BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS103C03

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    166   2e-43   Nicotiana tomentosiformis
ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    164   4e-43   Nicotiana tomentosiformis
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    161   6e-42   Nicotiana benthamiana
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    161   6e-42   Nicotiana benthamiana
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   2e-41   Nicotiana tomentosiformis
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   2e-41   Nicotiana sylvestris
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    160   2e-41   Nicotiana sylvestris
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    158   5e-41   Nicotiana benthamiana
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   5e-40   
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    155   5e-40   Solanum tuberosum [potatoes]
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    154   2e-39   Solanum lycopersicum
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    149   1e-37   Fragaria vesca subsp. vesca
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    149   1e-37   Nicotiana benthamiana
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    146   9e-37   Cucumis melo [Oriental melon]
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    143   9e-37   
gb|ADN33858.1|  ATP-dependent clp protease                              146   9e-37   Cucumis melo subsp. melo
ref|XP_010099042.1|  Chaperone protein ClpC                             143   2e-36   
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    143   1e-35   Prunus mume [ume]
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    143   1e-35   
emb|CBI15747.3|  unnamed protein product                                142   2e-35   Vitis vinifera
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             142   4e-35   Prunus persica
emb|CDO98310.1|  unnamed protein product                                141   6e-35   Coffea canephora [robusta coffee]
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    140   1e-34   
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    140   1e-34   Solanum lycopersicum
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    139   2e-34   Solanum tuberosum [potatoes]
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    139   4e-34   Solanum tuberosum [potatoes]
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    139   4e-34   Vitis vinifera
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    137   2e-33   Cucumis melo [Oriental melon]
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         137   2e-33   Jatropha curcas
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    136   3e-33   Cucumis sativus [cucumbers]
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           136   4e-33   Gossypium arboreum [tree cotton]
gb|KJB19711.1|  hypothetical protein B456_003G116200                    134   1e-32   Gossypium raimondii
ref|XP_007038115.1|  CLPC                                               134   1e-32   
gb|KJB19712.1|  hypothetical protein B456_003G116200                    134   2e-32   Gossypium raimondii
gb|KJB19710.1|  hypothetical protein B456_003G116200                    134   2e-32   Gossypium raimondii
ref|XP_002511102.1|  ATP-dependent clp protease, putative               133   4e-32   Ricinus communis
gb|AAD02267.1|  ClpC protease                                           132   7e-32   Spinacia oleracea
gb|KJB07945.1|  hypothetical protein B456_001G054700                    130   5e-31   Gossypium raimondii
gb|EPS63111.1|  hypothetical protein M569_11677                         122   5e-31   Genlisea aurea
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    129   9e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          129   2e-30   Medicago truncatula
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     125   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    125   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    125   2e-29   Eucalyptus grandis [rose gum]
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    125   2e-29   Cicer arietinum [garbanzo]
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    125   3e-29   Glycine max [soybeans]
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             124   5e-29   Phaseolus vulgaris [French bean]
gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               120   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    124   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    124   9e-29   
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    123   1e-28   
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   123   1e-28   Glycine soja [wild soybean]
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    123   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    123   1e-28   Glycine max [soybeans]
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    123   1e-28   Pisum sativum [garden pea]
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    122   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             122   3e-28   
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    122   3e-28   Populus euphratica
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    121   5e-28   Medicago truncatula
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    120   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             120   2e-27   Phaseolus vulgaris [French bean]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    119   3e-27   Malus domestica [apple tree]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    119   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    119   5e-27   Nelumbo nucifera [Indian lotus]
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          118   8e-27   Medicago truncatula
ref|XP_008778670.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    111   1e-26   Phoenix dactylifera
ref|XP_002865831.1|  heat shock protein 93-V                            117   1e-26   
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    117   1e-26   Populus euphratica
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    117   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    117   2e-26   Glycine max [soybeans]
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    116   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    115   6e-26   Brassica rapa
emb|CDX83052.1|  BnaA01g20520D                                          115   6e-26   
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             115   7e-26   Capsella rubella
gb|AAC04687.1|  ClpC                                                    115   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    114   2e-25   
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    114   2e-25   Elaeis guineensis
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   114   2e-25   Glycine soja [wild soybean]
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    114   3e-25   Glycine max [soybeans]
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    114   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    114   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    113   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_002877635.1|  AtClpC                                             113   3e-25   
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    113   5e-25   
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             112   5e-25   
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    112   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    112   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             112   7e-25   
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                112   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    111   2e-24   Cicer arietinum [garbanzo]
emb|CDX68504.1|  BnaC01g25820D                                          111   2e-24   
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    110   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    110   4e-24   Sesamum indicum [beniseed]
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    109   8e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    108   2e-23   Phoenix dactylifera
emb|CDY45800.1|  BnaC03g16230D                                          107   3e-23   Brassica napus [oilseed rape]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    107   3e-23   Brassica rapa
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    107   4e-23   Phoenix dactylifera
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    106   8e-23   
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    105   2e-22   Citrus sinensis [apfelsine]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    104   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    104   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    104   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_566912.2|  Clp ATPase                                            103   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190035.1|  Clp ATPase                                         103   7e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87915.1|  AtClpC                                                 103   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             103   1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    102   3e-21   Elaeis guineensis
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    101   5e-21   Elaeis guineensis
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...  99.0    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05878.1|  BnaC08g20550D                                        97.8    8e-20   
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...  97.8    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA38057.1|  TPA: hypothetical protein ZEAMMB73_563254            90.9    5e-19   
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...  93.2    3e-18   Brachypodium distachyon [annual false brome]
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...  93.2    3e-18   Brassica napus [oilseed rape]
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...  93.2    3e-18   Brachypodium distachyon [annual false brome]
emb|CAN78847.1|  hypothetical protein VITISV_010724                   92.4    6e-18   Vitis vinifera
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...  89.4    1e-17   Triticum urartu
ref|XP_006436943.1|  hypothetical protein CICLE_v10033976mg           85.1    3e-17   
gb|KDO51290.1|  hypothetical protein CISIN_1g003094mg                 90.1    3e-17   Citrus sinensis [apfelsine]
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...  89.7    4e-17   Setaria italica
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...  89.7    5e-17   Setaria italica
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...  89.4    6e-17   Triticum urartu
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...  89.4    6e-17   Zea mays [maize]
gb|EMS48250.1|  ATP-dependent Clp protease ATP-binding subunit cl...  85.9    7e-17   Triticum urartu
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...  88.2    7e-17   
gb|KGN63436.1|  hypothetical protein Csa_1G000600                     89.0    8e-17   Cucumis sativus [cucumbers]
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590        87.4    2e-16   Sorghum bicolor [broomcorn]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...  87.4    2e-16   Brachypodium distachyon [annual false brome]
dbj|BAJ99801.1|  predicted protein                                    87.0    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...  86.7    5e-16   Oryza brachyantha
gb|EEC77204.1|  hypothetical protein OsI_15716                        86.7    5e-16   Oryza sativa Indica Group [Indian rice]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                        86.7    5e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05148.2|  OSJNBa0039C07.4                                      86.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...  86.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...  85.9    8e-16   
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...  85.9    1e-15   Setaria italica
ref|NP_001169540.1|  uncharacterized protein LOC100383416             85.5    1e-15   Zea mays [maize]
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360           79.0    2e-15   Chlamydomonas reinhardtii
ref|WP_032555672.1|  hypothetical protein                             77.8    2e-15   
ref|WP_032554674.1|  hypothetical protein                             78.2    3e-15   
ref|NP_001066442.1|  Os12g0230100                                     84.3    3e-15   
ref|WP_032558761.1|  hypothetical protein                             78.2    4e-15   
gb|EEC69045.1|  hypothetical protein OsI_37876                        84.0    5e-15   Oryza sativa Indica Group [Indian rice]
ref|WP_032553896.1|  hypothetical protein                             78.2    5e-15   
ref|XP_001756645.1|  predicted protein                                83.6    6e-15   
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC   80.1    1e-14   Monoraphidium neglectum
ref|XP_001779162.1|  predicted protein                                82.4    1e-14   
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012           82.0    2e-14   
gb|AAB67745.1|  ClpC                                                  81.6    2e-14   Synechococcus elongatus PCC 7942
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC   81.6    2e-14   Synechococcus elongatus PCC 6301
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431            81.6    3e-14   Volvox carteri f. nagariensis
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                  81.3    3e-14   Nostoc sp. PCC 7120
gb|EDZ93048.1|  Clp domain protein                                    79.7    3e-14   Arthrospira maxima CS-328
gb|AFW96628.1|  ATP-dependent Clp family protein                      81.3    3e-14   Anabaena sp. 90
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit   81.3    3e-14   Nostoc sp. PCC 7524
gb|EHC12174.1|  ATPase AAA-2 domain protein                           81.3    3e-14   Fischerella thermalis
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC   80.9    4e-14   Monoraphidium neglectum
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163           80.5    5e-14   Selaginella moellendorffii
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...  80.1    7e-14   Chamaesiphon minutus
gb|ABK95905.1|  unknown                                               80.1    7e-14   Populus trichocarpa [western balsam poplar]
emb|CDX84888.1|  BnaA03g13420D                                        80.1    7e-14   
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g           80.1    7e-14   
gb|EEE52971.1|  hypothetical protein OsJ_35634                        80.1    8e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...  80.1    8e-14   
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC    79.7    9e-14   Ulva fasciata
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein   79.7    9e-14   Nostoc punctiforme
ref|WP_029638478.1|  Clp protease ClpX [                              79.7    9e-14   [Scytonema hofmanni] UTEX B 1581
ref|WP_015111477.1|  ATPase                                           79.7    9e-14   Nostoc sp. PCC 7107
ref|WP_028951828.1|  Clp protease ClpX                                79.7    9e-14   Synechococcus sp. CC9616
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein   79.7    9e-14   Trichormus azollae
ref|WP_039740335.1|  Clp protease ClpX                                79.7    9e-14   
ref|WP_041555480.1|  Clp protease ClpX                                79.7    1e-13   Nostoc sp. PCC 7524
ref|WP_038544339.1|  Clp protease ClpX                                79.7    1e-13   Synechococcus sp. KORDI-100
ref|WP_041458572.1|  Clp protease ClpX                                79.7    1e-13   Anabaena sp. 90
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...  79.7    1e-13   Richelia intracellularis
gb|KIE07407.1|  Clp protease ClpX                                     79.7    1e-13   Tolypothrix bouteillei VB521301
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. RS9917
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...  79.7    1e-13   Richelia intracellularis
ref|WP_028090149.1|  Clp protease ClpX                                79.7    1e-13   Dolichospermum circinale
ref|WP_027404746.1|  Clp protease ClpX                                79.7    1e-13   Aphanizomenon flos-aquae
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Cyanothece sp. PCC 7425
ref|WP_028082153.1|  Clp protease ClpX                                79.7    1e-13   Dolichospermum circinale
ref|WP_023174246.1|  ATPase AAA-2 domain protein                      79.7    1e-13   Gloeobacter kilaueensis
ref|WP_039200429.1|  Clp protease ClpX                                79.7    1e-13   Aphanizomenon flos-aquae
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Aphanizomenonaceae
ref|WP_035153450.1|  Clp protease ClpX                                79.7    1e-13   Calothrix sp. 336/3
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.7    1e-13   Synechococcus
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Anabaena sp. PCC 7108
ref|WP_042153862.1|  Clp protease ClpX                                79.7    1e-13   Planktothrix agardhii
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                  79.7    1e-13   Planktothrix
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Calothrix sp. PCC 7103
ref|WP_009626822.1|  ATPase AAA-2 domain protein                      79.7    1e-13   Pseudanabaena biceps
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Fortiea contorta
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Trichormus variabilis
ref|WP_015227883.1|  chaperone ATPase                                 79.7    1e-13   Dactylococcopsis salina
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Nodularia spumigena
ref|WP_041677108.1|  Clp protease ClpX                                79.7    1e-13   Synechococcus elongatus
gb|AGW80480.1|  Clp protease ATP binding subunit                      79.7    1e-13   Planktothrix agardhii NIVA-CYA 68
ref|WP_027842712.1|  Clp protease ClpX                                79.7    1e-13   Mastigocoleus testarum
ref|WP_044521582.1|  Clp protease ClpX                                79.7    1e-13   Nostocaceae
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Aphanizomenonaceae
ref|WP_037222416.1|  Clp protease ClpX                                79.7    1e-13   
ref|WP_015128787.1|  ATPase                                           79.7    1e-13   Calothrix sp. PCC 7507
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus
ref|WP_015216290.1|  ATPase AAA-2 domain protein                      79.7    1e-13   Anabaena cylindrica
ref|WP_015107874.1|  chaperone ATPase                                 79.7    1e-13   Cyanobium gracile
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. CB0205
ref|WP_027250152.1|  Clp protease ClpX                                79.7    1e-13   Planktothrix agardhii
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                  79.7    1e-13   Planktothrix
gb|KIJ80614.1|  Clp protease ClpX                                     79.7    1e-13   Scytonema tolypothrichoides VB-61278
ref|WP_041035515.1|  Clp protease ClpX                                79.7    1e-13   Tolypothrix campylonemoides
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...  79.7    1e-13   Cylindrospermum stagnale
ref|WP_036000319.1|  Clp protease ClpX                                79.7    1e-13   [Leptolyngbya] sp. JSC-1
ref|WP_015189078.1|  ATPase AAA-2 domain protein                      79.7    1e-13   Gloeocapsa sp. PCC 7428
ref|WP_041428551.1|  Clp protease ClpX                                79.7    1e-13   Synechococcus sp. WH 7803
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Oscillatoria sp. PCC 10802
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Prochlorothrix hollandica
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. RS9916
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Mastigocladopsis repens
