPSLARITSAMSTASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAIL  773

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN   A+ D PY  L +A
Sbjct  774  ALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLAYADNPYASLPAA  829



>ref|XP_004296401.1| PREDICTED: uncharacterized protein LOC101310979 [Fragaria vesca 
subsp. vesca]
Length=455

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE-RQSQIL  182
            FIKEYIFPGGCLPSL RV SAMAASSRLCVEHLE+IGI    T+  ++  FL    S+IL
Sbjct  341  FIKEYIFPGGCLPSLGRVISAMAASSRLCVEHLENIGIFMTATV-LYKMQFLFCIYSEIL  399

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  347
             LGF++ FIRTWEYYFDYCAAGF +  +GDYQIVFSRPGN   + +PYKG  SAY
Sbjct  400  ALGFNENFIRTWEYYFDYCAAGFKSHIVGDYQIVFSRPGNALTYNNPYKGFPSAY  454



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +FIKEYIFPGG LP L+ +T+AM  +S LCVEHLE+IG+HYYQTL CWR NF  + S+I 
Sbjct  751  EFIKEYIFPGGSLPCLAALTAAMFRASSLCVEHLENIGLHYYQTLMCWRRNFNSKTSEIA  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF + F+R W+YYF YCAAGF TCTLG+ QIVFSR GN  A G+PY+   +A
Sbjct  811  KLGFSESFMRKWDYYFIYCAAGFLTCTLGNLQIVFSRSGNAAALGNPYRSFPTA  864



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF++EYIFPGG L + S+VTS MAA+SRLCVEHLE+IGIHYYQTL+CWR NF + QSQI 
Sbjct  421  DFMREYIFPGGGLNAPSQVTSVMAAASRLCVEHLENIGIHYYQTLKCWRRNFFKNQSQIR  480

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  278
             LGFD KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  481  ALGFDDKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   +  I 
Sbjct  706  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAIS  765

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  766  ALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  821



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+
Sbjct  699  FIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILE  758

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYK  329
            LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY 
Sbjct  759  LGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPYN  807



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+
Sbjct  753  FIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILE  812

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYK  329
            LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY 
Sbjct  813  LGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPYN  861



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   +  I 
Sbjct  761  DFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAIS  820

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  344
             LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  821  ALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  876



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGC+P L+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL
Sbjct  712  DFIKEYIFPGGCIPCLTRITSAMSAASRLCIEHVENIGHHYYPTLVRWRDNFMANKDKIL  771

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  329
             LGFD++F RTWEYYF Y AAGF + TLG YQIVFSRPGN    G  +K
Sbjct  772  ALGFDERFTRTWEYYFMYSAAGFKSRTLGVYQIVFSRPGNAK-LGSGFK  819



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+E+IG HYY TL  WR NF+  + Q+L
Sbjct  519  DFIKEYIFPGGCLPSLGRVVSAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVL  578

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KF+R WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  579  ALGFDEKFMRIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  618



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPS + +T+AM++ S  CVEH+E+IGIHY +TL  W+  F   +++I+
Sbjct  751  DFIKEYIFPGGCLPSFAALTTAMSSGSSFCVEHMENIGIHYCETLLRWQEQFTRNRNKIM  810

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF +KFIRTW+YYF YCAAGF +CTLG  QIVFSRPGN    G PY    +A
Sbjct  811  KLGFGEKFIRTWDYYFFYCAAGFKSCTLGVLQIVFSRPGNEAFLGCPYVSFPTA  864



>dbj|BAJ86532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RV SAM  SSR  +EH+E+IG HYY TL  WR NF+  + +IL
Sbjct  154  DFIKEYIFPGGCLPSLARVMSAMTTSSRFSIEHVENIGPHYYTTLMRWRDNFMINKDEIL  213

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD KF+R WEYY  + A+ F + TLGDYQ+VFSRPGN
Sbjct  214  ALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSRPGN  253



>ref|XP_006406023.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
 gb|ESQ47476.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
Length=394

