BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS103B11

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       167   2e-44   Nicotiana tomentosiformis
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            166   2e-44   Nicotiana sylvestris
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       164   1e-43   
emb|CDP13516.1|  unnamed protein product                                163   1e-43   Coffea canephora [robusta coffee]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            164   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   2e-42   Citrus sinensis [apfelsine]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     160   2e-42   Eucalyptus grandis [rose gum]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             160   2e-42   Citrus clementina [clementine]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    160   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    160   4e-42   Prunus mume [ume]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   5e-42   Solanum tuberosum [potatoes]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             158   2e-41   Prunus persica
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       158   2e-41   Vitis vinifera
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             157   4e-41   Phaseolus vulgaris [French bean]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       157   4e-41   Cicer arietinum [garbanzo]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   6e-41   
gb|AFT92041.1|  EIN3 binding F-box 1                                    156   6e-41   Malus domestica [apple tree]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   7e-41   Sesamum indicum [beniseed]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   9e-41   Populus euphratica
ref|XP_003588766.1|  Ein3-binding f-box protein                         155   1e-40   Medicago truncatula
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   1e-40   Nicotiana tomentosiformis
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   1e-40   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
ref|XP_002524506.1|  grr1, plant, putative                              155   2e-40   Ricinus communis
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         155   2e-40   Jatropha curcas
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   3e-40   Populus euphratica
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             154   4e-40   
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   4e-40   Sesamum indicum [beniseed]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         154   4e-40   Jatropha curcas
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             154   5e-40   
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             153   9e-40   
ref|XP_002515516.1|  grr1, plant, putative                              153   9e-40   Ricinus communis
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   9e-40   
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       153   1e-39   
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   1e-39   Nicotiana sylvestris
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      153   1e-39   Gossypium arboreum [tree cotton]
gb|KJB65824.1|  hypothetical protein B456_010G114900                    152   1e-39   Gossypium raimondii
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             152   2e-39   Populus trichocarpa [western balsam poplar]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            152   2e-39   Glycine soja [wild soybean]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    152   3e-39   Glycine max [soybeans]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       151   3e-39   Cicer arietinum [garbanzo]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       152   4e-39   
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       151   5e-39   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       151   5e-39   Populus euphratica
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   9e-39   Fragaria vesca subsp. vesca
gb|KJB27084.1|  hypothetical protein B456_004G276800                    150   9e-39   Gossypium raimondii
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      150   1e-38   Gossypium arboreum [tree cotton]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   2e-38   Pyrus x bretschneideri [bai li]
gb|KJB54023.1|  hypothetical protein B456_009G017100                    149   2e-38   Gossypium raimondii
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   2e-38   Solanum lycopersicum
gb|EPS63879.1|  f-box family protein                                    149   2e-38   Genlisea aurea
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   2e-38   Cucumis melo [Oriental melon]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                149   3e-38   Erythranthe guttata [common monkey flower]
ref|XP_002308665.2|  grr1 family protein                                149   3e-38   
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            149   4e-38   Sesamum indicum [beniseed]
gb|KJB07737.1|  hypothetical protein B456_001G042600                    148   4e-38   Gossypium raimondii