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. WH 8016
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. WH 5701
ref|WP_038554285.1|  Clp protease ClpX                                79.7    1e-13   Synechococcus sp. KORDI-52
ref|WP_015166859.1|  chaperone ATPase                                 79.7    1e-13   Synechococcus sp. PCC 7502
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein   79.7    1e-13   Leptolyngbya sp. Heron Island J
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Scytonema hofmannii
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. PCC 7335
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...  79.7    1e-13   Rubidibacter lacunae
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Gloeobacter violaceus
ref|WP_015117004.1|  chaperone ATPase                                 79.7    1e-13   Rivularia sp. PCC 7116
ref|WP_015170572.1|  ATPase                                           79.7    1e-13   Geitlerinema sp. PCC 7407
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...  79.7    1e-13   Oscillatoriales cyanobacterium JSC-12
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. CC9605
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Coleofasciculus chthonoplastes
ref|WP_015126250.1|  chaperone ATPase                                 79.7    1e-13   Synechococcus sp. PCC 6312
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.3    1e-13   Kamptonema
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Synechococcus sp. PCC 7336
ref|WP_039899756.1|  Clp protease ClpX                                79.3    1e-13   Microcystis sp. T1-4
ref|WP_038653496.1|  Clp protease ClpX                                79.7    1e-13   Prochlorococcus sp. MIT 0801
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Prochlorococcus marinus
ref|WP_015225278.1|  ATPase                                           79.3    1e-13   Halothece sp. PCC 7418
ref|WP_015200797.1|  ATPase                                           79.3    1e-13   Calothrix parietina
ref|WP_023066904.1|  istB-like ATP binding family protein             79.3    1e-13   Lyngbya aestuarii
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein   79.7    1e-13   Synechococcus sp. CB0101
ref|WP_015166218.1|  ATPase                                           79.3    1e-13   Pseudanabaena sp. PCC 7367
ref|WP_043691512.1|  Clp protease ClpX                                79.3    1e-13   Synechococcus sp. KORDI-49
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Cyanobium sp. PCC 7001
ref|WP_035989117.1|  Clp protease ClpX                                79.3    1e-13   Leptolyngbya sp. KIOST-1
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   cyanobacterium PCC 7702
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...  79.3    1e-13   Leptolyngbya sp. PCC 6406
gb|AHF63374.1|  ATPase                                                79.3    1e-13   Synechococcus sp. WH 8109
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Trichodesmium erythraeum
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.3    1e-13   Oscillatoriales
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Pseudanabaena sp. PCC 6802
ref|WP_036906575.1|  Clp protease ClpX                                79.3    1e-13   Prochlorococcus marinus
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...  79.3    1e-13   Leptolyngbya sp. PCC 7375
ref|WP_026734190.1|  Clp protease ClpX                                79.3    1e-13   Fischerella sp. PCC 9605
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Lyngbya sp. PCC 8106
ref|WP_015201320.1|  ATPase                                           79.3    1e-13   Crinalium epipsammum
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Chlorogloeopsis fritschii
ref|WP_015185589.1|  chaperone ATPase                                 79.3    1e-13   Microcoleus sp. PCC 7113
ref|WP_026097796.1|  Clp protease ClpX                                79.3    1e-13   Geitlerinema sp. PCC 7105
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                  79.3    1e-13   Fischerella thermalis
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Moorea producens
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Synechococcus sp. WH 7805
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                  79.3    1e-13   Prochlorococcus
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Synechococcus sp. CC9902
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                  79.3    1e-13   Lyngbya confervoides
ref|WP_026086125.1|  Clp protease ClpX                                79.3    1e-13   Fischerella muscicola
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Arthrospira platensis
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   filamentous cyanobacterium ESFC-1
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Synechococcus sp. RCC307
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Prochlorococcus marinus
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   Leptolyngbya boryana
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.3    1e-13   Fischerella
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_028949334.1|  Clp protease ClpX                                79.3    1e-13   
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|YP_001293474.1|  Clp protease ATP binding subunit                 79.3    1e-13   
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_026722984.1|  Clp protease ClpX                                79.3    1e-13   
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...  79.3    1e-13   
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...  79.3    1e-13   
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...  79.3    1e-13   
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein   79.3    1e-13   
ref|WP_015147858.1|  chaperone ATPase                                 79.3    1e-13   
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.3    1e-13   
ref|NP_050661.1|  Clp protease ATP binding subunit                    79.3    1e-13   
ref|WP_036909986.1|  Clp protease ClpX                                79.3    1e-13   
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...  78.6    1e-13   
ref|WP_015219504.1|  ATPase                                           79.3    1e-13   
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  79.3    1e-13   
ref|WP_036902654.1|  Clp protease ClpX                                79.0    2e-13   
ref|XP_007509860.1|  predicted protein                                79.0    2e-13   
ref|WP_032527486.1|  Clp protease ClpX                                78.6    2e-13   
ref|WP_015157369.1|  ATPase                                           78.6    2e-13   
emb|CDY64710.1|  BnaA06g38690D                                        78.6    2e-13   
ref|WP_039713557.1|  Clp protease ClpX                                78.6    2e-13   
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...  78.6    2e-13   
ref|WP_044105586.1|  Clp protease ClpX                                78.6    2e-13   
ref|WP_019474998.1|  hypothetical protein                             78.2    3e-13   
ref|WP_024545676.1|  Clp protease ClpX                                78.2    3e-13   
ref|XP_002505550.1|  predicted protein                                78.6    3e-13   
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...  78.6    3e-13   
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_030006722.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC   78.2    3e-13   
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025932059.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025923359.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032515069.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025935959.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025906631.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025924610.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_015132374.1|  ATPase                                           78.2    3e-13   
ref|WP_025972244.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032522603.1|  Clp protease ClpX                                78.2    3e-13   
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935           76.6    3e-13   
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_025968127.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025965623.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025956785.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025914744.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_042850567.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025961281.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025958425.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025894690.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025970276.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025964345.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025962478.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_025926674.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025955884.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025941830.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032519126.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025954710.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_025893396.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                  78.2    3e-13   
ref|WP_032514205.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_025944115.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025928515.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032524589.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032523561.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025930513.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_029976482.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_025959792.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_032516684.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_036896901.1|  Clp protease ClpX                                78.2    3e-13   
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein   78.2    3e-13   
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein   78.2    4e-13   
ref|WP_040943370.1|  Clp protease ClpX                                77.8    4e-13   
ref|WP_040054326.1|  Clp protease ClpX                                77.8    4e-13   
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  77.8    4e-13   
gb|ADJ57429.1|  clp protease ATP binding subunit                      77.8    4e-13   
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_040939432.1|  Clp protease ClpX                                77.8    4e-13   
ref|WP_036485541.1|  Clp protease ClpX                                77.8    4e-13   
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_015191669.1|  ATPase AAA-2 domain protein                      77.8    4e-13   
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...  77.8    4e-13   
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...  77.8    4e-13   
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein   77.8    4e-13   
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit    77.4    5e-13   
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein   77.4    5e-13   
ref|WP_015145231.1|  chaperone ATPase                                 77.4    5e-13   
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit    77.0    7e-13   
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein   77.0    7e-13   
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                  77.0    7e-13   
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein   77.0    7e-13   
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555            77.0    9e-13   
emb|CEG02027.1|  Clp, N-terminal                                      76.6    1e-12   
ref|XP_001766010.1|  predicted protein                                76.6    1e-12   
ref|WP_025781797.1|  Clp protease ClpX                                76.3    1e-12   
ref|XP_001766888.1|  predicted protein                                76.3    1e-12   
ref|WP_026735736.1|  hypothetical protein                             72.4    1e-12   
gb|AJA71272.1|  HSP100                                                75.9    2e-12   
ref|WP_015223717.1|  ATPase                                           75.9    2e-12   
ref|YP_007947862.1|  Clp protease ATP binding subunit                 75.9    2e-12   
gb|AFC40000.1|  Clp protease ATP binding subunit                      75.9    2e-12   
ref|NP_053942.1|  Clp protease ATP binding subunit                    75.9    2e-12   
gb|AIA21566.1|  Clp protease ATP binding subunit                      75.9    2e-12   
gb|AIA21360.1|  Clp protease ATP binding subunit                      75.9    2e-12   
ref|YP_537014.1|  Clp protease ATP binding subunit                    75.9    2e-12   
ref|YP_009027615.1|  Clp protease ATP binding subunit                 75.9    2e-12   
gb|AJH65889.1|  ATP-dependent Clp protease                            75.9    2e-12   
ref|NP_045112.1|  Clp protease ATP binding subunit                    75.9    2e-12   
ref|YP_007627346.1|  Clp protease ATP binding subunit                 75.5    2e-12   
ref|YP_277337.1|  Clp protease ATP binding subunit                    75.5    2e-12   
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...  75.5    2e-12   
ref|YP_007878188.1|  Clp protease ATP binding subunit                 75.5    2e-12   
ref|YP_063564.1|  Clp protease ATP binding subunit                    75.5    2e-12   
ref|YP_009019572.1|  Clp protease ATP binding subunit                 75.5    2e-12   
gb|AJO68399.1|  Clp protease ATP binding subunit                      75.5    2e-12   
ref|NP_190131.1|  Double Clp-N motif-containing P-loop nucleoside...  73.6    3e-12   
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...  75.1    3e-12   
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                75.1    3e-12   
ref|XP_003063658.1|  predicted protein                                75.1    3e-12   
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...  75.1    3e-12   
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C            75.1    3e-12   
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...  75.1    3e-12   
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type              75.1    3e-12   
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit        74.7    4e-12   
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...  74.3    5e-12   
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...  74.3    6e-12   
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...  74.3    6e-12   
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...  73.9    7e-12   
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...  73.2    2e-11   
ref|YP_005088687.1|  Clp protease ATP binding subunit                 72.8    2e-11   
gb|ABG51946.1|  TPR repeat containing protein                         73.2    2e-11   
ref|YP_008145463.1|  Clp protease ATP binding subunit                 72.8    2e-11   
ref|WP_017285691.1|  hypothetical protein                             69.7    3e-11   
gb|AJH65844.1|  ATP-dependent Clp protease                            71.6    5e-11   
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...  71.6    5e-11   
ref|XP_010318665.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...  68.2    5e-11   
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)        71.2    6e-11   
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein   71.2    6e-11   
ref|YP_007476253.1|  Clp protease ATP binding subunit                 71.2    7e-11   
gb|EFA73792.1|  Probable ATP-dependent Clp protease ATP-binding s...  65.9    1e-10   
ref|YP_009051035.1|  Clp protease ATP binding subunit                 70.5    1e-10   
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...  70.5    1e-10   
ref|YP_003359282.1|  Clp protease ATP binding subunit                 70.1    1e-10   
ref|WP_011142066.1|  endopeptidase Clp ATP-binding chain              68.6    1e-10   
emb|CCI36398.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  70.1    2e-10   
ref|NP_849021.1|  Clp protease ATP binding subunit                    69.7    2e-10   
ref|WP_032525473.1|  hypothetical protein                             64.7    2e-10   
ref|WP_039961643.1|  Clp protease ClpX, partial [                     69.3    2e-10   
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein   69.3    2e-10   
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein   69.3    2e-10   
ref|WP_015178164.1|  ATPase AAA-2 domain protein                      69.3    2e-10   
ref|WP_015197969.1|  Clp domain-containing protein                    68.2    5e-10   
gb|ELS44939.1|  clp amino terminal domain protein                     68.6    5e-10   
emb|CAO87136.1|  unnamed protein product                              68.6    5e-10   
emb|CCI17334.1|  Similar to Q110X8_TRIEI TPR repeat containing pr...  68.2    8e-10   
ref|WP_011321026.1|  ATP-dependent Clp protease ATP-binding protein   67.4    1e-09   
ref|WP_010996127.1|  ATP-dependent Clp protease ATP-binding protein   67.4    1e-09   
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein   67.4    1e-09   
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein   67.0    1e-09   
gb|EMT20629.1|  ATP-dependent Clp protease ATP-binding subunit cl...  66.6    2e-09   
ref|WP_026735213.1|  Clp protease ClpX                                66.6    2e-09   
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein   66.6    2e-09   
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein   66.6    2e-09   
gb|AFZ60359.1|  ATPase AAA-2 domain protein                           66.2    3e-09   
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein   66.2    3e-09   
ref|XP_003576089.1|  PREDICTED: chaperone protein ClpC2, chloropl...  66.2    3e-09   
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding subunit   66.2    3e-09   
ref|WP_017653296.1|  ATP-dependent Clp protease ATP-binding protein   65.9    3e-09   
ref|WP_015126728.1|  ATPase                                           65.9    3e-09   
gb|KIJ85031.1|  Clp protease ClpX                                     65.9    3e-09   
gb|KIE09004.1|  Clp protease ClpX                                     65.9    3e-09   
gb|AFY44720.1|  Clp domain protein                                    65.5    3e-09   
ref|WP_044292615.1|  Clp protease ClpX                                65.9    3e-09   
ref|WP_015137763.1|  chaperone ATPase                                 65.9    3e-09   
ref|WP_041038849.1|  Clp protease ClpX                                65.9    3e-09   
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein   65.9    3e-09   
ref|WP_036533173.1|  Clp protease ClpX                                65.5    4e-09   
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit   65.5    4e-09   
ref|WP_029638259.1|  Clp protease ClpX [                              65.5    4e-09   
ref|WP_027845315.1|  Clp protease ClpX                                65.1    5e-09   
ref|WP_017716489.1|  ATP-dependent Clp protease ATP-binding protein   65.1    6e-09   
ref|WP_015206990.1|  ATPase with chaperone activity, ATP-binding ...  65.1    6e-09   
ref|WP_035148903.1|  Clp protease ClpX                                65.1    6e-09   
ref|WP_006275568.1|  ATP-dependent Clp protease ATP-binding protein   64.7    6e-09   
ref|WP_039752731.1|  Clp protease ClpX                                64.7    7e-09   
ref|WP_012409943.1|  ATP-dependent Clp protease ATP-binding protein   64.7    7e-09   
ref|WP_013321074.1|  Clp domain-containing protein                    64.7    8e-09   
ref|WP_042466185.1|  Clp protease ClpX                                64.7    8e-09   
ref|WP_026723037.1|  Clp protease ClpX                                64.7    8e-09   
ref|WP_013190390.1|  ATP-dependent Clp protease ATP-binding protein   64.7    8e-09   
ref|WP_017310273.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  64.3    9e-09   
dbj|BAK06755.1|  predicted protein                                    64.3    9e-09   
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding subunit   64.3    9e-09   
ref|WP_009453815.1|  MULTISPECIES: ATP-dependent Clp protease ATP...  64.3    9e-09   
gb|EMS45024.1|  ATP-dependent Clp protease ATP-binding subunit cl...  64.3    9e-09   



