BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS103F12

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008388846.1|  PREDICTED: subtilisin-like protease              89.7    4e-19   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease              89.7    4e-19   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g           89.4    5e-19   Phaseolus vulgaris [French bean]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease              89.0    7e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease              88.6    9e-19   Nicotiana tomentosiformis
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like         88.6    1e-18   Cicer arietinum [garbanzo]
ref|XP_003632376.1|  PREDICTED: subtilisin-like protease              88.2    1e-18   
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease              88.2    1e-18   Fragaria vesca subsp. vesca
gb|KHN07895.1|  Subtilisin-like protease                              87.4    1e-18   Glycine soja [wild soybean]
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease              88.2    1e-18   
gb|AHI59369.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus palmeri
gb|AHI59338.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus acanthochiton
gb|AHI59337.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus acanthochiton
gb|AHI59358.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus floridanus
gb|AHI59377.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus retroflexus [common amaranth]
gb|AHI59385.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus tuberculatus
gb|AHI59371.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus powellii subsp. powellii
gb|AHI59386.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus tuberculatus
gb|AHI59342.1|  putative substilisin-like protease-like protein       85.1    1e-18   Amaranthus arenicola
gb|AHI59355.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus hybridus subsp. cruentus [African-spinach]
gb|AHI59349.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus californicus
gb|AHI59380.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus spinosus
gb|AHI59379.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus spinosus
gb|AHI59352.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus crassipes
gb|AHI59393.1|  putative substilisin-like protease-like protein       84.3    2e-18   Achyranthes bidentata
gb|AHI59391.1|  putative substilisin-like protease-like protein       85.1    2e-18   Celosia trigyna [wool-flower]
gb|AHI59375.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus quitensis
gb|AHI59350.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus caudatus [Inca-wheat]
gb|AHI59344.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus australis
gb|AHI59382.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus tamaulipensis
gb|AHI59390.1|  putative substilisin-like protease-like protein       85.1    2e-18   Celosia trigyna [wool-flower]
gb|AHI59357.1|  putative substilisin-like protease-like protein       85.1    2e-18   Amaranthus fimbriatus
gb|AHI59368.1|  putative substilisin-like protease-like protein       84.7    2e-18   Amaranthus palmeri
gb|AHI59392.1|  putative substilisin-like protease-like protein       84.7    2e-18   Celosia trigyna [wool-flower]
gb|AAX21198.1|  putative protein                                      82.4    2e-18   Nicotiana sylvestris
dbj|BAD94244.1|  serine protease like protein                         84.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHG16003.1|  Subtilisin-like protease                              87.0    3e-18   Gossypium arboreum [tree cotton]
gb|KJB82990.1|  hypothetical protein B456_013G223900                  87.0    3e-18   Gossypium raimondii
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease              87.0    3e-18   Eucalyptus grandis [rose gum]
gb|EPS65938.1|  hypothetical protein M569_08836                       86.7    4e-18   Genlisea aurea
emb|CBI36893.3|  unnamed protein product                              86.7    4e-18   Vitis vinifera
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg           86.7    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg           86.7    4e-18   Prunus persica
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like         86.7    4e-18   
gb|AHI59339.1|  putative substilisin-like protease-like protein       84.0    4e-18   Amaranthus acutilobus
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease              86.7    4e-18   Cucumis melo [Oriental melon]
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease              86.7    4e-18   Prunus mume [ume]
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g           86.7    5e-18   Phaseolus vulgaris [French bean]
emb|CDP03080.1|  unnamed protein product                              86.3    5e-18   Coffea canephora [robusta coffee]
ref|XP_003595292.1|  Subtilisin-like protease                         86.3    6e-18   Medicago truncatula
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg              86.3    6e-18   Erythranthe guttata [common monkey flower]
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg              86.3    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease              86.3    7e-18   Nicotiana sylvestris
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease              86.3    7e-18   Solanum lycopersicum
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like         86.3    7e-18   Solanum tuberosum [potatoes]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1   85.9    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease              85.5    1e-17   Malus domestica [apple tree]
gb|EYU44465.1|  hypothetical protein MIMGU_mgv1a0020562mg             84.3    1e-17   Erythranthe guttata [common monkey flower]
gb|KHN06066.1|  Subtilisin-like protease                              85.1    1e-17   Glycine soja [wild soybean]
gb|EMS60034.1|  Subtilisin-like protease                              84.7    1e-17   Triticum urartu
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              85.5    1e-17   Sesamum indicum [beniseed]
dbj|BAJ90522.1|  predicted protein                                    82.8    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg           85.1    1e-17   Capsella rubella
emb|CBI27801.3|  unnamed protein product                              85.1    1e-17   Vitis vinifera
ref|XP_010090170.1|  Subtilisin-like protease                         85.1    2e-17   Morus notabilis
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease              85.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease              85.1    2e-17   Sesamum indicum [beniseed]
emb|CDY33400.1|  BnaA07g04390D                                        85.1    2e-17   Brassica napus [oilseed rape]
gb|AHI59354.1|  putative substilisin-like protease-like protein       82.4    2e-17   Amaranthus crispus
ref|NP_565330.1|  Subtilase-like protein                              85.1    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease              85.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease              85.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease              85.1    2e-17   Brassica rapa
ref|XP_002885806.1|  predicted protein                                84.7    2e-17   Arabidopsis lyrata subsp. lyrata
emb|CBI33725.3|  unnamed protein product                              84.3    2e-17   Vitis vinifera
dbj|BAD36156.1|  putative serine protease                             85.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18042.1|  BnaC07g04280D                                        84.7    2e-17   Brassica napus [oilseed rape]
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                  84.7    2e-17   Arabis alpina [alpine rockcress]
emb|CBI35805.3|  unnamed protein product                              84.7    2e-17   Vitis vinifera
gb|ABX75360.1|  hypothetical protein LBL6                             82.0    2e-17   Panax quinquefolius
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease              84.7    2e-17   Tarenaya hassleriana [spider flower]
gb|KDO81559.1|  hypothetical protein CISIN_1g0053341mg                84.3    2e-17   Citrus sinensis [apfelsine]
gb|AES92191.2|  subtilisin-like serine protease                       84.7    2e-17   Medicago truncatula
gb|AHI59370.1|  putative substilisin-like protease-like protein       82.0    2e-17   Amaranthus palmeri
ref|XP_010105482.1|  Subtilisin-like protease                         84.7    2e-17   Morus notabilis
gb|AHI59388.1|  putative substilisin-like protease-like protein       82.0    2e-17   Amaranthus viridis [bledo]
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease              84.7    2e-17   Vitis vinifera
ref|XP_007012625.1|  Subtilase family protein                         84.7    2e-17   
ref|XP_003609994.1|  Subtilisin-like protease                         84.7    2e-17   
gb|EMS68171.1|  Subtilisin-like protease                              83.2    2e-17   Triticum urartu
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease              84.7    2e-17   Vitis vinifera
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              84.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease              84.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE50901.1|  hypothetical protein OsJ_31407                        84.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease              84.3    2e-17   Phoenix dactylifera
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease    84.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g           84.3    2e-17   Phaseolus vulgaris [French bean]
gb|ACB87529.1|  subtilisin protease                                   84.0    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520        84.3    2e-17   Amborella trichopoda
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          84.3    3e-17   Prunus persica
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050        84.3    3e-17   
gb|EAY78354.1|  hypothetical protein OsI_33442                        84.3    3e-17   Oryza sativa Indica Group [Indian rice]
gb|KGN66306.1|  hypothetical protein Csa_1G597040                     84.0    3e-17   Cucumis sativus [cucumbers]
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease              84.3    3e-17   Sesamum indicum [beniseed]
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg           84.3    3e-17   Citrus clementina [clementine]
ref|XP_002510884.1|  Cucumisin precursor, putative                    84.3    3e-17   Ricinus communis
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease              84.3    3e-17   Populus euphratica
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like         84.3    3e-17   Citrus sinensis [apfelsine]
ref|XP_002321861.2|  subtilase family protein                         84.3    3e-17   Populus trichocarpa [western balsam poplar]
gb|KDP22364.1|  hypothetical protein JCGZ_26195                       84.3    3e-17   Jatropha curcas