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   4e-38   Pyrus x bretschneideri [bai li]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                148   7e-38   Erythranthe guttata [common monkey flower]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    147   8e-38   Gossypium raimondii
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   9e-38   Solanum tuberosum [potatoes]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   1e-37   Glycine max [soybeans]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       148   1e-37   
gb|AFU61111.1|  F-box protein                                           147   1e-37   Capsicum annuum
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             147   1e-37   Phaseolus vulgaris [French bean]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   1e-37   Cucumis sativus [cucumbers]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   1e-37   Cucumis sativus [cucumbers]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            147   2e-37   Cucumis melo [Oriental melon]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    147   2e-37   Gossypium raimondii
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   4e-37   Fragaria vesca subsp. vesca
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             145   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    145   6e-37   
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   144   9e-37   Citrus sinensis [apfelsine]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    145   9e-37   Gossypium raimondii
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       144   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             144   9e-37   
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    145   9e-37   
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       145   1e-36   
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       144   2e-36   Glycine max [soybeans]
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      144   2e-36   Gossypium arboreum [tree cotton]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       144   3e-36   
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   3e-36   
dbj|BAF01819.1|  putative glucose regulated repressor protein           141   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   3e-36   Glycine max [soybeans]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            142   4e-36   Brassica rapa
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   4e-36   Phoenix dactylifera
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            142   5e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  142   7e-36   Cucumis sativus [cucumbers]
gb|ABK25485.1|  unknown                                                 141   7e-36   Picea sitchensis
emb|CDY35358.1|  BnaA04g14890D                                          142   8e-36   Brassica napus [oilseed rape]
dbj|BAH20224.1|  AT2G25490                                              141   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     141   1e-35   Eucalyptus grandis [rose gum]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          141   2e-35   Amborella trichopoda
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             141   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   2e-35   Tarenaya hassleriana [spider flower]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    140   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   3e-35   Eucalyptus grandis [rose gum]
gb|AES73649.2|  EIN3-binding F-box-like protein                         140   4e-35   Medicago truncatula
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   4e-35   Phoenix dactylifera
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            139   7e-35   Camelina sativa [gold-of-pleasure]
gb|ADW83728.1|  EIN3-binding F-box protein 1                            138   7e-35   Musa acuminata AAA Group [Cavendish banana]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    139   7e-35   Glycine max [soybeans]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   1e-34   
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   2e-34   Elaeis guineensis
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       138   2e-34   Solanum tuberosum [potatoes]
gb|KHM99176.1|  EIN3-binding F-box protein 1                            130   3e-34   Glycine soja [wild soybean]
ref|XP_002880682.1|  ein3-binding F box protein 1                       137   3e-34   
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       137   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             137   6e-34   Capsella rubella
gb|KEH32121.1|  EIN3-binding F-box-like protein                         137   8e-34   Medicago truncatula
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            136   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             136   9e-34   Phaseolus vulgaris [French bean]
gb|KEH32122.1|  EIN3-binding F-box-like protein                         137   9e-34   Medicago truncatula
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003609344.1|  Ein3-binding f-box protein                         137   1e-33   