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 131/157 (83%), Gaps = 4/157 (3%)
 Frame = +1

Query  109  SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  288
             L  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+G
Sbjct  8    DLWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSG  63

Query  289  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  468
            LRG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEAR
Sbjct  64   LRGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEAR  123

Query  469  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  124  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  160



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = +1

Query  112  LGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGL  291
            +  IMAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GL
Sbjct  1    MWSIMARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGL  56

Query  292  RGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARR  471
            RG NA+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARR
Sbjct  57   RGCNAIDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARR  116

Query  472  LGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|AIM41271.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=938

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS V+GE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVSGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RSGQTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVRSGQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 130/152 (86%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ +SGQTLHSKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS VAGE   +F GSGK      R V MLCS+QSPSL+LR F+GLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTTKFNGSGKTN----RTVKMLCSAQSPSLRLRDFSGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RS QTL SKVAAATS RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSEQTLQSKVAAATSVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 130/152 (86%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ QSPS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQSPSIRLTNFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AVDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|AIM41268.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=906

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGERTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RSGQTL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGQTLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST+IPS VAGE   +F GSGK K    R V MLC++QS SL LR FTGLRG N
Sbjct  1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ RSG+TL SKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVRSGETLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLV STNIP LVAG+ +GQ     KG G  +R   M+CS ++P+L++ SF+GLR  N
Sbjct  1    MARVLVHSTNIPGLVAGQRLGQ----SKGSGNARRSTKMMCSLRTPALRISSFSGLRSVN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD MAR GQ L+SKV  A S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMARPGQDLYSKVGVAISSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 126/167 (75%), Gaps = 19/167 (11%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNIPS VAGE   QF GSGK K    + V MLC+ Q PS++L +FTGLRG N
Sbjct  1    MARALVQSTNIPSSVAGEMTRQFSGSGKNK----KTVKMLCNVQPPSIRLTNFTGLRGCN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+DT+ +SGQTLHSKVAAATS RR +G R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   AIDTLVKSGQTLHSKVAAATSVRRPKGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FV---------------gteqillgligegtgiAAKVLKSMGINLKD  579
            FV                  +ILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKILLGLIGEGTGIAAKVLKSMGINLKD  163



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTSRGSASVKRAVKMMATAHSPGLRIRNFSGLRGFN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M RSGQ  HSK+A   S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSGQDFHSKMAITISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTN+P LV+G   GQ     KG GK KR V M+   Q+P L++R F+GLR  N
Sbjct  1    MARVLVQSTNVPGLVSGLKHGQ----SKGSGKSKRAVRMMSCIQAPGLRMRGFSGLRSFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDTM R GQ  +SKVA   S RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTMMRPGQDFYSKVAITRSSRRQKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP +VAG  + Q     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLSQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD MA+ GQ  +SK+  A + RR + SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRRKASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP LV G   G    + +G    KR V M+ ++ SP L++R+F+GLRG N
Sbjct  1    MARVLVQSTNIPGLVGGRKNG---LTTRGSANVKRAVKMMSTAHSPGLRIRNFSGLRGFN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   SLDNMLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = +1