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg           84.3    3e-17   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease              84.0    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              84.3    3e-17   Prunus mume [ume]
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease              84.0    3e-17   Populus euphratica
gb|EMT16255.1|  Subtilisin-like protease                              84.0    3e-17   
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease              84.0    3e-17   
ref|XP_007038510.1|  Subtilase 1.3                                    84.0    4e-17   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g           84.0    4e-17   Populus trichocarpa [western balsam poplar]
gb|AHI59381.1|  putative substilisin-like protease-like protein       81.3    4e-17   Amaranthus standleyanus
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010105478.1|  Subtilisin-like protease                         84.0    4e-17   Morus notabilis
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   Eucalyptus grandis [rose gum]
emb|CDO97802.1|  unnamed protein product                              84.0    4e-17   Coffea canephora [robusta coffee]
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   Populus euphratica
gb|AHI59367.1|  putative substilisin-like protease-like protein       81.3    4e-17   Amaranthus muricatus
gb|AHI59343.1|  putative substilisin-like protease-like protein       81.3    4e-17   Amaranthus asplundii
gb|AHI59347.1|  putative substilisin-like protease-like protein       81.3    4e-17   Amaranthus blitum var. pseudogracilis
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   Prunus mume [ume]
gb|AHI59384.1|  putative substilisin-like protease-like protein       80.9    4e-17   Amaranthus tricolor [Chinese spinach]
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg           84.0    4e-17   Prunus persica
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                       84.0    4e-17   Jatropha curcas
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              84.0    4e-17   Nicotiana tomentosiformis
ref|XP_007047459.1|  Subtilase family protein                         84.0    4e-17   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease              83.6    4e-17   Sesamum indicum [beniseed]
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   Fragaria vesca subsp. vesca
ref|XP_003627424.1|  Subtilisin-like serine protease                  83.6    5e-17   Medicago truncatula
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   Fragaria vesca subsp. vesca
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   Nicotiana sylvestris
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   Fragaria vesca subsp. vesca
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like         83.6    5e-17   Citrus sinensis [apfelsine]
gb|KJB58612.1|  hypothetical protein B456_009G218000                  83.6    5e-17   Gossypium raimondii
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              83.6    5e-17   
ref|XP_010109072.1|  Subtilisin-like protease                         83.6    6e-17   Morus notabilis
emb|CBI19425.3|  unnamed protein product                              82.8    6e-17   Vitis vinifera
ref|XP_010685229.1|  PREDICTED: subtilisin-like protease              83.6    6e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         83.6    6e-17   Citrus sinensis [apfelsine]
gb|ACN27570.1|  unknown                                               82.8    6e-17   Zea mays [maize]
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like         83.6    6e-17   Glycine max [soybeans]
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 83.2    6e-17   Citrus sinensis [apfelsine]
ref|NP_001234288.1|  SBT2 protein precursor                           83.2    6e-17   Solanum lycopersicum
gb|KHN12283.1|  Subtilisin-like protease                              82.4    6e-17   Glycine soja [wild soybean]
emb|CAN71376.1|  hypothetical protein VITISV_001491                   83.2    6e-17   Vitis vinifera
emb|CDX75757.1|  BnaC03g38400D                                        82.0    6e-17   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like         83.2    6e-17   Glycine max [soybeans]
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           83.2    6e-17   Citrus clementina [clementine]
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like         83.2    6e-17   Glycine max [soybeans]
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  83.2    7e-17   Elaeis guineensis
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like         83.2    7e-17   Solanum tuberosum [potatoes]
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  83.2    7e-17   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease              83.2    7e-17   Nicotiana sylvestris
gb|KHN15704.1|  Subtilisin-like protease                              83.2    7e-17   Glycine soja [wild soybean]
gb|KHN17728.1|  Subtilisin-like protease                              80.1    7e-17   Glycine soja [wild soybean]
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                   83.2    7e-17   Eucalyptus grandis [rose gum]
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              83.2    8e-17   Nicotiana tomentosiformis
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease              83.2    8e-17   Pyrus x bretschneideri [bai li]
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease              83.2    8e-17   Eucalyptus grandis [rose gum]
gb|KJB57083.1|  hypothetical protein B456_009G147400                  82.8    8e-17   Gossypium raimondii
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease              83.2    8e-17   Phoenix dactylifera
gb|KJB57084.1|  hypothetical protein B456_009G147400                  82.8    8e-17   Gossypium raimondii
gb|EMT11314.1|  hypothetical protein F775_42966                       82.4    8e-17   
gb|ACN28035.1|  unknown                                               81.3    9e-17   Zea mays [maize]
gb|KJB29423.1|  hypothetical protein B456_005G099900                  82.8    9e-17   Gossypium raimondii
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010103418.1|  Subtilisin-like protease                         82.8    9e-17   Morus notabilis
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Prunus mume [ume]
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2    82.8    9e-17   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Cucumis melo [Oriental melon]
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1    82.8    9e-17   
emb|CDP05276.1|  unnamed protein product                              82.8    9e-17   Coffea canephora [robusta coffee]
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg           82.8    9e-17   Prunus persica
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Pyrus x bretschneideri [bai li]
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Nicotiana tomentosiformis
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease              82.8    9e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              82.8    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006426784.1|  hypothetical protein CICLE_v10024934mg           82.8    1e-16   
ref|NP_001151463.1|  LOC100285096 precursor                           82.8    1e-16   
tpg|DAA51518.1|  TPA: putative subtilase family protein               82.8    1e-16   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              82.8    1e-16   Nicotiana sylvestris
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  82.8    1e-16   
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg              82.8    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease              82.8    1e-16   Vitis vinifera
gb|KJB27210.1|  hypothetical protein B456_004G284900                  82.8    1e-16   Gossypium raimondii
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2   82.8    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease              82.8    1e-16   Fragaria vesca subsp. vesca
emb|CAN62640.1|  hypothetical protein VITISV_010210                   82.4    1e-16   Vitis vinifera
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like         82.8    1e-16   Citrus sinensis [apfelsine]
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg           82.8    1e-16   Citrus clementina [clementine]
dbj|BAJ93208.1|  predicted protein                                    82.8    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB27211.1|  hypothetical protein B456_004G284900                  82.4    1e-16   Gossypium raimondii
gb|AGT17100.1|  serine protease                                       82.4    1e-16   Saccharum hybrid cultivar R570
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g           82.8    1e-16   Phaseolus vulgaris [French bean]
dbj|BAJ87876.1|  predicted protein                                    82.8    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB43875.1|  hypothetical protein B456_007G221100                  82.4    1e-16   Gossypium raimondii
ref|NP_001234282.1|  SBT1 protein precursor                           82.4    1e-16   
emb|CDX82491.1|  BnaA03g33300D                                        82.4    1e-16   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like         82.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease              82.8    1e-16   
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              82.4    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease              82.4    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         82.4    1e-16   Setaria italica
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease              82.4    1e-16   Vitis vinifera
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like         82.4    1e-16   Setaria italica
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        82.4    1e-16   Sorghum bicolor [broomcorn]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                 82.4    1e-16   Citrus sinensis [apfelsine]
gb|KDP33922.1|  hypothetical protein JCGZ_07493                       82.4    1e-16   Jatropha curcas
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...  82.4    1e-16   Citrus sinensis [apfelsine]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like         82.4    1e-16   Glycine max [soybeans]
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg           82.4    1e-16   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                       82.4    1e-16   Jatropha curcas
gb|KHN44005.1|  Subtilisin-like protease                              81.3    1e-16   Glycine soja [wild soybean]
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease              82.4    1e-16   Vitis vinifera
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease              82.4    1e-16   Nicotiana tomentosiformis
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg           82.4    1e-16   