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       136   2e-33   Vitis vinifera
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       135   2e-33   Nicotiana tomentosiformis
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   2e-33   Populus euphratica
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       135   2e-33   Nicotiana sylvestris
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             135   2e-33   Capsella rubella
dbj|BAJ34438.1|  unnamed protein product                                134   3e-33   Eutrema halophilum
gb|EPS63568.1|  ein3-binding f-box protein 3                            134   3e-33   Genlisea aurea
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   Elaeis guineensis
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like       134   4e-33   Tarenaya hassleriana [spider flower]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       134   5e-33   Solanum lycopersicum
ref|XP_010086585.1|  hypothetical protein L484_002248                   134   6e-33   Morus notabilis
gb|KHN07078.1|  EIN3-binding F-box protein 1                            134   7e-33   Glycine soja [wild soybean]
ref|XP_002874252.1|  ein3-binding F box protein 2                       133   7e-33   
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             134   9e-33   Eutrema salsugineum [saltwater cress]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   1e-32   Cucumis melo [Oriental melon]
emb|CDX88173.1|  BnaA06g27640D                                          133   1e-32   
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    132   2e-32   Gossypium raimondii
emb|CDX87090.1|  BnaC09g04050D                                          132   2e-32   
ref|NP_197917.1|  EIN3-binding F-box protein 2                          132   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                132   3e-32   Erythranthe guttata [common monkey flower]
emb|CDX80503.1|  BnaC07g29410D                                          132   4e-32   
gb|AEK81539.1|  EIN3 binding F-box 1                                    131   6e-32   Dianthus caryophyllus [carnation]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       130   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            130   2e-31   Brassica rapa
ref|XP_004170235.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    129   2e-31   
gb|AES91540.2|  EIN3-binding F-box-like protein                         129   3e-31   Medicago truncatula
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   5e-31   Cucumis sativus [cucumbers]
gb|ACB59221.1|  F-box protein                                           129   6e-31   Brassica oleracea
ref|XP_003609343.1|  Ein3-binding f-box protein                         130   7e-31   
emb|CDY19807.1|  BnaA09g04600D                                          127   1e-30   Brassica napus [oilseed rape]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       126   3e-30   Brassica rapa
emb|CAN83761.1|  hypothetical protein VITISV_043743                     126   6e-30   Vitis vinifera
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   1e-29   
gb|ACF81449.1|  unknown                                                 119   2e-29   Zea mays [maize]
ref|XP_002437255.1|  hypothetical protein SORBIDRAFT_10g023670          121   2e-29   
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   4e-29   
ref|XP_003603398.1|  Ein3-binding f-box protein                         122   1e-28   
emb|CBI21043.3|  unnamed protein product                                121   3e-28   Vitis vinifera
ref|NP_001132560.1|  F-box family member                                119   3e-28   
gb|ACR35519.1|  unknown                                                 119   7e-28   Zea mays [maize]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1          119   2e-27   
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   3e-27   Setaria italica
ref|NP_001147557.1|  LOC100281166                                       118   4e-27   Zea mays [maize]
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   4e-27   Setaria italica
ref|NP_001046222.1|  Os02g0200900                                       115   1e-26   
dbj|BAD15849.1|  putative F-box protein                                 116   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870          116   3e-26   Sorghum bicolor [broomcorn]
gb|EAY84905.1|  hypothetical protein OsI_06273                          115   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   4e-26   Oryza brachyantha
dbj|BAD35544.1|  putative F-box protein Fbl2                            115   5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01599.1|  hypothetical protein OsI_23635                          115   6e-26   Oryza sativa Indica Group [Indian rice]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                    114   7e-26   
gb|EMS45959.1|  hypothetical protein TRIUR3_29988                       111   1e-25   Triticum urartu
gb|EMT32544.1|  hypothetical protein F775_30491                         111   2e-25   
emb|CDP10419.1|  unnamed protein product                                111   1e-24   Coffea canephora [robusta coffee]