Query  109  SLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTG  288
            S+  +MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+G
Sbjct  44   SVSAVMARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSG  99

Query  289  LRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEAR  468
            LRG NALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEAR
Sbjct  100  LRGANALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEAR  159

Query  469  RLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  160  RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  196



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 117/152 (77%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQSTNIP +VAG  +GQ     KG G  KR V M C+ ++P L++ SF+GLR  N
Sbjct  1    MARVLVQSTNIPGVVAGRRLGQ----SKGSGNAKRTVKMCCTLRAPGLRISSFSGLRSVN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD MA+ GQ  +SK+  A + RR        KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDIMAKPGQDFYSKMGVAITSRRKASRCVP-KAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR +VQSTN+ SLVA    GQFKGSGK K    R V MLCS     L++R F+GLR  N
Sbjct  1    MARAIVQSTNVSSLVAPGRYGQFKGSGKNK----RAVMMLCSLHVAPLRMRGFSGLRTSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD M ++GQ+LHSKVA ATS RRGRGSR   +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDMMVKTGQSLHSKVAIATSSRRGRGSRMAPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 124/154 (81%), Gaps = 5/154 (3%)
 Frame = +1

Query  121  IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  300
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  301  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  477
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  478  HNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  150



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 124/154 (81%), Gaps = 5/154 (3%)
 Frame = +1

Query  121  IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  300
            +MAR LVQSTNI   VAGE  GQF GS K +    R V MLC+ +  S +L +F GLRG 
Sbjct  1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC  56

Query  301  NALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLG  477
            NALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG  116

Query  478  HNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  150



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST+I S VA E  GQF GS K +    R V MLC+ +  S +L SF GLRG N
Sbjct  1    MARALVQSTDILSSVASERAGQFNGSRKNQ----RTVRMLCNVKCSSSRLNSFAGLRGCN  56

Query  304  ALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            ALDT+  +SG+TLHSKVAAAT  RR RG R V KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   ALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 125/155 (81%), Gaps = 7/155 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPS--LVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRG  297
            MAR LVQST+I S   VAGE  GQF GS K +    R V M+C  + PSLKL+SF GLRG
Sbjct  1    MARALVQSTDILSSVAVAGERAGQFNGSRKNQ----RTVRMICDVKFPSLKLKSFVGLRG  56

Query  298  GNALDTM-ARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  474
             NALDT+  +SG+TLHSKVAAAT  RR +G R V KAMFERFTEKAIK IMLAQ+EARRL
Sbjct  57   CNALDTLLVKSGETLHSKVAAATFVRRSQGCRFVPKAMFERFTEKAIKGIMLAQDEARRL  116

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GH+FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  GHDFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C+ Q+P L++R F+GLRG N
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNVQAPGLRIRGFSGLRGAN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD + RSG   HS+VAAA S R G+ SR V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDNLVRSGHDFHSRVAAAISVRGGKASRCVARAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 120/153 (78%), Gaps = 5/153 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQ TNIP LV    +G+   S KG G  KR V M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VGRKSPSSKGSGNSKRAVKMMSSVHSPCMRMRSFSGLRGLN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            +LD M R GQ  HSK+A A S RR  R SR V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKMAIAISSRRVGRASRCVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV STNIP+L  G   G    S + +   +    M+CS++ P+L LR F+GLR  N
Sbjct  1    MARLLVHSTNIPALSHGVKHG---LSQESETSRRTATKMMCSTRPPALTLRGFSGLRNSN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT+ RSGQ  HS+VA + S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRSGQDFHSRVAISMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 118/153 (77%), Gaps = 5/153 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQ TNIP LV    + +   S +G G  KRVV M+ S  SP +++RSF+GLRG N
Sbjct  1    MARVLVQPTNIPGLV----VARKSPSSRGSGNAKRVVKMMSSVHSPGMRMRSFSGLRGLN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            +LD M R GQ  HSKVA A S RRG      V +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SLDNMFRPGQDFHSKVAIAISSRRGGRPSRGVPRAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA++L QS  +P+L++  + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILAQSAIVPTLLSSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD + R GQ  HSKV  + S +RGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRYGQDFHSKVGISISSQRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA+VL QST +P+LV   + G  K S K KG       M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKVLAQSTIVPALVTSRSHGPSKESSKSKG----SAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M R GQ   SKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNMVRFGQDFRSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA++L QS  +P+L+   + G    + K  GK KR   M+CS Q+P L++RSF+GLRG N
Sbjct  1    MAKILSQSAIVPTLLTSRSHG----ASKESGKPKRSAKMMCSLQTPGLRIRSFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD + R GQ  HSKV  + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDNIVRFGQDFHSKVGISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 114/152 (75%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV S N+P+L      GQ + SG  +    +   M+CSS+ P+L LR +TGLR  N
Sbjct  1    MARLLVHSINVPALAPHIKHGQSQESGTSRRTATK---MMCSSRLPALTLRGYTGLRSSN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM RSG   HS+VA   S R+ +  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTMLRSGLDFHSRVAITMSRRQQKAKRFLPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L+QSTNIPSL A +  GQF+ S KG     + V M+ S Q P  ++R+F+G+RGGN
Sbjct  1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDTLGTTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 117/152 (77%), Gaps = 6/152 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA+VL QST +PSLV   + G+        GK KR V M+ S  +P L++ SF+GLRG  
Sbjct  1    MAKVLAQSTIVPSLVTSRSHGR------STGKSKRSVKMMSSLPTPGLRINSFSGLRGST  54

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD M R  Q  HSKVA + S RRGRGSR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   SLDNMVRVDQDFHSKVAISISSRRGRGSRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  146



>gb|EPS63111.1| hypothetical protein M569_11677, partial [Genlisea aurea]
Length=195

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 117/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQ-SPSLKLRSFTGLRGG  300
            MA VLVQST++PS V+   +    G  +   K +R V MLCSS+ +P+  +RSF+G RG 
Sbjct  1    MAGVLVQSTSLPSSVS---LANNGGKLEASTKNRRAVTMLCSSRLAPARTMRSFSGFRGV  57

Query  301  NALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRL  474
            N LD +  +S QTLHSKVA A    R  R +R   +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   NVLDRLVQKSSQTLHSKVAEAAGPSRRGRRTRMAPRAMFERFTEKAIKVIMLAQEEARRL  117

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L+QST IP+  A +  GQF+ SGKGK      V M+ S Q+P  ++R+F+GLRGGN
Sbjct  1    MAGALIQSTTIPASFAYQRNGQFQRSGKGKQG----VKMMASLQAPGYRMRNFSGLRGGN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDT+  + +  +SK+ A  S R+G  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTLGSTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS N+P LV G    Q KGSGK K    R V M+C+S++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLVVGHKQSQHKGSGKSK----RSVKMMCASRTIGLRMPGFSGLRTIN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM R G   H+KV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLDTMLRPGLDFHAKVSMAISSRRARAKRIIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA VL QS N P++V+G+  G       G  K +R V M+ +  +PS+++R F+GLRG N
Sbjct  1    MAGVLAQSRNAPAIVSGQRYG----GSGGSAKSRRSVKMMSALTAPSIRMRGFSGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LDT+  S    HS+VA + S RRG+ SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SLDTLLNSSPDFHSRVANSISFRRGKASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL Q  N+P LVAG    Q K SGK K    R V M+C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQPINVPGLVAGHRQNQHKASGKSK----RSVKMMCAFRTNRLRMPGFSGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  480
             LDTM R G   HSKV+ A S  R   +   + KAMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   HLDTMLRPGLDFHSKVSIAISSSRRARATRCIPKAMFERFTEKAIKVIMLAQEEARRLGH  116

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS N+P LVA    GQ     KG GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSVNVPGLVAEHRHGQ----QKGSGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM R G   HSKV+ ATS R+ R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRQARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS  +P L++G+  GQ KGSGK +    R + M+ S Q P+L++ SF+GLR  N
Sbjct  1    MARVLAQSIGMPGLLSGQRHGQHKGSGKSR----RSLKMMSSLQMPALRMSSFSGLRTVN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD ++RS ++L SK+  +TS RR R  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRSLPSKMLTSTSSRRERAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 8/153 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTN+PS V+      F+GS K K        MLC+S + S ++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVSWANNCPFEGSNKTKAGP----TMLCNSLATSARMRSFSGLRGAN  56

Query  304  ALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            ++D M +   QTL SKV+ +  G++ R      +AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  57   SIDMMLQKNIQTLQSKVSVSRRGKKIRTGA---RAMFERFTEKAIKVIMLAQEEARRLGH  113

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  114  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  146



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 115/152 (76%), Gaps = 7/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTN+ + V G+  GQF+GS +      R   M  +  +PSL LR F+GLR  N
Sbjct  1    MARALVQSTNLSAAV-GQHHGQFRGSNR------RSSIMAYNIPAPSLMLRGFSGLRASN  53

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD+M RS    HSKVAAA S  R + SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   ALDSMLRSHCNFHSKVAAAISIPRAKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  145



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV S NIP++       QF+ S K +    R   M+ SS S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCLRHCQFEESKKRRDSSAR---MMSSSPSQGLVMSGYSGLRSAN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT+ R GQ+ HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGQSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQST IPS+  G  +G             R   M C+ ++P+L++ S+TGLR  N
Sbjct  1    MARNLVQSTYIPSVATGRRLG-----YSKGSGNARRTVMFCTLRAPALRMSSYTGLRSVN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD   +    L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDVSVKPRHDLFSTVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS N+P L+A    GQ     K  GK KR   M+ + ++  L++  F+GLR  N
Sbjct  1    MARVLAQSINVPGLLAEHRHGQ----QKESGKLKRSTKMMSALRTNGLRMSGFSGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM R G   HSKV+ ATS RR R +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFHSKVSIATSSRRARATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS ++P LVAG    Q KGSGK K    R V  +C+ ++  L++  F+GLR  N
Sbjct  1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             L+TM R G   HSKV+ A S RR R  R + +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   HLNTMMRPGLDFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQST IPSLV G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSLVTGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSCYTGLRSVN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD   +  + L S V  A + R  R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRCERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHCQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV S NIP++       Q++ S K +    +   M+CS  S  L +  ++GLR  N
Sbjct  1    MARLLVHSANIPAVAPCPRHRQYEESKKSRASSAK---MMCSLPSRGLVISGYSGLRSAN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 115/155 (74%), Gaps = 6/155 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M+R L QS N+P LVAG    +   + KG  + +R V M+ ++++ S +L S++GLR  N
Sbjct  1    MSRALAQSINVPGLVAGR---RHVNNNKGAARSRRSVRMMFTTRTASPRLSSYSGLRTLN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  474
            +LD+M R GQ  HSKV       R +G   SR V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPGQDFHSKVLTQIGTNRAKGGRGSRCVTKAMFERFTEKAIKVIMLAQEEARRL  117