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSL+RVTSAMA+SSRLCVE +E+IGIHYY TL+ WR +FLERQ +I+
Sbjct  305  DFIKEYIFPGGCLPSLARVTSAMASSSRLCVEDVENIGIHYYLTLKFWRKSFLERQKEIM  364

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  272
            +LGFD KFIRTW YYF+Y AAGF   +L +
Sbjct  365  NLGFDDKFIRTWVYYFNYYAAGFKAHSLKN  394



>gb|EMT01203.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=198

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+ EYIFPGGCLPSL+RV SAM+ SSR C+EH+E+IG +YY TL CW  NF   + ++L
Sbjct  89   DFLTEYIFPGGCLPSLARVVSAMSTSSRFCIEHVENIGPNYYPTLMCWMDNFTANKDKML  148

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYY  + AA   + TLG YQ+VFSRPGN
Sbjct  149  ALGFDEKFIRIWEYYLIFSAACMKSRTLGVYQVVFSRPGN  188



>gb|EMS47377.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=640

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH E+IG HYY TL CW  N++  + +IL
Sbjct  531  DFIKEYIFPGGCLPSLSRVMSAMTTSSRFSIEHAENIGPHYYTTLMCWMDNYIANRDKIL  590

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  591  ALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  630



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +F+KEYIFPGGCLPSL+R+TSAM+ +SRLCV H+E+IG HYY TL  WR NF+  + ++L
Sbjct  763  EFLKEYIFPGGCLPSLARITSAMSNASRLCVHHVENIGYHYYPTLIHWRDNFVANREKVL  822

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIRTWEYY +YCAA F +    DYQIVF+RPG+
Sbjct  823  ALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIVFARPGD  862



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  6    FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  185
            F+KEYIFPGGC+PSL+RV SAM  SSR  +EH+E+IG +YY TL  WR NF+  + Q+L+
Sbjct  572  FVKEYIFPGGCIPSLARVMSAMTTSSRFSIEHVENIGPNYYTTLMHWRDNFMANKDQVLE  631

Query  186  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
            LGFD+KFI  WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  632  LGFDEKFILIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  670



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL
Sbjct  763  DFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKIL  822

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  823  ALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL
Sbjct  763  DFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKIL  822

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  302
             LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  823  ALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPG C PSL R++SAMAA++RLCVEH+E+IG  Y++T+R W+   L+ +S+I+
Sbjct  809  DFLKEYIFPGICPPSLGRISSAMAATTRLCVEHVENIGSQYHRTVRFWKNKLLDNKSKIV  868

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  344
             LGF+++FIR WEYY DY AAG ++ T  +YQ+VFSR G   A G+P KG +SA
Sbjct  869  ALGFNEEFIRMWEYYLDYVAAGMNSRTHLNYQVVFSRHGYPAAPGNPDKGFSSA  922



>ref|XP_008664676.1| PREDICTED: uncharacterized protein LOC103643302 isoform X1 [Zea 
mays]
Length=875

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPGGC+PSL+R+ SAM+ +SRLC++H+E+IG HYY TL  WR NF   + ++L
Sbjct  766  DFLKEYIFPGGCIPSLARIASAMSNASRLCIQHVENIGYHYYPTLIHWRENFEANEEKVL  825

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
             LGFD+KFIRTWEYY +YCAA F +    DYQIVF+R G+ 
Sbjct  826  ALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIVFARAGDA  866



>ref|XP_008664677.1| PREDICTED: uncharacterized protein LOC103643302 isoform X2 [Zea 
mays]
 tpg|DAA49063.1| TPA: hypothetical protein ZEAMMB73_143484 [Zea mays]
Length=873

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            DF+KEYIFPGGC+PSL+R+ SAM+ +SRLC++H+E+IG HYY TL  WR NF   + ++L
Sbjct  764  DFLKEYIFPGGCIPSLARIASAMSNASRLCIQHVENIGYHYYPTLIHWRENFEANEEKVL  823

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
             LGFD+KFIRTWEYY +YCAA F +    DYQIVF+R G+ 
Sbjct  824  ALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIVFARAGDA  864



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  3    DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  182
            +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + ++ 
Sbjct  763  EFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVA  822

Query  183  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  305
             LGFD+KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  823  ALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  863



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750