gb|AIX97848.1|  SBT1.5                                                82.4    1e-16   Nicotiana tabacum [American tobacco]
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  82.4    1e-16   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              82.4    1e-16   Solanum lycopersicum
emb|CDY12840.1|  BnaC07g15930D                                        82.4    1e-16   Brassica napus [oilseed rape]
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor   82.4    1e-16   Zea mays [maize]
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810        82.4    1e-16   Sorghum bicolor [broomcorn]
emb|CBI24480.3|  unnamed protein product                              82.0    2e-16   Vitis vinifera
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor   82.0    2e-16   Zea mays [maize]
gb|ACF79126.1|  unknown                                               82.0    2e-16   Zea mays [maize]
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Sesamum indicum [beniseed]
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like         82.0    2e-16   Solanum tuberosum [potatoes]
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190        82.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative    82.0    2e-16   
tpg|DAA50071.1|  TPA: putative subtilase family protein               82.0    2e-16   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Brassica rapa
emb|CDY57437.1|  BnaAnng14520D                                        82.0    2e-16   Brassica napus [oilseed rape]
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like         81.6    2e-16   
dbj|BAJ89916.1|  predicted protein                                    82.0    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010087293.1|  Subtilisin-like protease                         82.0    2e-16   
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1   82.0    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   
gb|EAY90937.1|  hypothetical protein OsI_12551                        81.3    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg           82.0    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Sesamum indicum [beniseed]
ref|XP_006381615.1|  subtilase family protein                         82.0    2e-16   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Populus euphratica
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              82.0    2e-16   Solanum lycopersicum
gb|AES62637.2|  subtilisin-like serine protease                       82.0    2e-16   Medicago truncatula
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g           82.0    2e-16   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Populus euphratica
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010089708.1|  Subtilisin-like protease                         82.0    2e-16   Morus notabilis
gb|AFW73751.1|  putative subtilase family protein                     82.0    2e-16   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           82.0    2e-16   Musa acuminata [banana]
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              81.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease              82.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06243.1|  predicted protein                                    81.6    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  81.6    2e-16   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              81.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77855.1|  unknown                                               80.1    2e-16   Picea sitchensis
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  81.6    2e-16   Cucumis sativus [cucumbers]
ref|XP_003592386.1|  Subtilisin-like protease                         81.6    2e-16   
ref|XP_004292752.1|  PREDICTED: subtilisin-like protease              81.6    2e-16   Fragaria vesca subsp. vesca
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130        81.6    2e-16   Amborella trichopoda
gb|ADE76648.1|  unknown                                               80.1    2e-16   Picea sitchensis
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease              81.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease              81.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980        81.6    2e-16   Sorghum bicolor [broomcorn]
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like         81.6    2e-16   Cicer arietinum [garbanzo]
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like         81.6    3e-16   Cucumis sativus [cucumbers]
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like         81.6    3e-16   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like         81.6    3e-16   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  81.6    3e-16   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like         81.6    3e-16   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease              81.6    3e-16   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              81.6    3e-16   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              81.6    3e-16   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              81.6    3e-16   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                  81.6    3e-16   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g           81.3    3e-16   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like         81.3    3e-16   
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease              81.3    3e-16   
gb|KJB34439.1|  hypothetical protein B456_006G065800                  80.9    3e-16   
gb|KHN21060.1|  Subtilisin-like protease                              81.3    3e-16   
gb|KJB34438.1|  hypothetical protein B456_006G065800                  80.9    3e-16   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg           81.3    3e-16   
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like         81.3    3e-16   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease              81.3    3e-16   
ref|XP_010906270.1|  PREDICTED: subtilisin-like protease              80.9    3e-16   
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease              81.3    3e-16   
gb|ACN39811.1|  unknown                                               81.3    3e-16   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like         81.3    3e-16   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like         81.3    3e-16   
emb|CDY29697.1|  BnaA04g17300D                                        81.3    3e-16   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         81.3    3e-16   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like         81.3    4e-16   
ref|NP_568765.1|  subtilase 1.3                                       81.3    4e-16   
ref|NP_001050634.1|  Os03g0605300                                     81.3    4e-16   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease              80.1    4e-16   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...  81.3    4e-16   
gb|KJB34440.1|  hypothetical protein B456_006G065800                  81.3    4e-16   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease              81.3    4e-16   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease              81.3    4e-16   
gb|EMS67510.1|  Subtilisin-like protease                              80.9    4e-16   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like         81.3    4e-16   
emb|CDX97560.1|  BnaA05g25190D                                        81.3    4e-16   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease              81.3    4e-16   
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g           81.3    4e-16   
emb|CDY18654.1|  BnaA09g07410D                                        80.9    4e-16   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like         81.3    4e-16   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  80.9    4e-16   
dbj|BAJ86110.1|  predicted protein                                    80.9    4e-16   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like         80.9    4e-16   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease              80.9    4e-16   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease              80.9    4e-16   
dbj|BAJ96698.1|  predicted protein                                    80.9    4e-16   
gb|ACN27710.1|  unknown                                               80.9    4e-16   
emb|CDY18651.1|  BnaA09g07440D                                        80.9    4e-16   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative    80.9    4e-16   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like         80.9    4e-16   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease              80.9    4e-16   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1   80.9    4e-16   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg           80.9    4e-16   
gb|KJB70050.1|  hypothetical protein B456_011G056000                  80.9    4e-16   
gb|EMT07781.1|  Subtilisin-like protease                              80.5    4e-16   
dbj|BAJ88205.1|  predicted protein                                    80.9    4e-16   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease              80.9    4e-16   
ref|XP_010105479.1|  Subtilisin-like protease                         80.9    4e-16   
emb|CDY55359.1|  BnaCnng28690D                                        80.9    4e-16   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease              80.9    5e-16   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease              80.9    5e-16   
gb|ADD09584.1|  proteinase inhibitor                                  80.9    5e-16   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease              80.9    5e-16   
gb|KEH35793.1|  subtilisin-like serine protease                       80.9    5e-16   
emb|CDX98438.1|  BnaC05g39370D                                        80.9    5e-16   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              80.9    5e-16   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease              80.9    5e-16   
ref|NP_001151549.1|  subtilisin-like protease precursor               80.9    5e-16   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  80.9    5e-16   
tpg|DAA50265.1|  TPA: putative subtilase family protein               80.9    5e-16   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g           80.9    5e-16   
gb|EPS59495.1|  hypothetical protein M569_15309                       80.5    5e-16   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                  80.5    5e-16   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like         80.9    5e-16   
emb|CDY63300.1|  BnaCnng41800D                                        80.5    5e-16   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like         80.5    5e-16   
dbj|BAJ87780.1|  predicted protein                                    80.5    5e-16   