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R V M+   Q+  L+++SF+GLR  NALD MARSGQ  HSKV    S  +G+G R V KA
Sbjct  30   RCVKMMSGLQASGLRMQSFSGLRSSNALDFMARSGQDFHSKVRLHISSCKGKGCRFVPKA  89

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QS  +P LVA    GQ     KG GK KR   M+ + ++  L++  FTGLR  N
Sbjct  1    MARVLAQSVTVPGLVAEHRHGQ----QKGSGKLKRPAKMMSAVRTNGLRMSGFTGLRTFN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDTM R G    SKV+ ATS RRGR +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDTMLRPGIDFRSKVSIATSARRGRATRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG N 
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRTRRPVKMMCSQLQVSGLRMQGFLGLRGNNV  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+ RS Q  HS+V  A +  +G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGRSRQDFHSRVRQAMNVPKGKASRCVTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQST IPS+  G  +G             R   MLC+ ++P+L++  +TGLR  N
Sbjct  1    MATNLVQSTYIPSVAMGRRLG-----YSKGSGNARRTVMLCTLRAPALRMSGYTGLRSVN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD   +  + L S V  A + RR R SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDISVKPRRDLFSSVKFANTKRRERASRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 113/151 (75%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 113/153 (74%), Gaps = 6/153 (4%)
 Frame = +1

Query  121  IMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGG  300
            IMA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  
Sbjct  29   IMAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRAS  82

Query  301  NALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            NALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGH
Sbjct  83   NALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGH  142

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  143  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  175



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M+RVL QS N+P LVAG        +        R V M+ ++Q+ +++L  F+GLR  N
Sbjct  1    MSRVLAQSINVPGLVAGRR--HVNNNNGSVRSRPRSVRMMYATQTATMRLSGFSGLRPLN  58

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  474
            +LD+M R  Q  HSKV       R RG   SR V +AMFERFTEKAIKVIMLAQEEARRL
Sbjct  59   SLDSMFRPRQDFHSKVLTQIGTNRARGGRGSRCVTRAMFERFTEKAIKVIMLAQEEARRL  118

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GHNFVGTEQILLGLIGEGTGI AKVLKSMGINLKD
Sbjct  119  GHNFVGTEQILLGLIGEGTGIGAKVLKSMGINLKD  153



>ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Phoenix dactylifera]
Length=195

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQS  +PS V     GQ KG+GK +    +   M+ + +S  L+L+ F GLRG N
Sbjct  1    MAGALVQSAILPSQVVSRNRGQLKGAGKTR----KAPKMMGNLRSHPLRLQDFAGLRGAN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISSPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMG+NLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGVNLKD  148



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 113/151 (75%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q   L+++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFLGLRGNNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+ ++ Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKNRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+LV S NIP++       QF+ S K +      V M+ S  S  L +  ++GLR  N
Sbjct  1    MARLLVYSANIPAVAPRLRHCQFEESKKRRDSS---VKMMSSLPSRGLVMSGYSGLRSAN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT+ R G + HSKVA   S R+ +  R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  58   CLDTLLRHGHSFHSKVAITISPRQQKAKRFVPRAMFERFTEKAIKVIMLAQEEARRLGHN  117

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  149



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 112/152 (74%), Gaps = 6/152 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQ TN+ + VAG+  GQ +GSG+   K      ML     PSL LR F+GLR  N
Sbjct  1    MAMALVQLTNLSAAVAGQCHGQLRGSGRNPSK------MLFHVPFPSLLLRGFSGLRASN  54

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD+M RS    HS V AA S  RG+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  55   ALDSMLRSHCNFHSMVTAAISVPRGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  115  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  146



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 8/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVLVQST +P L++G+  G+ KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLVQSTGMPGLLSGQRHGKHKGSGKSK----RSVKMMSTLRMPALRMSSFSGLRTLN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             +D+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PMDSLSRPRHTF----PLNTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L  ST + SL A     ++    +G GK +R V M+ + ++P L+++SF+GLR  N
Sbjct  1    MARLLAHST-VSSLFAS----RWNVQSQGSGKPRRYVKMMYNLEAPGLRIQSFSGLRSSN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +LD +ARSG   HSKV   TS R+G+  R V KAMFERFTEKAIKVIMLAQEEA+RLGHN
Sbjct  56   SLDFIARSGHDFHSKVRLQTSSRKGKACRFVPKAMFERFTEKAIKVIMLAQEEAQRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLK  576
            FVGTEQILLGLIGEGTGIAAKVLKS+GINLK
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGINLK  146



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDDYRKPRRCVKMMYTSQTPVLSIQSFSGLRAAN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A+D +AR      SKV    S R+G+ SR V KAMFERFTEKAIKVIML+QEEARRLGHN
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKSSRCVTKAMFERFTEKAIKVIMLSQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFLGLRGSNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+ ++ Q  HSKV  A +  +G+ SR   KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGKTRQDFHSKVRQAMTVPKGKASRCTTKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 111/150 (74%), Gaps = 5/150 (3%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGNAL  309
            RVL QST  PSL    A  Q     +G G+ +R V M+C   +  L ++ F GLRG NAL
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRGNNAL  60

Query  310  DTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFV  489
            DT+ +S Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNFV
Sbjct  61   DTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNFV  120

Query  490  gteqillgligegtgiAAKVLKSMGINLKD  579
            GTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  GTEQILLGLIGEGTGIAAKVLKSMGINLKD  150



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 110/158 (70%), Gaps = 11/158 (7%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTN+PS V     GQF+GS K K    +   MLC+S S  +++RSF+GLRG N
Sbjct  1    MARALVQSTNLPSSVGFVNNGQFEGSNKTK----KASTMLCNSWSAPVRMRSFSGLRGAN  56

Query  304  ALDTMA-RSGQTLHSKvaaats-----grrgrgsravvKAMFERFTEKAIKVIMLAQEEA  465
            ALD M  RSGQTL SKVAA  S       R            E F  KAIKVIMLAQEEA
Sbjct  57   ALDVMVQRSGQTLQSKVAATNSGKRGRKLRMAXXXXXXXXXXEGFX-KAIKVIMLAQEEA  115

Query  466  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  153



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQS  +P  V      Q KGSGK +    +   M+C+ +S +L+L++F GLRG N
Sbjct  1    MAGALVQSAILPVQVVSRTCEQLKGSGKTR----KAAKMMCNLRSHALRLQAFAGLRGAN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD ++RS Q  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRQDFHSLVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 113/152 (74%), Gaps = 8/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 113/152 (74%), Gaps = 8/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MARVL QST +P L++G   G  KGSGK K    R V M+ + + P+L++ SF+GLR  N
Sbjct  1    MARVLAQSTGMPGLLSGRRHGPHKGSGKTK----RSVKMMSTLRIPALRMSSFSGLRTLN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD+++R   T        T+ RR R  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   PLDSVSRPRHTF----PLTTTSRRERAKRCVPKAMFERFTEKAIKVIMLAQEEARRLGHN  112

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  113  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P LK++ FTGLR  NALD  AR  Q   SKV    S R  +  R V KAMF
Sbjct  31   VKMMFSVQAPVLKIQCFTGLRASNALDFRARPSQDFVSKVNRNISSRNEKARRCVPKAMF  90

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  146



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGSNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+  + Q  HSKV  + +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQSMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M    Q+P L+++ F GLRG N LD + RS Q  HSKV    S RRG+ SR + KAMFER
Sbjct  38   MSSQPQAPGLRIQGFLGLRGQNVLDMLGRSRQDFHSKVRLTMSSRRGKPSRCMPKAMFER  97

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  98   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+CS Q+P LK++SF+GLR  +ALD MAR       K   A S RR + SR V KAMF
Sbjct  56   VKMMCSLQAPVLKIQSFSGLRAPSALDYMARPSPGFLVKFKRAISSRREKASRCVPKAMF  115

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  171



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  130  RVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSS-QSPSLKLRSFTGLRGGNA  306
            RVL QST  PSL    A  Q     +G G+ +R V M+CS  Q    +++ F GLRG NA
Sbjct  6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGSRMQGFMGLRGRNA  60

Query  307  LDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNF  486
            LDT+  + Q  HSKV  A +  +G+ SR  VKAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct  61   LDTLGSTRQDFHSKVRQAMNVPKGKASRCTVKAMFERFTEKAIKVIMLAQEEARRLGHNF  120

Query  487  VgteqillgligegtgiAAKVLKSMGINLKD  579
            VGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  196



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  256  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  435
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  45   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  104

Query  436  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  105  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  256  SPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAI  435
            SP L+++ F GLRG N LDT+ RS Q  HSK+  A +  RG+ +R+   AMFERFTEKAI
Sbjct  52   SPGLRIQGFLGLRGQNVLDTLGRSHQDFHSKIRLAMTSGRGKPTRSTPTAMFERFTEKAI  111

Query  436  KVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  112  KVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  159



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P LKL SF GLR  N LD M R  Q   S    +   R+ +G R V KAMF
Sbjct  81   VKMMYSCQAPVLKLHSFAGLRATNPLDIMGRPRQDWFSMSKLSIPKRKDKGKRCVTKAMF  140

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  141  ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  196



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 113/154 (73%), Gaps = 6/154 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M   L++ TN+PS V     GQ  GS K +    +   MLCS+Q  +++L+SF+GLR  N
Sbjct  1    MTHTLIRPTNLPSSVVLGNNGQLNGSNKAR----KAPTMLCSTQPTAIRLQSFSGLRRAN  56

Query  304  ALDTMA-RSGQTLHSKvaaatsgrrg-rgsravvKAMFERFTEKAIKVIMLAQEEARRLG  477
            +LD M  +   TL SKVAAA +  R  R SR   +AMFERFTEKAIKVIMLAQEEARRLG
Sbjct  57   SLDIMVWQPRHTLQSKVAAAIAPVRQGRKSRMAPRAMFERFTEKAIKVIMLAQEEARRLG  116