gb|AFA36487.1|  EIN3-binding F-box protein                              107   2e-24   Lolium perenne [perennial ryegrass]
ref|NP_001145991.1|  uncharacterized protein LOC100279520               110   2e-24   
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1            110   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...    110   3e-24   
ref|NP_001058023.1|  Os06g0605900                                       103   3e-24   
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   4e-24   Brachypodium distachyon [annual false brome]
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                    110   5e-24   
emb|CDX76980.1|  BnaC04g37750D                                          104   2e-22   
dbj|BAJ88579.1|  predicted protein                                      104   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19526.1|  hypothetical protein F775_07091                         102   2e-21   
emb|CAN82790.1|  hypothetical protein VITISV_030601                     102   2e-21   Vitis vinifera
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                       100   3e-21   Triticum urartu
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     93.6    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        92.0    6e-18   
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     92.0    7e-18   Nelumbo nucifera [Indian lotus]
ref|NP_001237471.1|  grr1 protein                                     87.8    2e-16   
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           84.3    2e-15   
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           82.4    1e-14   
emb|CBI28209.3|  unnamed protein product                              81.3    2e-14   Vitis vinifera
ref|XP_001783097.1|  predicted protein                                80.1    6e-14   
ref|XP_001775242.1|  predicted protein                                77.4    5e-13   
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            75.5    2e-12   
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           75.5    2e-12   Phaseolus vulgaris [French bean]
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           75.1    3e-12   Selaginella moellendorffii
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     74.7    4e-12   Elaeis guineensis
gb|AAL67490.1|AF459405_1  putative glucose-induced repressor-like...  68.6    8e-12   Narcissus pseudonarcissus
ref|NP_001172897.1|  Os02g0281150                                     69.7    9e-11   
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.1    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBJ28117.1|  Hypothetical leucine rich repeat calmodulin bind...  70.1    2e-10   Ectocarpus siliculosus
gb|ETE73360.1|  F-box/LRR-repeat protein 7                            67.0    9e-10   Ophiophagus hannah
ref|XP_007426934.1|  PREDICTED: F-box/LRR-repeat protein 7            66.6    1e-09   Python bivittatus
gb|EFA03310.1|  hypothetical protein TcasGA2_TC013252                 66.6    2e-09   
ref|XP_785847.3|  PREDICTED: F-box/LRR-repeat protein 7-like          66.2    2e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009059139.1|  hypothetical protein LOTGIDRAFT_164359           65.5    3e-09   Lottia gigantea
dbj|GAN11538.1|  conserved hypothetical protein                       64.7    7e-09   Mucor ambiguus
ref|XP_007365012.1|  RNI-like protein                                 64.3    8e-09   Dichomitus squalens LYAD-421 SS1
gb|KFB45523.1|  Dsec\GM15616-PA-like protein                          64.3    8e-09   Anopheles sinensis
ref|XP_009032915.1|  hypothetical protein AURANDRAFT_11299            63.2    1e-08   Aureococcus anophagefferens
ref|XP_009592242.1|  PREDICTED: F-box/LRR-repeat protein 2            63.2    2e-08   Nicotiana tomentosiformis
gb|EFX86579.1|  hypothetical protein DAPPUDRAFT_208061                62.8    2e-08   Daphnia pulex
ref|XP_003727308.1|  PREDICTED: protein AMN1 homolog                  61.6    3e-08   Strongylocentrotus purpuratus [purple urchin]
ref|XP_008870641.1|  hypothetical protein H310_07119                  63.2    3e-08   Aphanomyces invadans
ref|XP_001630901.1|  predicted protein                                60.8    3e-08   Nematostella vectensis
gb|KFO34898.1|  F-box/LRR-repeat protein 20                           62.4    4e-08   Fukomys damarensis [Damara mole rat]
gb|EFX60588.1|  hypothetical protein DAPPUDRAFT_71291                 59.3    5e-08   Daphnia pulex
gb|ETN67361.1|  partner of paired                                     62.0    5e-08   Anopheles darlingi [American malaria mosquito]
ref|XP_008107062.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  62.0    5e-08   Anolis carolinensis [Carolina anole]
emb|CDS16257.1|  fbxl20                                               61.6    5e-08   Echinococcus granulosus
emb|CEI94275.1|  hypothetical protein RMCBS344292_08489               61.2    5e-08   Rhizopus microsporus
ref|XP_008107061.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  61.6    5e-08   Anolis carolinensis [Carolina anole]
ref|XP_009173095.1|  hypothetical protein T265_08903                  62.0    5e-08   Opisthorchis viverrini [Southeast Asian liver fluke]