emb|CDY18653.1|  BnaA09g07420D                                        80.5    6e-16   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                     80.5    6e-16   
gb|AAM60964.1|  subtilisin-like serine protease                       80.5    6e-16   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864           80.5    6e-16   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg           80.5    6e-16   
gb|KHN01461.1|  Subtilisin-like protease                              78.6    6e-16   
gb|EAY95232.1|  hypothetical protein OsI_17050                        79.7    6e-16   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2   80.5    6e-16   
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease              80.5    6e-16   
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease              80.5    6e-16   
ref|NP_569048.1|  subtilisin-like protease                            80.5    6e-16   
gb|AGN03879.1|  senescence-associated subtilisin protease             80.5    6e-16   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease              80.5    6e-16   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                  80.5    6e-16   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1   80.5    6e-16   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1   80.5    6e-16   
emb|CAA59963.1|  subtilisin-like protease                             80.5    6e-16   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2   80.5    6e-16   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1   80.5    6e-16   
ref|XP_007024750.1|  Subtilase family protein isoform 1               80.5    6e-16   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease              80.5    7e-16   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease              80.5    7e-16   
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease              80.5    7e-16   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease              80.5    7e-16   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease              80.5    7e-16   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg           80.5    7e-16   
emb|CDP02570.1|  unnamed protein product                              80.5    7e-16   
ref|XP_002864127.1|  subtilase family protein                         80.1    7e-16   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease              80.1    8e-16   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              80.1    8e-16   
emb|CDX80285.1|  BnaC09g34570D                                        79.0    8e-16   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease              80.1    8e-16   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         80.1    8e-16   
gb|EPS61652.1|  hypothetical protein M569_13143                       80.1    9e-16   
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease              80.1    9e-16   
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease              80.1    9e-16   
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease              80.1    1e-15   
emb|CDP15554.1|  unnamed protein product                              80.1    1e-15   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease              80.1    1e-15   
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
emb|CDY22001.1|  BnaC09g01070D                                        79.7    1e-15   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
emb|CDY00126.1|  BnaC09g01750D                                        79.0    1e-15   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         79.7    1e-15   
emb|CDY63219.1|  BnaAnng18730D                                        79.7    1e-15   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg           79.7    1e-15   
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg           79.7    1e-15   
emb|CAB67119.1|  subtilisin-like protease                             79.7    1e-15   
ref|NP_001053614.1|  Os04g0573300                                     79.7    1e-15   
emb|CAH66960.1|  OSIGBa0147H17.8                                      79.7    1e-15   
ref|NP_001152427.1|  LOC100286067 precursor                           79.7    1e-15   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease              79.7    1e-15   
gb|AAL32016.1|AF436834_1  AT3g14240/MLN21_2                           79.3    1e-15   
ref|XP_006342910.1|  PREDICTED: subtilisin-like protease-like         79.7    1e-15   
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980        79.7    1e-15   
gb|AGT16155.1|  subtilisin-like protease                              79.3    1e-15   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                   79.7    1e-15   
gb|ACN28204.1|  unknown                                               79.7    1e-15   
emb|CAN81090.1|  hypothetical protein VITISV_040910                   79.7    1e-15   
ref|XP_006358841.1|  PREDICTED: subtilisin-like protease-like         79.7    1e-15   
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1         79.7    1e-15   
emb|CDY00497.1|  BnaA10g07760D                                        79.7    1e-15   
ref|XP_009587381.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  80.1    1e-15   
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like         79.7    1e-15   
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease         79.7    1e-15   
emb|CDX99895.1|  BnaC09g28100D                                        79.7    1e-15   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              79.3    1e-15   
ref|XP_003608462.1|  Subtilisin-like protease                         79.3    1e-15   
gb|KJB57037.1|  hypothetical protein B456_009G146000                  79.3    1e-15   
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease              79.3    1e-15   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg           79.3    1e-15   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like         79.3    1e-15   
emb|CDY63302.1|  BnaCnng41810D                                        79.3    1e-15   
emb|CAD29822.2|  putative serine protease                             79.0    1e-15   
ref|XP_004245674.1|  PREDICTED: subtilisin-like protease              79.3    2e-15   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease              79.3    2e-15   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g           79.3    2e-15   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like         79.3    2e-15   
ref|NP_566483.1|  Subtilase family protein                            79.3    2e-15   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease              79.3    2e-15   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like         79.3    2e-15   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   79.3    2e-15   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              79.3    2e-15   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1   79.3    2e-15   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative    79.3    2e-15   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4   79.3    2e-15   
emb|CDY67452.1|  BnaCnng55020D                                        79.3    2e-15   
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1   79.3    2e-15   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like         79.3    2e-15   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g           79.3    2e-15   
dbj|BAH20348.1|  AT3G14067                                            79.0    2e-15   
gb|KJB49368.1|  hypothetical protein B456_008G115600                  79.3    2e-15   
emb|CDY44380.1|  BnaA02g29970D                                        79.0    2e-15   
gb|KHN45156.1|  Subtilisin-like protease                              79.0    2e-15   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease              79.0    2e-15   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like         79.0    2e-15   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841           79.0    2e-15   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1   79.0    2e-15   
gb|EPS61757.1|  hypothetical protein M569_13035                       79.0    2e-15   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease              79.0    2e-15   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g           79.0    2e-15   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease              79.0    2e-15   
gb|AES94150.2|  subtilisin-like serine protease                       79.0    2e-15   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease              79.0    2e-15   
gb|KHN31561.1|  Subtilisin-like protease                              78.6    2e-15   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease              79.0    2e-15   
ref|XP_003538510.1|  PREDICTED: subtilisin-like protease-like         79.0    2e-15   
ref|XP_003611192.1|  Subtilisin-like serine protease                  79.0    2e-15   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like         79.0    2e-15   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like         79.0    3e-15   
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
emb|CBI35855.3|  unnamed protein product                              79.3    3e-15   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...  78.6    3e-15   
ref|XP_010692332.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g           78.6    3e-15   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like         78.6    3e-15   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    78.6    3e-15   
emb|CBI38831.3|  unnamed protein product                              78.2    3e-15   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
emb|CAN81091.1|  hypothetical protein VITISV_040911                   77.4    3e-15   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like         78.6    3e-15   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              78.6    3e-15   
gb|EYU31528.1|  hypothetical protein MIMGU_mgv1a0212142mg             77.4    3e-15   
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_006369092.1|  subtilase family protein                         78.6    3e-15   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260        78.6    3e-15   
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg              78.2    3e-15   
ref|XP_010661613.1|  PREDICTED: subtilisin-like protease              78.6    3e-15   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           78.6    3e-15   
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                   78.2    3e-15   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease              78.2    3e-15   
gb|KCW77656.1|  hypothetical protein EUGRSUZ_D01954                   78.2    3e-15   
gb|ACN34516.1|  unknown                                               77.0    3e-15   
ref|XP_007158428.1|  hypothetical protein PHAVU_002G152400g           78.2    3e-15   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         78.2    4e-15   