Query  478  HNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            HNFVGTEQILLGLIGEG+GIAAKV+KSMGINLKD
Sbjct  117  HNFVGTEQILLGLIGEGSGIAAKVIKSMGINLKD  150



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 110/155 (71%), Gaps = 6/155 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M+R+LV S N+P LV G+  G    + K   K +R V M+ ++ + + ++  F+GLR  N
Sbjct  1    MSRLLVHSLNVPGLVPGQRHGN---NNKVLAKVRRPVKMMFATGTAASRMPGFSGLRTVN  57

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrg---sravvKAMFERFTEKAIKVIMLAQEEARRL  474
            +LD+M R     HSKV       R R    +R V KAMFERFTEKAIKVIMLAQEEARRL
Sbjct  58   SLDSMLRPRLDFHSKVLTQIGTNRARSGRGNRVVPKAMFERFTEKAIKVIMLAQEEARRL  117

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  118  GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L   T  P L  G  +           K +R V M+ +SQ+P L ++SF+GLR  N
Sbjct  1    MARLLANFTARPLLGPGRHV-----QSDEYRKPRRCVKMMYTSQTPVLSIQSFSGLRSAN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrr-grgsravvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            A+D +AR      SKV    S R+         KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   AVDLIARPAHGFFSKVNLQISSRKGKASRCVTTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  408
            V M+ SSQ+P LK++ FTGL+  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSSQAPVLKIQCFTGLKASNALDFRARPSHQDFVSKVNLNISYRMEKARRCVPKAM  90

Query  409  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrg-rgsravvKAMF  411
            MLCS+    L L  FTGLR  NALD M R +GQTL SK+AA  +  +  + +R V +AMF
Sbjct  35   MLCSAHFAPLTLTGFTGLRRANALDMMVRQAGQTLQSKIAAKNTFAKRGKHARMVPRAMF  94

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  95   ERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  150



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMAR-SGQTLHSKvaaatsgrrgrgsravvKAM  408
            V M+ S Q+P LK++ FTGLR  NALD  AR S Q   SKV    S R  +  R V KAM
Sbjct  31   VKMMFSLQAPVLKIQCFTGLRASNALDFRARPSHQDFVSKVNLNISSRIEKARRCVPKAM  90

Query  409  FERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L QS  +P+ V     GQ KGSGK +        M+C+ +   L+L+ F GLRG N
Sbjct  1    MAGALFQSAILPAQVLSRNRGQLKGSGKAR----EAAKMMCNMRLHPLRLQGFAGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD ++RS +  HS V+A  S  + +  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQAKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  232  VAMLCSS--QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            V M+C+    S S +++ F GLRG NALDT+ RS Q+   KV  A +  +G+GSR VVKA
Sbjct  35   VKMMCTQLQVSGSSRMQGFLGLRGNNALDTLGRSRQSFGGKVRHAMNVPKGKGSRGVVKA  94

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  95   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  152



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +1

Query  226  RVVAMLCSS-QSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvK  402
            R V M+C+  Q    +++ F GLRG N LDT+ RS Q+   KV  A +  +G+GSR VVK
Sbjct  33   RSVKMMCTQLQVSGSRMQGFLGLRGNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVK  92

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  93   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  151



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 107/152 (70%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LV+S   P++ +   I       +G  +  R+  M+C+ +   L+L  FTGLR  N
Sbjct  1    MAGTLVKSATFPAVTSRAHI-----QIQGSRRPSRLTLMMCNVRVSPLRLHGFTGLRQLN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALD   +SG+  HS ++A     RGR  R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   ALDFPYKSGKDFHSLISALNPASRGRAKRVVPKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKS+GI+LKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSLGISLKD  147



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 104/153 (68%), Gaps = 6/153 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L  ST+   L +G          +   K +R V M+ +SQ+  L ++SF+GLR  N
Sbjct  1    MARLLANSTSRSLLGSGRDF-----QSEDYRKPRRCVKMMYTSQTSVLSIQSFSGLRASN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARRLGH  480
            ALD +AR       KV    S  R   +   V KAMFERFTEKAIKVIML+QEEARRLGH
Sbjct  56   ALDRVARPSHDFFGKVNLQMSSSRREKASRGVTKAMFERFTEKAIKVIMLSQEEARRLGH  115

Query  481  NFVgteqillgligegtgiAAKVLKSMGINLKD  579
            NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  NFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDT      +  +   ++  G+ GR    VVKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  171



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQS  +P++    A+ + +   +G GK KR   M+C  +  SL+L+ F GLR  +
Sbjct  1    MAGSLVQSAILPTV----AVNRIQSHLRGSGKVKRGSKMMCQPRKHSLRLQGFAGLRRSD  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             ++  +R+ +  HS V+   S  RG+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NVEFSSRNQRDFHSVVSGYISYSRGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQ T +PS +A     Q +GSGK K    R   M+C  Q   L+L  F GLR  +
Sbjct  1    MAGSLVQLTILPSALANRRQSQLRGSGKAK----RGAKMMCQLQMHPLRLPGFAGLRRAD  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             L+  +R+    HS V+   S   G+ SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLEFFSRNRHDFHSLVSVYVSYAWGKASRGVAKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LV S  +PS V   +  Q +GSGK K    R   M+ S +   L+L+SF GLR  +
Sbjct  1    MADSLVHSAILPSAVMTRSQSQLRGSGKAK----RGAKMVRSMRMHPLRLQSFAGLRAAD  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD  +R  Q  HS V+   S  RG+ +R V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDFSSRCQQDFHSVVSRYISNPRGKATRGVPKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  171



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  25   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  84

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  85   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  140



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K   A S  R + SR V KAMF
Sbjct  56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF  115

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  171



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMF  411
            V M+ S  +P L +R+++GLR  +ALD MA       +KV  + S R+G+ SR V KAMF
Sbjct  32   VKMMSSLHAPVLSIRNYSGLRVNSALDLMASRSPDFFAKVNISISSRKGKASRCVPKAMF  91

Query  412  ERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  92   ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQS  +P+ V      Q KGSG+ +G       M+ + +  S++L+ F GLRG N
Sbjct  1    MAGALVQSAVLPAQVLSRNHRQLKGSGRTRG----AAKMMYNMRLHSIRLQGFAGLRGSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LD ++RS +  HS V+A  S  +G+  R V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLDLLSRSRRDFHSVVSAYISAPQGKACRGVPVAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  148



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R+  M+C+ +   L+++ FTGLR  NALD   +SG+  H  ++A +   RGR  R V KA
Sbjct  30   RLALMMCNVRVSPLRMQGFTGLRQLNALDFPYKSGRDFHFLISALSPTARGRAKRVVPKA  89

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            +FERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKS+GI+LKD
Sbjct  90   VFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSLGISLKD  147



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR L +S+ +P  V+G ++  F+GSGK +    +   M+CS +S  L+   FTGL+G N
Sbjct  1    MARPLFKSSVLPDAVSG-SVPLFQGSGKAR----KPANMMCSRRSSQLRFLGFTGLKGSN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             L  ++   +     V+A+ S  +G+ SR V  AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   DLHLVSGPSKDFRLAVSASVSAPKGKASRGVAVAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  229  VVAMLCSSQSPSLKLRSFTGLRGG-NALDTMARSGQTLHSKvaaatsgrrgrgsra-vvK  402
            V  M+ +SQ+  L ++SF+GLR   NALD +AR       KV    S  R   +   V K
Sbjct  32   VKMMMYTSQTSVLSIQSFSGLRASSNALDRVARPSHDFFGKVNLQISSSRKGKASRGVTK  91

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIML+QEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  92   AMFERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  150



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 109/152 (72%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  LVQS  +P+++   +  Q +GSGK K    R   M+C  Q   L+L+ F GLR  +
Sbjct  1    MAGSLVQSAVLPAVIMNRSHSQLQGSGKAK----RGARMICQLQMHPLRLQGFAGLRVAD  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             L + +R  Q  HS V+   +  RGR SR V KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   NLFS-SRHRQDFHSVVSGYITNPRGRPSRLVTKAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  147



>tpg|DAA38057.1| TPA: hypothetical protein ZEAMMB73_563254, partial [Zea mays]
Length=188

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGTLVQSAVVPTVYRSSS-GRFRVRARARTNA----TMVRNMPTRTLTLGGFQGLRQTN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  235  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  414
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA+  +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVASQLARPRGKGSRMVVRAMFE  92

Query  415  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  GGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRL  474
            G N LDT+ RS Q+   KV  A +  +G+GSR VVKAMFERFTEKAIKVIMLAQEEARRL
Sbjct  4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL  63

Query  475  GHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  98



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  235  AMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFE  414
            A +CS ++ ++ L  F GLR  N LDT +   +   S VA   +  RG+GSR VV+AMFE
Sbjct  33   ASVCSMRTQTMTLGGFQGLRRANFLDTRSVVRRDFGSIVAHQLARPRGKGSRMVVRAMFE  92

Query  415  RFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  93   RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 97/152 (64%), Gaps = 30/152 (20%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR LVQSTNI + VA    G+F+GS + K    + V M+C++     + +    +RGG 
Sbjct  1    MARALVQSTNIFASVADGKHGKFQGSERTK----KSVKMMCNAMISIPEWQLLFLVRGGK  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            A   +AR                          AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ASRCVAR--------------------------AMFERFTEKAIKVIMLAQEEARRLGHN  90

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  122



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  247  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  426
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  427  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  142



>ref|XP_006436943.1| hypothetical protein CICLE_v10033976mg [Citrus clementina]
 gb|ESR50183.1| hypothetical protein CICLE_v10033976mg [Citrus clementina]
Length=139

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L Q TN P+LV G    Q     +  G+ +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGRSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDT      +  +   ++  G+ GR    VVKA+FERFTEKA KVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKALFERFTEKAFKVIMLAQEEARRLGHN  116

Query  484  FV  489
            FV
Sbjct  117  FV  118



>gb|KDO51290.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
Length=848

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MAR+L Q TN P+LV G    Q     +  GK +R V M+   Q  + ++ SF+GLR  N
Sbjct  1    MARLLAQLTNAPALVPGGRHFQ----SQNAGKSRRNVKMMSYMQPSASRISSFSGLRRSN  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ALDT      +  +   ++  G+ GR    VVKAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   ALDTFTCDFHSTVAVSLSSRRGKSGRAGGFVVKAMFERFTEKAIKVIMLAQEEARRLGHN  116

Query  484  FVgteqillgligegtgiAAKVLKSMGIN  570
            ++G+E +LLGL+ EG G+AA+VL+++G +
Sbjct  117  YIGSEHLLLGLLREGEGVAARVLENLGAD  145