gb|EUB63603.1|  F-box/LRR-repeat protein 2                            62.0    6e-08   Echinococcus granulosus
gb|KFQ73642.1|  F-box/LRR-repeat protein 20                           61.6    6e-08   Phoenicopterus ruber ruber
dbj|GAA54333.1|  F-box and leucine-rich repeat protein 2/20           61.6    7e-08   Clonorchis sinensis [oriental liver fluke]
emb|CDJ03778.1|  fbxl20                                               61.6    7e-08   
ref|XP_004611387.1|  PREDICTED: protein AMN1 homolog                  59.7    7e-08   Sorex araneus [Eurasian shrew]
ref|XP_010243424.1|  PREDICTED: F-box protein At3g58530               61.2    7e-08   Nelumbo nucifera [Indian lotus]
gb|EPB81854.1|  hypothetical protein HMPREF1544_11403                 61.6    8e-08   Mucor circinelloides f. circinelloides 1006PhL
gb|ELT99813.1|  hypothetical protein CAPTEDRAFT_133834                61.2    8e-08   Capitella teleta
gb|EKC18517.1|  F-box/LRR-repeat protein 7                            61.6    8e-08   Crassostrea gigas
ref|XP_011418884.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  61.2    8e-08   Crassostrea gigas
ref|XP_001812041.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    8e-08   Tribolium castaneum [rust-red flour beetle]
ref|XP_008193982.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    9e-08   Tribolium castaneum [rust-red flour beetle]
ref|XP_008193983.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  60.8    9e-08   Tribolium castaneum [rust-red flour beetle]
ref|XP_011418892.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  61.2    1e-07   Crassostrea gigas
ref|XP_011418878.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  61.2    1e-07   Crassostrea gigas
emb|CBJ48439.1|  Hypothetical leucine rich repeat and MORN domain...  61.6    1e-07   Ectocarpus siliculosus
ref|XP_005658145.1|  PREDICTED: F-box/LRR-repeat protein 2-like       59.7    1e-07   
ref|XP_006155945.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  60.5    1e-07   
ref|XP_006155944.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  60.5    1e-07   Tupaia chinensis
ref|XP_001344855.1|  PREDICTED: F-box/LRR-repeat protein 7            60.5    1e-07   Danio rerio [leopard danio]
gb|KFW81651.1|  F-box/LRR-repeat protein 20                           60.5    1e-07   Manacus vitellinus
ref|XP_005619483.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  60.5    1e-07   
ref|XP_009080171.1|  PREDICTED: F-box/LRR-repeat protein 20           60.5    2e-07   Acanthisitta chloris
ref|XP_008922985.1|  PREDICTED: F-box/LRR-repeat protein 20           60.1    2e-07   
ref|XP_793918.2|  PREDICTED: F-box/LRR-repeat protein 20-like         60.1    2e-07   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009575812.1|  PREDICTED: F-box/LRR-repeat protein 20           60.1    2e-07   Fulmarus glacialis
ref|XP_002908196.1|  conserved hypothetical protein                   60.5    2e-07   Phytophthora infestans T30-4
ref|XP_001510661.3|  PREDICTED: protein AMN1 homolog                  58.9    2e-07   
ref|XP_011506568.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  60.1    2e-07   Ceratosolen solmsi marchali
ref|XP_010722901.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.7    2e-07   Meleagris gallopavo [common turkey]
ref|XP_319486.4|  AGAP010289-PA                                       59.7    2e-07   Anopheles gambiae str. PEST
ref|XP_011506576.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.7    2e-07   Ceratosolen solmsi marchali
ref|XP_007422430.1|  PREDICTED: F-box/LRR-repeat protein 20           59.7    2e-07   Python bivittatus
ref|XP_004453997.1|  PREDICTED: F-box/LRR-repeat protein 7-like       60.1    2e-07   
ref|XP_003414736.2|  PREDICTED: F-box/LRR-repeat protein 20           59.7    2e-07   Loxodonta africana [African bush elephant]
ref|XP_010130458.1|  PREDICTED: F-box/LRR-repeat protein 20           59.7    2e-07   Buceros rhinoceros silvestris
gb|KGB33620.1|  F-box/LRR-repeat protein 2                            59.7    2e-07   Schistosoma haematobium
ref|XP_008111533.1|  PREDICTED: F-box/LRR-repeat protein 20           59.7    2e-07   Anolis carolinensis [Carolina anole]
gb|KDR06592.1|  F-box/LRR-repeat protein 7                            60.1    2e-07   Zootermopsis nevadensis
ref|XP_001598990.1|  PREDICTED: F-box/LRR-repeat protein 2-like       58.5    3e-07   
ref|XP_006903146.1|  PREDICTED: F-box/LRR-repeat protein 20-like      59.7    3e-07   
ref|XP_004855098.1|  PREDICTED: protein AMN1 homolog isoform X6       58.2    3e-07   
ref|XP_005073009.1|  PREDICTED: protein AMN1 homolog                  58.5    3e-07   
ref|XP_004855100.1|  PREDICTED: protein AMN1 homolog isoform X8       58.2    3e-07   
ref|XP_010618356.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
gb|KFO87286.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
ref|XP_010189680.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    3e-07   
ref|XP_003213137.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_010722900.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
gb|KFV14114.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
gb|EGW10826.1|  Protein AMN1-like                                     58.2    3e-07   