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTH
Sbjct  535  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTH  578



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTH
Sbjct  535  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTH  578



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYTH
Sbjct  535  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTH  578



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY H
Sbjct  548  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNH  591



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY H
Sbjct  537  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVH  580



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTH
Sbjct  548  FNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTH  591



>ref|XP_003632376.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=784

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALLK AHP+WSPGAI+SALMTTAYTH
Sbjct  560  FNILSGTSMSCPHVSGLAALLKGAHPDWSPGAIRSALMTTAYTH  603



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTH
Sbjct  541  FNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTH  584



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+
Sbjct  293  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTY  336



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAALLKAAHPEWSP A+KSALMTTAYTH
Sbjct  535  FNIISGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTH  578



>gb|AHI59369.1| putative substilisin-like protease-like protein, partial [Amaranthus 
palmeri]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59338.1| putative substilisin-like protease-like protein, partial [Amaranthus 
acanthochiton]
 gb|AHI59341.1| putative substilisin-like protease-like protein, partial [Amaranthus 
arenicola]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59337.1| putative substilisin-like protease-like protein, partial [Amaranthus 
acanthochiton]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59358.1| putative substilisin-like protease-like protein, partial [Amaranthus 
floridanus]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59377.1| putative substilisin-like protease-like protein, partial [Amaranthus 
retroflexus]
 gb|AHI59378.1| putative substilisin-like protease-like protein, partial [Amaranthus 
retroflexus]
 gb|AHI59389.1| putative substilisin-like protease-like protein, partial [Amaranthus 
wrightii]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59385.1| putative substilisin-like protease-like protein, partial [Amaranthus 
tuberculatus]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59371.1| putative substilisin-like protease-like protein, partial [Amaranthus 
powellii subsp. powellii]
 gb|AHI59372.1| putative substilisin-like protease-like protein, partial [Amaranthus 
powellii subsp. bouchonii]
 gb|AHI59373.1| putative substilisin-like protease-like protein, partial [Amaranthus 
powellii subsp. powellii]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59386.1| putative substilisin-like protease-like protein, partial [Amaranthus 
tuberculatus]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59342.1| putative substilisin-like protease-like protein, partial [Amaranthus 
arenicola]
Length=285

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59355.1| putative substilisin-like protease-like protein, partial [Amaranthus 
cruentus]
 gb|AHI59356.1| putative substilisin-like protease-like protein, partial [Amaranthus 
cruentus]
 gb|AHI59363.1| putative substilisin-like protease-like protein, partial [Amaranthus 
cruentus x Amaranthus hybridus]
 gb|AHI59365.1| putative substilisin-like protease-like protein, partial [Amaranthus 
hypochondriacus]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59349.1| putative substilisin-like protease-like protein, partial [Amaranthus 
californicus]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59380.1| putative substilisin-like protease-like protein, partial [Amaranthus 
spinosus]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59379.1| putative substilisin-like protease-like protein, partial [Amaranthus 
spinosus]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59352.1| putative substilisin-like protease-like protein, partial [Amaranthus 
crassipes]
 gb|AHI59353.1| putative substilisin-like protease-like protein, partial [Amaranthus 
crassipes]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59393.1| putative substilisin-like protease-like protein, partial [Achyranthes 
bidentata]
Length=219

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEW+P AIKSALMTTAYT
Sbjct  24   FNIISGTSMSCPHVSGLAALVKAAHPEWTPAAIKSALMTTAYT  66



>gb|AHI59391.1| putative substilisin-like protease-like protein, partial [Celosia 
trigyna]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59375.1| putative substilisin-like protease-like protein, partial [Amaranthus 
quitensis]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59350.1| putative substilisin-like protease-like protein, partial [Amaranthus 
caudatus]
 gb|AHI59351.1| putative substilisin-like protease-like protein, partial [Amaranthus 
caudatus]
 gb|AHI59364.1| putative substilisin-like protease-like protein, partial [Amaranthus 
hybridus]
 gb|AHI59366.1| putative substilisin-like protease-like protein, partial [Amaranthus 
hypochondriacus]
 gb|AHI59374.1| putative substilisin-like protease-like protein, partial [Amaranthus 
quitensis]
 gb|AHI59376.1| putative substilisin-like protease-like protein, partial [Amaranthus 
quitensis]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59344.1| putative substilisin-like protease-like protein, partial [Amaranthus 
australis]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59382.1| putative substilisin-like protease-like protein, partial [Amaranthus 
tamaulipensis]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59390.1| putative substilisin-like protease-like protein, partial [Celosia 
trigyna]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59357.1| putative substilisin-like protease-like protein, partial [Amaranthus 
fimbriatus]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59368.1| putative substilisin-like protease-like protein, partial [Amaranthus 
palmeri]
Length=285

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AHI59392.1| putative substilisin-like protease-like protein, partial [Celosia 
trigyna]
Length=285

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTAYT  121



>gb|AAX21198.1| putative protein [Nicotiana sylvestris]
Length=122

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  37   FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  79



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  109  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  150



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAAL+KAAHPEWSP AIKSALMTTAYT 
Sbjct  535  FNIMSGTSMSCPHISGLAALIKAAHPEWSPSAIKSALMTTAYTQ  578



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAAL+KAAHPEWSP AIKSALMTTAYT 
Sbjct  535  FNIMSGTSMSCPHISGLAALIKAAHPEWSPSAIKSALMTTAYTQ  578



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT+YTH
Sbjct  542  FNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTSYTH  585



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYT
Sbjct  510  PFNIISGTSMSCPHISGLAALLKAAHPRWSPSAIKSALMTTAYT  553



>emb|CBI36893.3| unnamed protein product [Vitis vinifera]
Length=755

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALLK AHP+WSPGAI+SALMTTAYTH
Sbjct  509  FNILSGTSMSCPHVSGLAALLKGAHPDWSPGAIRSALMTTAYTH  552



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAYT
Sbjct  537  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYT  579



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  536  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQ  579



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  538  FNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQ  581



>gb|AHI59339.1| putative substilisin-like protease-like protein, partial [Amaranthus 
acutilobus]
 gb|AHI59340.1| putative substilisin-like protease-like protein, partial [Amaranthus 
acutilobus]
Length=285

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIK+ALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKAALMTTAYT  121



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  540  FNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQ  583



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  536  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQ  579



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY H
Sbjct  536  FNIVSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVH  579



>emb|CDP03080.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT
Sbjct  506  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYT  548



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAY H
Sbjct  551  FNIMSGTSMSCPHISGLAALLKAAHPTWSPSAIKSALMTTAYNH  594



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYTH
Sbjct  540  FNIISGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTH  583



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT
Sbjct  538  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYT  580



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  
Sbjct  537  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVR  580



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  
Sbjct  535  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNR  578



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY  
Sbjct  540  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNR  583



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAY 
Sbjct  547  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYN  589



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHI GLAALLKAAHPEWSP A+KSALMTTAYTH
Sbjct  535  FNIISGTSMSCPHIIGLAALLKAAHPEWSPSAVKSALMTTAYTH  578



>gb|EYU44465.1| hypothetical protein MIMGU_mgv1a0020562mg, partial [Erythranthe 
guttata]
Length=426

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAALLK+AHPEWSP AI+SALMTTAYT
Sbjct  189  FNIISGTSMSCPHISGLAALLKSAHPEWSPAAIRSALMTTAYT  231



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAY H
Sbjct  373  FNIMSGTSMSCPHISGLAALLKAAHPGWSPSAIKSALMTTAYVH  416



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT YT
Sbjct  252  PFNIISGTSMSCPHISGLAALLKAAHPNWSPAAIKSALMTTTYT  295



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAY+H
Sbjct  559  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYSH  602



>dbj|BAJ90522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSM+CPHISGLAALLKAAHP WSP AIKSALMTTAYT 
Sbjct  108  FNILSGTSMACPHISGLAALLKAAHPTWSPAAIKSALMTTAYTR  151



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  532  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  573



>emb|CBI27801.3| unnamed protein product [Vitis vinifera]
Length=703

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISG+AAL+KAAHPEWSP A+KSALMTTAYT 
Sbjct  567  FNIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYTR  610



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAY
Sbjct  536  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAY  577



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  531  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  572



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAALLKAAHP WSP AIKSALMTTAYT
Sbjct  534  FNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYT  576



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY 
Sbjct  526  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYN  568



>gb|AHI59354.1| putative substilisin-like protease-like protein, partial [Amaranthus 
crispus]
Length=285

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHQEWSPAAIKSALMTTAYT  121



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  529  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  570



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  530  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  571



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  529  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  570



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY 
Sbjct  538  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYN  580



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  527  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  568



>emb|CBI33725.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLA LLKAAHPEWSP AI+SALMTTAYT+
Sbjct  380  FNIISGTSMSCPHISGLAGLLKAAHPEWSPAAIRSALMTTAYTN  423



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  540  PFNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  583