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            ML S+ + +L L  F GLR  N LDT +   +     VA+  S  RG  SR VV+AMFER
Sbjct  31   MLRSTPTRTLTLGGFQGLRQTNFLDTRSVVKRDFGYIVASQISRPRGSASRGVVRAMFER  90

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M   LVQS  +P++    + G+F+   + +        M+ +  + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPTIYRSNS-GRFRVRARARTN----ATMVRNMPTRTLTLGGFQGLRQTN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVVKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            ML S+ + +L L  F GLR  N LDT +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  30   MLRSTPTRTLTLGGFQGLRQTNFLDTRSVIKRDFGSIVASQISRPRGSGSRMVVRAMFER  89

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  90   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  143



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            M   LVQS  +P++    + G+F+   + +        M+ ++ + +L L  F GLR  N
Sbjct  1    MEGALVQSAIVPAVYRSSS-GRFRVRARARTN----ATMVRNTPTRTLTLGGFQGLRQTN  55

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
             LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  56   FLDTRSVIKRDFGSIVASQIARPRGSASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN  115

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKV+KSMGINLKD
Sbjct  116  FVGTEQILLGLIGEGTGIAAKVMKSMGINLKD  147



>gb|EMS48250.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=241

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R  +ML  S +  +++ +F GLR  ++   +  S     S VA+    RRGR +  V +A
Sbjct  80   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAVRSS--NFRSTVASYRFSRRGRRASFVTRA  137

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKD
Sbjct  138  MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKD  195



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  247  SSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTE  426
            S ++ ++ L  F GLR  N LDT +       S VA+  +  RG+GSR VV+AMFERFTE
Sbjct  32   SMETQTITLGGFQGLRRANFLDTKSVVRHDFGSIVASQLARPRGKGSRMVVRAMFERFTE  91

Query  427  KAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  92   KAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  142



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  316  MARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHNFVgt  495
            M RS Q  HSKVA A S RR + SR V +AMFERFTEKAIKVIMLAQEEARRLGHNFVGT
Sbjct  1    MLRSRQNFHSKVATAISSRRRKASRCVPRAMFERFTEKAIKVIMLAQEEARRLGHNFVGT  60

Query  496  eqillgligegtgiAAKVLKSMGINLKD  579
            EQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  61   EQILLGLIGEGTGIAAKVLKSMGINLKD  88



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +1

Query  262  SLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKV  441
            +L L  F GLR  N LDT +   +   S VA+  +  RG  SR VV+AMFERFTEKAIKV
Sbjct  42   TLTLGGFQGLRQTNFLDTRSVIKRDFVSIVASQIARPRGSASRGVVRAMFERFTEKAIKV  101

Query  442  IMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  102  IMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L+    + S  AG A GQ           +R  +ML  S +  +++ +F GLR  +
Sbjct  1    MAGTLLLPVALGSTFAGRASGQ----RWKSHGTRRPASMLAMSLNRPVRMAAFVGLRSAH  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +    A       S VA+  S RRGR +R V +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SF--TATPASNYRSTVASYRSSRRGRRTRFVTRAMFERFTEKAIKVIMLAQEEARRLGHN  114

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGL+GEGTGIAAKVLKSMGINLKD
Sbjct  115  FVGTEQILLGLVGEGTGIAAKVLKSMGINLKD  146



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R  +ML  S +  +++ +F GLR  ++   M  S     S VA+    RRGR +  V +A
Sbjct  31   RTPSMLAMSLNRPVRMAAFVGLRSVHSFSAMRSS--NFRSTVASYRFSRRGRRASFVTRA  88

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQ+LLGL+GEGTGIAAKVLKSMGINLKD
Sbjct  89   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQVLLGLVGEGTGIAAKVLKSMGINLKD  146



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR  +
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLRSVH  56

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            +   M  S         A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  57   SFSVMPVSN---FRSTVASYRSRRGRRTRFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  145



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  146  MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  205

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  206  FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  259



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  60

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  114



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M+ +  + +L L  F GLR  N LD+ +   +   S VA+  S  RG GSR VV+AMFER
Sbjct  31   MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER  90

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  91   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  144



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFER  417
            M+ +  + +L L  F GLR  N LD+ +   +   + VA+  S  RG  SR VV+AMFER
Sbjct  1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVVKRDFGAIVASQISRHRGSASRGVVRAMFER  60

Query  418  FTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  114



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S RR R SR V +A
Sbjct  31   RPASMLAMSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRRTRRSRFVTRA  89

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  226  RVVAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKA  405
            R  +ML  S S  +K+ +F GLR  ++         +  S VA+  S R+ R SR V +A
Sbjct  31   RPASMLAVSLSRPVKMSAFVGLRSVHSFSVTPTVSNS-RSAVASYRSSRQTRRSRFVTQA  89

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  90   MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  147



>ref|XP_001690745.1| hypothetical protein CHLREDRAFT_110360 [Chlamydomonas reinhardtii]
 gb|EDO95778.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=97

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  58



>ref|WP_032555672.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518A6]
Length=69

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKD  58



>ref|WP_032554674.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_518J7]
Length=91

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKD  58



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 101/152 (66%), Gaps = 7/152 (5%)
 Frame = +1

Query  124  MARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFTGLRGGN  303
            MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F GLR   
Sbjct  1    MAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFVGLR---  53

Query  304  ALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEARRLGHN  483
            ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEARRLGHN
Sbjct  54   SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEARRLGHN  113

Query  484  FVgteqillgligegtgiAAKVLKSMGINLKD  579
            FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  114  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  145



>ref|WP_032558761.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498A3]
Length=100

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKD  58



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = +1

Query  106  GSLGGIMARVLVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLKLRSFT  285
            G L   MA  L+Q   + +  AG   GQ           +R  +ML  S S  +K+ +F 
Sbjct  488  GKLLLTMAGTLLQPVALGTTFAGRVSGQ----RWKSHGTRRPPSMLAMSLSRPVKMAAFV  543

Query  286  GLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIMLAQEEA  465
            GLR   ++ + + +  T      A+   RRGR +R V ++MFERFTEKAIKVIMLAQEEA
Sbjct  544  GLR---SVHSFSVTPVTNFRSTVASYRSRRGRRARFVTRSMFERFTEKAIKVIMLAQEEA  600

Query  466  RRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  601  RRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  638



>ref|WP_032553896.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498J20]
Length=123

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKS+G+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKD  58



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 105/156 (67%), Gaps = 9/156 (6%)
 Frame = +1

Query  136  LVQSTNIPSLVAGEAIGQFkgsgkgkgk-gkRVVAM----LCSSQSPSL-KLRSFTGLRG  297
            +  S  IPS V    +GQF GS K K +   R  +M    +  S S S+ + +SF+G+R 
Sbjct  1    MAHSLTIPS-VGASPVGQFNGSRKSKKQGAARAASMGRRNVDKSASMSVARFQSFSGMRK  59

Query  298  GNALDTMA-RSGQTLHSKvaaatsgrrgrgsra-vvKAMFERFTEKAIKVIMLAQEEARR  471
            G+ +D +  + G+   S VA +T+          V  AMFERFTEKAIKVIMLAQEEARR
Sbjct  60   GSVVDALVVKQGKDFKSVVANSTAVTGHSRPSRGVTTAMFERFTEKAIKVIMLAQEEARR  119

Query  472  LGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            LGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+
Sbjct  120  LGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKE  155



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKD  58



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 101/159 (64%), Gaps = 15/159 (9%)
 Frame = +1

Query  136  LVQSTNIPSLVAGEAIGQFkgsgkgkgkgkRVVAMLCSSQSPSLK---------LRSFTG  288
            +  S  +PS V    +GQ   S K K    R +A   S+   +LK          +SF+G
Sbjct  4    MAHSLTLPS-VGSSLVGQLNDSAKSKR---RTIAQAASTGRKNLKKSASLSVSGFQSFSG  59

Query  289  LRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvK-AMFERFTEKAIKVIMLAQEE  462
            +R  +A+D +  + G+ L S VA + +          V  AMFERFTEKAIKVIMLAQEE
Sbjct  60   MRKASAVDALTVKQGKDLKSVVAKSMAVAGHSRPSRGVTFAMFERFTEKAIKVIMLAQEE  119

Query  463  ARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+
Sbjct  120  ARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKE  158



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +1

Query  271  LRSFTGLRGGNALDTMA-RSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  447
            L+++ G+R  + LD++A R+ +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  21   LQTYVGMRKPSPLDSLATRTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  80

Query  448  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+
Sbjct  81   LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKE  124



>gb|AAB67745.1| ClpC [Synechococcus elongatus PCC 7942]
Length=839

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +1

Query  400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73



>dbj|BAD79443.1| ATP-dependent Clp protease regulatory subunit ClpC [Synechococcus 
elongatus PCC 6301]
Length=839

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/60 (95%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +1

Query  400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  73



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +1

Query  400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            K+MFERFTEKAIKV+MLAQEEARRLGHNFVGTEQ+LLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  73   KSMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQLLLGLIGESTGIAAKVLKSMGVNLKD  132



>dbj|BAB74698.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
Length=839

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  74



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>gb|AFW96628.1| ATP-dependent Clp family protein [Anabaena sp. 90]
Length=838

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  74



>gb|AFY46028.1| ATPase with chaperone activity, ATP-binding subunit [Nostoc sp. 
PCC 7524]
Length=856

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  33   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  91



>gb|EHC12174.1| ATPase AAA-2 domain protein [Fischerella sp. JSC-11]
Length=851

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  29   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  87



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  403  AMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AMFERFTEKAIKV+MLAQEEARRLGHNFVGTEQILLGLIGE TGIAAKVLKSMG+NLKD
Sbjct  78   AMFERFTEKAIKVVMLAQEEARRLGHNFVGTEQILLGLIGESTGIAAKVLKSMGVNLKD  136



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +1

Query  271  LRSFTGLRGGNALDTMARSG-QTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIM  447
            L+++ G+R  + LD++A S  +  +S V++ ++      SR VV AMFERFTEKAIKVIM
Sbjct  57   LQTYVGMRKPSPLDSLATSTCKDWNSVVSSVSTSGGRGASRGVVVAMFERFTEKAIKVIM  116

Query  448  LAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMG+NLK+
Sbjct  117  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKE  160



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMGINLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGINLKD  58



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  58



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  58



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  58



>gb|EEE52971.1| hypothetical protein OsJ_35634 [Oryza sativa Japonica Group]
Length=832