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY 
Sbjct  512  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYN  554



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISGLA LLKAAHPEWSP AIKSALMTTAY
Sbjct  529  FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAY  570



>emb|CBI35805.3| unnamed protein product [Vitis vinifera]
Length=619

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSM+CPHISGLAALLKAAHPEWSP AI+SALMTTAYT 
Sbjct  328  FNILSGTSMACPHISGLAALLKAAHPEWSPAAIRSALMTTAYTE  371



>gb|ABX75360.1| hypothetical protein LBL6 [Panax quinquefolius]
Length=260

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+K+AHPEWSP AI+SALMTTAYT
Sbjct  29   FNIISGTSMSCPHLSGLAALVKSAHPEWSPAAIRSALMTTAYT  71



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAA LKAAHPEWSP AIKSALMTTAY 
Sbjct  541  FNIMSGTSMSCPHISGLAAFLKAAHPEWSPSAIKSALMTTAYN  583



>gb|KDO81559.1| hypothetical protein CISIN_1g0053341mg, partial [Citrus sinensis]
Length=577

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTTAY+
Sbjct  346  FNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIKSALMTTAYS  388



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT
Sbjct  529  FNIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYT  571



>gb|AHI59370.1| putative substilisin-like protease-like protein, partial [Amaranthus 
palmeri]
Length=285

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAA PEWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAXPEWSPAAIKSALMTTAYT  121



>ref|XP_010105482.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04838.1| Subtilisin-like protease [Morus notabilis]
Length=765

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTTAY+
Sbjct  544  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALMTTAYS  586



>gb|AHI59388.1| putative substilisin-like protease-like protein, partial [Amaranthus 
viridis]
Length=285

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHXEWSPAAIKSALMTTAYT  121



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLA LLKAAHPEWSP AI+SALMTTAYT+
Sbjct  537  FNIISGTSMSCPHISGLAGLLKAAHPEWSPAAIRSALMTTAYTN  580



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHPEWS  AIKSALMTTAYT 
Sbjct  534  FNIMSGTSMSCPHISGLAALLKAAHPEWSTSAIKSALMTTAYTE  577



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT
Sbjct  529  FNIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYT  571



>gb|EMS68171.1| Subtilisin-like protease [Triticum urartu]
Length=419

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT 
Sbjct  265  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYTR  308



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSM+CPHISGLAALLKAAHPEWSP AI+SALMTTAYT 
Sbjct  554  FNILSGTSMACPHISGLAALLKAAHPEWSPAAIRSALMTTAYTE  597



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTT+YT
Sbjct  529  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALMTTSYT  571



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  544  FNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTD  587



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT
Sbjct  534  FNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYT  576



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT
Sbjct  541  FNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYT  583



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT
Sbjct  549  FNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYT  591



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  552  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  595



>gb|ACB87529.1| subtilisin protease [Triticum aestivum]
Length=571

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPH+SGLAALL+ AHPEWSP A+KSALMTTAY 
Sbjct  335  PFNIISGTSMSCPHVSGLAALLRQAHPEWSPAAVKSALMTTAYN  378



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  554  FNIISGTSMSCPHISGVAALLKAAHPDWSPAAIKSALMTTAYTR  597



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  554  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  597



>ref|XP_006857985.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
 gb|ERN19452.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
Length=786

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY H
Sbjct  560  FNILSGTSMSCPHVSGVAALLKAAHPDWSPAAIKSALMTTAYVH  603



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AALLKAAHPEWSP AIKSALMTTAYT
Sbjct  549  FNIISGTSMSCPHISGVAALLKAAHPEWSPAAIKSALMTTAYT  591



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT 
Sbjct  341  FNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQ  384



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISGLAALLKAAHPEWSP AIKSALMTTAYT
Sbjct  519  FNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYT  561



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTTAY+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIKSALMTTAYS  577



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  549  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  592



>ref|XP_011041660.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  594



>ref|XP_006490276.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO65327.1| hypothetical protein CISIN_1g044578mg [Citrus sinensis]
Length=769

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  543  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  586



>ref|XP_002321861.2| subtilase family protein [Populus trichocarpa]
 gb|EEF05988.2| subtilase family protein [Populus trichocarpa]
Length=778

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  594



>gb|KDP22364.1| hypothetical protein JCGZ_26195 [Jatropha curcas]
Length=778

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  552  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  595



>ref|XP_006421788.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
 gb|ESR35028.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
Length=769

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  543  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  586



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AALLKAAHP+WSP AIKSALMTTAYT
Sbjct  534  FNIMSGTSMSCPHISGVAALLKAAHPKWSPSAIKSALMTTAYT  576



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  615  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  658



>ref|XP_011030007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  594



>gb|EMT16255.1| Subtilisin-like protease [Aegilops tauschii]
Length=761

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPHISGLAALLKAAHP WSP AIKSALMTT YT
Sbjct  357  PFNIISGTSMSCPHISGLAALLKAAHPNWSPAAIKSALMTTTYT  400



>ref|XP_008378050.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=660

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  434  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  477



>ref|XP_007038510.1| Subtilase 1.3 [Theobroma cacao]
 gb|EOY23011.1| Subtilase 1.3 [Theobroma cacao]
Length=778

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  594



>ref|XP_002318860.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
 gb|EEE97080.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
Length=778

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  551  FNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVH  594



>gb|AHI59381.1| putative substilisin-like protease-like protein, partial [Amaranthus 
standleyanus]
Length=285

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHLEWSPAAIKSALMTTAYT  121



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT 
Sbjct  544  FNIMSGTSMSCPHISGVAALLKAAHPNWSPSAIKSALMTTAYTR  587



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTTAY+
Sbjct  538  FNIVSGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAYS  580



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT
Sbjct  547  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYT  589



>emb|CDO97802.1| unnamed protein product [Coffea canephora]
Length=792

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT
Sbjct  559  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYT  601



>ref|XP_011036534.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT
Sbjct  540  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYT  582



>gb|AHI59367.1| putative substilisin-like protease-like protein, partial [Amaranthus 
muricatus]
Length=285

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHLEWSPAAIKSALMTTAYT  121



>gb|AHI59343.1| putative substilisin-like protease-like protein, partial [Amaranthus 
asplundii]
 gb|AHI59345.1| putative substilisin-like protease-like protein, partial [Amaranthus 
blitoides]
 gb|AHI59346.1| putative substilisin-like protease-like protein, partial [Amaranthus 
graecizans subsp. aschersonianus]
 gb|AHI59348.1| putative substilisin-like protease-like protein, partial [Amaranthus 
blitum subsp. blitum]
 gb|AHI59359.1| putative substilisin-like protease-like protein, partial [Amaranthus 
graecizans subsp. silvestris]
 gb|AHI59360.1| putative substilisin-like protease-like protein, partial [Amaranthus 
graecizans subsp. aschersonianus]
 gb|AHI59361.1| putative substilisin-like protease-like protein, partial [Amaranthus 
graecizans subsp. aschersonianus]
 gb|AHI59362.1| putative substilisin-like protease-like protein, partial [Amaranthus 
greggii]
 gb|AHI59383.1| putative substilisin-like protease-like protein, partial [Amaranthus 
tricolor]
 gb|AHI59387.1| putative substilisin-like protease-like protein, partial [Amaranthus 
viridis]
Length=285

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHLEWSPAAIKSALMTTAYT  121



>gb|AHI59347.1| putative substilisin-like protease-like protein, partial [Amaranthus 
blitum var. pseudogracilis]
Length=285

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHLEWSPAAIKSALMTTAYT  121



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  545  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  587



>gb|AHI59384.1| putative substilisin-like protease-like protein, partial [Amaranthus 
tricolor]
Length=285