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKD  58



>gb|EMT29575.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4B 
protein, chloroplastic [Aegilops tauschii]
Length=1027

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +1

Query  400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            +AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGI+LKD
Sbjct  224  RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKD  283



>gb|ABR23161.1| ATP-dependent Clp protease regulatory subunit ClpC [Ulva fasciata]
Length=904

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = +1

Query  271  LRSFTGLRGGNALDTMARSGQTLHSKvaaatsgrrgrgsravvKAMFERFTEKAIKVIML  450
            L +FTG R GN +D    +    H  V + TS     G++     MFERFTEKAIKV+ML
Sbjct  28   LSTFTGFRRGNVVDA---ATACPHGAVKSKTSRSSQSGTKKPTTMMFERFTEKAIKVVML  84

Query  451  AQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            AQEE+RRLGHNFVGTEQILLGLIGE TGIAAKVLK MG+NLK+
Sbjct  85   AQEESRRLGHNFVGTEQILLGLIGEATGIAAKVLKQMGVNLKE  127



>ref|WP_012412218.1| ATP-dependent Clp protease ATP-binding protein [Nostoc punctiforme]
 gb|ACC84277.1| ATPase AAA-2 domain protein [Nostoc punctiforme PCC 73102]
Length=822

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_029638478.1| Clp protease ClpX [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015111477.1| ATPase [Nostoc sp. PCC 7107]
 gb|AFY41237.1| ATPase AAA-2 domain protein [Nostoc sp. PCC 7107]
Length=823

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_028951828.1| Clp protease ClpX [Synechococcus sp. CC9616]
Length=856

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_013192942.1| ATP-dependent Clp protease ATP-binding protein [Trichormus azollae]
 gb|ADI65932.1| ATPase AAA-2 domain protein ['Nostoc azollae' 0708]
Length=824

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_039740335.1| Clp protease ClpX [Hassallia byssoidea]
 gb|KIF37306.1| Clp protease ClpX [Hassallia byssoidea VB512170]
Length=822

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_041555480.1| Clp protease ClpX [Nostoc sp. PCC 7524]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_038544339.1| Clp protease ClpX [Synechococcus sp. KORDI-100]
 gb|AII43210.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-100]
Length=862

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_041458572.1| Clp protease ClpX [Anabaena sp. 90]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_008231833.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH66412.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HH01]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>gb|KIE07407.1| Clp protease ClpX [Tolypothrix bouteillei VB521301]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_007100194.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9917]
 gb|EAQ68890.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS9917]
Length=860

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_008226206.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
 emb|CCH64853.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis 
HM01]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_028090149.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_027404746.1| Clp protease ClpX [Aphanizomenon flos-aquae]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_028082153.1| Clp protease ClpX [Dolichospermum circinale]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_023174246.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis]
 gb|AGY59031.1| ATPase AAA-2 domain protein [Gloeobacter kilaueensis JS1]
Length=821

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_039200429.1| Clp protease ClpX [Aphanizomenon flos-aquae]
 gb|KHG42537.1| Clp protease ClpX [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_009342297.1| ATP-dependent Clp protease ATP-binding protein [Raphidiopsis 
brookii]
 gb|EFA73676.1| UvrB/UvrC protein [Raphidiopsis brookii D9]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_035153450.1| Clp protease ClpX [Calothrix sp. 336/3]
 gb|KFB83654.1| Clp protease ClpX [Calothrix sp. 336/3]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011377512.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Synechococcus]
 gb|ABB56292.1| ATPase [Synechococcus elongatus PCC 7942]
 gb|AJD56659.1| Clp protease ClpX [Synechococcus sp. UTEX 2973]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_016952177.1| ATP-dependent Clp protease ATP-binding protein [Anabaena sp. 
PCC 7108]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_019491687.1| ATP-dependent Clp protease ATP-binding protein [Calothrix sp. 
PCC 7103]
Length=826

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_009626822.1| ATPase AAA-2 domain protein [Pseudanabaena biceps]
 gb|ELS33048.1| ATPase AAA-2 domain protein [Pseudanabaena biceps PCC 7429]
Length=829

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017651562.1| ATP-dependent Clp protease ATP-binding protein [Microchaete sp. 
PCC 7126]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011317764.1| ATP-dependent Clp protease ATP-binding protein [Anabaena variabilis]
 gb|ABA20534.1| UvrB/UvrC protein [Anabaena variabilis ATCC 29413]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015227883.1| chaperone ATPase [Dactylococcopsis salina]
 gb|AFZ48870.1| ATPase with chaperone activity, ATP-binding subunit [Dactylococcopsis 
salina PCC 8305]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006198453.1| ATP-dependent Clp protease ATP-binding protein [Nodularia spumigena]
 gb|EAW43399.1| endopeptidase Clp ATP-binding chain [Nodularia spumigena CCY9414]
 gb|AHJ31070.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Nodularia spumigena 
CCY9414]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_041677108.1| Clp protease ClpX [Synechococcus elongatus]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>gb|AGW80480.1| Clp protease ATP binding subunit [Planktothrix agardhii NIVA-CYA 
68]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_027842712.1| Clp protease ClpX [Mastigocoleus testarum]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_044521582.1| Clp protease ClpX [Nostoc sp. PCC 7120]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006277610.1| ATP-dependent Clp protease ATP-binding protein [Cylindrospermopsis 
raciborskii]
 gb|EFA69311.1| UvrB/UvrC protein [Cylindrospermopsis raciborskii CS-505]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_037222416.1| Clp protease ClpX [Richelia intracellularis]
 emb|CDN15062.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Richelia intracellularis]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015128787.1| ATPase [Calothrix sp. PCC 7507]
 gb|AFY32974.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 7507]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011127803.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8102]
 emb|CAE07453.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 8102]
Length=846

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015216290.1| ATPase AAA-2 domain protein [Anabaena cylindrica]
 gb|AFZ59673.1| ATPase AAA-2 domain protein [Anabaena cylindrica PCC 7122]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015107874.1| chaperone ATPase [Cyanobium gracile]
 gb|AFY27415.1| ATPase with chaperone activity, ATP-binding subunit [Cyanobium 
gracile PCC 6307]
Length=849

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_010317861.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0205]
Length=850

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_041035515.1| Clp protease ClpX [Tolypothrix campylonemoides]
 gb|KIJ77734.1| Clp protease ClpX [Tolypothrix campylonemoides VB511288]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015206692.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale]
 gb|AFZ23436.1| ATPase with chaperone activity, ATP-binding subunit [Cylindrospermum 
stagnale PCC 7417]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_036000319.1| Clp protease ClpX [Leptolyngbya sp. JSC-1]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015189078.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31206.1| ATPase AAA-2 domain protein [Gloeocapsa sp. PCC 7428]
Length=825

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_041428551.1| Clp protease ClpX [Synechococcus sp. WH 7803]
Length=857

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017712666.1| ATP-dependent Clp protease ATP-binding protein [Prochlorothrix 
hollandica]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_007098208.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. RS9916]
 gb|EAU74102.1| ATPase [Synechococcus sp. RS9916]
Length=859

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017318713.1| ATP-dependent Clp protease ATP-binding protein [Mastigocladopsis 
repens]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006170858.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 5701]
 gb|EAQ74030.1| endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH 5701]
Length=856

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_038554285.1| Clp protease ClpX [Synechococcus sp. KORDI-52]
 gb|AII49099.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-52]
Length=846

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017741509.1| ATP-dependent Clp protease ATP-binding protein [Scytonema hofmanni]
Length=823

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011142062.1| ATP-dependent Clp protease ATP-binding protein [Gloeobacter violaceus]
 ref|NP_925010.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
 dbj|BAC90005.1| endopeptidase Clp ATP-binding chain [Gloeobacter violaceus PCC 
7421]
Length=819

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015117004.1| chaperone ATPase [Rivularia sp. PCC 7116]
 gb|AFY53426.1| ATPase with chaperone activity, ATP-binding subunit [Rivularia 
sp. PCC 7116]
Length=831

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015170572.1| ATPase [Geitlerinema sp. PCC 7407]
 gb|AFY65004.1| ATPase AAA-2 domain protein [Geitlerinema sp. PCC 7407]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_009555478.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70911.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
Length=822

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011364587.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CC9605]
 gb|ABB35376.1| ATPase [Synechococcus sp. CC9605]
Length=846

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006102932.1| ATP-dependent Clp protease ATP-binding protein [Coleofasciculus 
chthonoplastes]
 gb|EDX73701.1| ATPase, AAA family [Coleofasciculus chthonoplastes PCC 7420]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_007353377.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Kamptonema]
 emb|CBN54150.1| ATPase AAA-2 [ [[Oscillatoria] sp. PCC 6506]
Length=823

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_017324677.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7336]
Length=828

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_038653496.1| Clp protease ClpX [Prochlorococcus sp. MIT 0801]
 gb|AIQ97644.1| ATP-dependent Clp protease [Prochlorococcus sp. MIT 0801]
Length=855

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_011824074.1| ATP-dependent Clp protease ATP-binding protein [Prochlorococcus 
marinus]
 gb|ABM76049.1| ClpC [Prochlorococcus marinus str. NATL1A]
Length=855

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015225278.1| ATPase [Halothece sp. PCC 7418]
 gb|AFZ43401.1| ATPase AAA-2 domain protein [Halothece sp. PCC 7418]
Length=823

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015200797.1| ATPase [Calothrix parietina]
 gb|AFZ04187.1| ATPase AAA-2 domain protein [Calothrix sp. PCC 6303]
Length=823

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_023066904.1| istB-like ATP binding family protein [Lyngbya aestuarii]
 gb|ERT06867.1| istB-like ATP binding family protein [Lyngbya aestuarii BL J]
Length=825

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_010303504.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0101]
Length=853

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_015166218.1| ATPase [Pseudanabaena sp. PCC 7367]
 gb|AFY71262.1| ATPase AAA-2 domain protein [Pseudanabaena sp. PCC 7367]
Length=831

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_043691512.1| Clp protease ClpX [Synechococcus sp. KORDI-49]
 gb|AII45534.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. KORDI-49]
Length=843

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



>ref|WP_006910091.1| ATP-dependent Clp protease ATP-binding protein [Cyanobium sp. 
PCC 7001]
 gb|EDY38192.1| ATPase, AAA family [Cyanobium sp. PCC 7001]
Length=843

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  MFERFTEKAIKVIMLAQEEARRLGHNFVgteqillgligegtgiAAKVLKSMGINLKD  579
            MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTG+AAKVLKSMG+NLKD
Sbjct  1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220