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAH EWSP AIKSALMTTAYT
Sbjct  79   FNIISGTSMSCPHVSGLAALVKAAHLEWSPAAIKSALMTTAYT  121



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  546  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  588



>ref|XP_008377982.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTT+YT
Sbjct  540  FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTSYT  582



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  516  FNIISGTSMSCPHISGLAALLKAAHPDWSPTAIRSALMTTAYT  558



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  541  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  583



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAYT 
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTD  578



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  534  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  576



>ref|XP_004305780.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=770

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT
Sbjct  536  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYT  578



>ref|XP_003627424.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AET01900.1| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTTAYT
Sbjct  548  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTAYT  590



>ref|XP_004308141.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=778

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLK+ HPEWSP AIKSALMTTAY H
Sbjct  555  FNILSGTSMSCPHVSGIAALLKSRHPEWSPAAIKSALMTTAYVH  598



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  541  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  583



>ref|XP_010272631.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=785

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKSALMTTAY H
Sbjct  559  FNILSGTSMSCPHVSGVAALLKARHPEWSPAAIKSALMTTAYVH  602



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  533  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  575



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTTAY+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALMTTAYS  577



>gb|KJB58612.1| hypothetical protein B456_009G218000 [Gossypium raimondii]
Length=768

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAA++KAAHPEWSP AIKSALMTTAYT
Sbjct  537  FNIISGTSMSCPHVSGLAAIVKAAHPEWSPAAIKSALMTTAYT  579



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAYT
Sbjct  545  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYT  587



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  544  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  587



>emb|CBI19425.3| unnamed protein product [Vitis vinifera]
Length=496

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEW P AIKSALMTTAY
Sbjct  347  FNIISGTSMSCPHVSGLAALLKAAHPEWRPAAIKSALMTTAY  388



>ref|XP_010685229.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=785

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP A++SALMTTAYT
Sbjct  552  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAVRSALMTTAYT  594



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTTAY
Sbjct  534  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAY  575



>gb|ACN27570.1| unknown [Zea mays]
Length=522

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALL+AAHPEWSP AI+SALMTTAY  
Sbjct  295  FNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNE  338



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  556  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  599



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTTAY
Sbjct  534  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAY  575



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  549  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  592



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTA  H
Sbjct  213  FNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTADVH  256



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AAL+KAAHPEWSP A+KSALMTTAYT
Sbjct  524  FNIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYT  566



>emb|CDX75757.1| BnaC03g38400D [Brassica napus]
Length=403

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  170  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  212



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+
Sbjct  525  FNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTY  568



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTTAY
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAY  576



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  555  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  598



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+ G+AALLKA+HP+WSP AIKSALMTTAYTH
Sbjct  559  FNILSGTSMSCPHVGGVAALLKASHPDWSPAAIKSALMTTAYTH  602



>ref|XP_006362686.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  549  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  592



>ref|XP_010932346.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=804

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP  IKSALMTTAYT 
Sbjct  569  FNILSGTSMACPHVSGLAALLKAAHPEWSPAVIKSALMTTAYTK  612



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  553  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  596



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  515  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  558



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +2

Query  14   MSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            MSGTSMSCPHISGLAALLKAAHP+WSP AIKSALMTTAYT+
Sbjct  1    MSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTN  41



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHPEWSP AI+SALMTTAYT
Sbjct  664  FNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYT  706



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  545  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  588



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  620  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  663



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  554  FNILSGTSMSCPHVSGVAALLKARHPDWSPAAIKSALMTTAYVH  597



>gb|KJB57083.1| hypothetical protein B456_009G147400 [Gossypium raimondii]
Length=749

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTTAYT
Sbjct  516  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTAYT  558



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+ G+AALLKA+HP+WSP AIKSALMTTAYTH
Sbjct  588  FNILSGTSMSCPHVGGVAALLKASHPDWSPSAIKSALMTTAYTH  631



>gb|KJB57084.1| hypothetical protein B456_009G147400 [Gossypium raimondii]
Length=772

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTTAYT
Sbjct  539  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTAYT  581



>gb|EMT11314.1| hypothetical protein F775_42966 [Aegilops tauschii]
Length=516

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPH+SGLAALL+ AHP+WSP A+KSALMTTAY 
Sbjct  241  PFNIISGTSMSCPHVSGLAALLRQAHPDWSPTAVKSALMTTAYN  284



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALL++AHPEWSP A++SALMTTAY
Sbjct  149  FNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAY  190



>gb|KJB29423.1| hypothetical protein B456_005G099900 [Gossypium raimondii]
Length=766

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAA+LKAAHPEWSP AIKSALMTTAY+
Sbjct  543  FNIVSGTSMSCPHVSGLAAILKAAHPEWSPAAIKSALMTTAYS  585



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AIKSALMTTAY
Sbjct  538  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIKSALMTTAY  579



>ref|XP_010103418.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB95737.1| Subtilisin-like protease [Morus notabilis]
Length=799

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNIMSGTSMSCPH+SG+AALLK AHPEW+P  IKSA+MTTAYTH
Sbjct  565  FNIMSGTSMSCPHLSGVAALLKGAHPEWTPAVIKSAMMTTAYTH  608



>ref|XP_008228336.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=764

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  531  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  573



>ref|XP_007018544.1| Xylem serine proteinase 1, putative isoform 2 [Theobroma cacao]
 gb|EOY15769.1| Xylem serine proteinase 1, putative isoform 2 [Theobroma cacao]
Length=707

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            F+I+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTTAYT
Sbjct  537  FSIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALMTTAYT  579



>ref|XP_008444575.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=770

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAALLKAAHP+WSP AI+SALMTTAY+
Sbjct  539  FNIISGTSMSCPHISGLAALLKAAHPDWSPAAIRSALMTTAYS  581



>ref|XP_007018543.1| Xylem serine proteinase 1, putative isoform 1 [Theobroma cacao]
 gb|EOY15768.1| Xylem serine proteinase 1, putative isoform 1 [Theobroma cacao]
Length=768

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            F+I+SGTSMSCPH+SGLAALLKAAHPEWSP AIKSALMTTAYT
Sbjct  537  FSIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALMTTAYT  579



>emb|CDP05276.1| unnamed protein product [Coffea canephora]
Length=778

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AIKSALMTTAY H
Sbjct  552  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVH  595



>ref|XP_007217030.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
 gb|EMJ18229.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
Length=784

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  551  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  593



>ref|XP_009357945.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=691

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  458  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  500



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHP+WSP AI+SALMTTAYT
Sbjct  537  FNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYT  579



>ref|XP_010688373.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=813

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KA+HPEWSP AIKSALMTTAYT
Sbjct  583  FNIISGTSMSCPHLSGLAALVKASHPEWSPAAIKSALMTTAYT  625



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HPEWSP AIKS+LMTTAY H
Sbjct  556  FNILSGTSMSCPHVSGVAALLKAKHPEWSPAAIKSSLMTTAYIH  599



>ref|XP_006426784.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|ESR40024.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|KDO53785.1| hypothetical protein CISIN_1g040458mg [Citrus sinensis]
Length=732

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  499  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  541



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALL+AAHPEWSP AI+SALMTTAY  
Sbjct  538  FNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNE  581



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALL+AAHPEWSP AI+SALMTTAY  
Sbjct  538  FNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNE  581



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHP+WSP AI+SALMTTAYT
Sbjct  537  FNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYT  579



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+ ALLKAAHPEWSP AIKSALMT+AYT
Sbjct  541  FNIMSGTSMSCPHISGVVALLKAAHPEWSPSAIKSALMTSAYT  583



>gb|EYU25500.1| hypothetical protein MIMGU_mgv1a001697mg [Erythranthe guttata]
Length=771

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AI+SALMTTAY+ 
Sbjct  539  FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIRSALMTTAYSR  582



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNIMSGTSMSCPHISG+AAL+KAAHPEWSP A+KSALMTTAYT
Sbjct  533  FNIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYT  575



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAA LKAAHP+WSP AIKSALMTTAYT 
Sbjct  536  FNIVSGTSMSCPHISGLAAWLKAAHPDWSPSAIKSALMTTAYTR  579



>ref|XP_009357900.1| PREDICTED: subtilisin-like protease isoform X2 [Pyrus x bretschneideri]
Length=797

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  564  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  606



>ref|XP_004290953.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=766

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAAL+KAAHP+WSP AIKSALMTTAY++
Sbjct  535  FNIISGTSMSCPHVSGLAALVKAAHPDWSPAAIKSALMTTAYSN  578



>emb|CAN62640.1| hypothetical protein VITISV_010210 [Vitis vinifera]
Length=566

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEW P AIKSALMTTAY
Sbjct  335  FNIISGTSMSCPHVSGLAALLKAAHPEWXPAAIKSALMTTAY  376



>ref|XP_006465816.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  545  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  587



>ref|XP_006426785.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|ESR40025.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
Length=778

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  545  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  587



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPH+SGLAALL+ AHP+WSP A+KSALMTTAY 
Sbjct  548  PFNIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYN  591



>gb|KJB27211.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=630

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPHISGLAA LKAAHP+WSP AIKSALMTTAYT 
Sbjct  536  FNIVSGTSMSCPHISGLAAWLKAAHPDWSPSAIKSALMTTAYTR  579



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  516  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  558



>ref|XP_007135377.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
 gb|ESW07371.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
Length=781

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  547  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  589



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    PFNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            PFNI+SGTSMSCPH+SGLAALL+ AHP+WSP A+KSALMTTAY 
Sbjct  548  PFNIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYN  591



>gb|KJB43875.1| hypothetical protein B456_007G221100 [Gossypium raimondii]
Length=761

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLA LLKAAHP+WSP AI+SALMTTAYT 
Sbjct  536  FNIISGTSMSCPHVSGLAGLLKAAHPDWSPAAIRSALMTTAYTE  579



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTT+Y+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTSYS  577



>emb|CDX82491.1| BnaA03g33300D [Brassica napus]
Length=767

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  534  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  576



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTT+Y+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTSYS  577



>ref|XP_008392153.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=815

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  582  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  624



>ref|XP_010527146.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=727

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAY+
Sbjct  504  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYS  546



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAY+
Sbjct  538  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYS  580



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALL+AAHPEWSP AI+SALMTTAY  
Sbjct  535  FNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNE  578



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHPEW P AIKSALMTTAY
Sbjct  534  FNIISGTSMSCPHVSGLAALLKAAHPEWRPAAIKSALMTTAY  575



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT
Sbjct  542  FNIISGTSMSCPHISGVAALLKAAHPNWSPAAIKSALMTTAYT  584



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SGLAALL+AAHPEWSP AI+SALMTTAY  
Sbjct  538  FNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYND  581



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY
Sbjct  538  FNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAY  579



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAY
Sbjct  536  FNIMSGTSMSCPHISGVAALLKAAHPSWSPSAIKSALMTTAY  577



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY
Sbjct  538  FNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAY  579



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  548  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  590



>ref|XP_007224759.1| hypothetical protein PRUPE_ppa024174mg [Prunus persica]
 gb|EMJ25958.1| hypothetical protein PRUPE_ppa024174mg [Prunus persica]
Length=758

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP A+KSALMTT+YT
Sbjct  531  FNIISGTSMSCPHVSGLAALLKAAHPKWSPAAVKSALMTTSYT  573



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAY
Sbjct  514  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAY  555



>gb|KHN44005.1| Subtilisin-like protease [Glycine soja]
Length=447

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+K+AHP+WSP A++SALMTTAYT
Sbjct  225  FNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALMTTAYT  267



>ref|XP_002270958.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AI+SALMTTAY H
Sbjct  549  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIRSALMTTAYVH  592



>ref|XP_009615143.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTT Y+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTGYS  577



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNIMSGTSMSCPH+SG+AALLKAAHP+WSP AIKSALMTTAY
Sbjct  557  FNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAY  598



>gb|AIX97848.1| SBT1.5 [Nicotiana tabacum]
Length=766

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLKAAHPEWSP AI+SALMTT Y+
Sbjct  535  FNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTGYS  577



>ref|XP_008377981.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=767

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAA+LKAAHP+WSP AIKSALMTT+YT
Sbjct  537  FNILSGTSMSCPHVSGLAAILKAAHPKWSPAAIKSALMTTSYT  579



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHP+WSP AI+SALMTTAYT
Sbjct  541  FNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYT  583



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLK+AHPEWSP AI+SALMTTAY
Sbjct  538  FNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAY  579



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT
Sbjct  543  FNIISGTSMSCPHISGVAALMKAAHPDWSPSAIKSALMTTAYT  585



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  546  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  588



>emb|CBI24480.3| unnamed protein product [Vitis vinifera]
Length=632

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYTH  136
            FNI+SGTSMSCPH+SG+AALLKA HP+WSP AI+SALMTTAY H
Sbjct  434  FNILSGTSMSCPHVSGIAALLKARHPDWSPAAIRSALMTTAYVH  477



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  538  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  580



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  538  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  580



>ref|XP_011069783.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AI+SALMTTAY+
Sbjct  538  FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIRSALMTTAYS  580



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHP+WSP AI+SALMTTAYT
Sbjct  540  FNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYT  582



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT
Sbjct  543  FNIISGTSMSCPHISGVAALMKAAHPDWSPAAIKSALMTTAYT  585



>ref|XP_002534008.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28379.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=706

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AIKSALMTTAY
Sbjct  473  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIKSALMTTAY  514



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AAL+KAAHP+WSP AIKSALMTTAYT
Sbjct  543  FNIISGTSMSCPHISGVAALMKAAHPDWSPSAIKSALMTTAYT  585



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLK+AHPEWSP AI+SALMTTAY
Sbjct  539  FNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAY  580



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLK+AHPEWSP AI+SALMTTAY
Sbjct  539  FNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAY  580



>ref|XP_008367646.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTT+Y
Sbjct  540  FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTSY  581



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISG+AALLKAAHP WSP AIKSALMTTAYT
Sbjct  310  FNIISGTSMSCPHISGVAALLKAAHPGWSPAAIKSALMTTAYT  352



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPHISGLAA +KAAHP+WSP AIKSALMTTAYT
Sbjct  542  FNILSGTSMSCPHISGLAAFVKAAHPDWSPSAIKSALMTTAYT  584



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAALLKAAHP+WSP AI+SALMTTAY
Sbjct  541  FNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAY  582



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALLK AHPEWSP AI+SALMTTAY+
Sbjct  518  FNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYS  560



>ref|XP_009357899.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=797

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  564  FNILSGTSMACPHLSGLAALLKAAHPDWSPAAIRSALMTTAYT  606



>ref|XP_008393753.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAY  130
            FNI+SGTSMSCPH+SGLAAL+KAAHPEWSP AIKSALMTT+Y
Sbjct  540  FNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIKSALMTTSY  581



>gb|EAY90937.1| hypothetical protein OsI_12551 [Oryza sativa Indica Group]
Length=470

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSMSCPH+SGLAALL++AHPEWSP A++SALMTTAY+
Sbjct  234  FNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYS  276



>ref|XP_006407103.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
 gb|ESQ48556.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
Length=779

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  5    FNIMSGTSMSCPHISGLAALLKAAHPEWSPGAIKSALMTTAYT  133
            FNI+SGTSM+CPH+SGLAALLKAAHP+WSP AI+SALMTTAYT
Sbjct  546  FNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT  588



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554300256640