ref|XP_011220083.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_008946933.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_005031145.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_005595808.1|  PREDICTED: F-box/LRR-repeat protein 2-like       58.2    3e-07   
ref|XP_009633416.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
dbj|BAG53862.1|  unnamed protein product                              59.3    3e-07   
ref|XP_002602530.1|  hypothetical protein BRAFLDRAFT_281976           58.9    3e-07   
ref|XP_009944408.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
gb|KFQ06121.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
ref|XP_009695601.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_006275039.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_004395115.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_008687375.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|NP_116264.2|  F-box/LRR-repeat protein 20 isoform 1               59.3    3e-07   
gb|EFB19926.1|  hypothetical protein PANDA_004954                     59.3    3e-07   
ref|XP_002414639.1|  fbxl20, putative                                 59.3    3e-07   
gb|KFQ40153.1|  F-box/LRR-repeat protein 20                           58.9    3e-07   
tpg|DAA18590.1|  TPA: F-box/LRR-repeat protein 20                     59.3    3e-07   
gb|EOA93203.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
ref|XP_006747015.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
gb|KFQ17114.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
ref|XP_006100835.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_005368353.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_010166270.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_009273124.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_004608784.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_007618499.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
dbj|BAG35499.1|  unnamed protein product                              59.3    3e-07   
ref|XP_008503871.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_007177599.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_005394360.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_006022657.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_009935688.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_005508301.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_005232720.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
ref|XP_001950086.2|  PREDICTED: F-box/LRR-repeat protein 7-like       59.3    3e-07   
ref|XP_006774359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    3e-07   
ref|XP_009968197.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    3e-07   
gb|KFV55236.1|  F-box/LRR-repeat protein 20                           59.3    3e-07   
ref|XP_010080364.1|  PREDICTED: F-box/LRR-repeat protein 20           59.3    4e-07   
ref|XP_006889440.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  59.3    4e-07   
ref|XP_002827704.2|  PREDICTED: F-box/LRR-repeat protein 20           59.3    4e-07   
ref|XP_004434635.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    4e-07   
ref|XP_005394359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    4e-07   
ref|XP_009188752.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.9    4e-07   
ref|XP_001917600.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    4e-07   
ref|XP_004327345.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    4e-07   
gb|KFO97482.1|  F-box/LRR-repeat protein 20                           58.9    4e-07   
ref|XP_008521487.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.9    4e-07   
ref|XP_003278353.2|  PREDICTED: F-box/LRR-repeat protein 20           59.3    4e-07   
dbj|BAF84533.1|  unnamed protein product                              59.3    4e-07   
ref|XP_002719383.2|  PREDICTED: F-box/LRR-repeat protein 20           59.3    4e-07   
ref|XP_005861962.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    4e-07   
ref|XP_004395114.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  59.3    4e-07   
ref|XP_005364687.1|  PREDICTED: protein AMN1 homolog                  58.2    4e-07   
ref|NP_001030268.1|  F-box/LRR-repeat protein 20                      59.3    4e-07   
ref|XP_008011063.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.9    4e-07   
ref|XP_004378080.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.9    4e-07   
ref|XP_004855096.1|  PREDICTED: protein AMN1 homolog isoform X4       57.8    4e-07   
gb|KFP42166.1|  F-box/LRR-repeat protein 20                           58.9    4e-07   
ref|XP_010119165.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  58.9    4e-07   
gb|ERE66582.1|  putative protein AMN1 like protein                    58.2    4e-07   
gb|ELK01573.1|  F-box/LRR-repeat protein 20                           58.9    4e-07   
ref|XP_008329845.1|  PREDICTED: F-box/LRR-repeat protein 2            58.9    4e-07   
ref|XP_009487783.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    4e-07   
ref|XP_007644174.1|  PREDICTED: protein AMN1 homolog isoform X1       58.2    4e-07   
ref|XP_004186202.1|  PREDICTED: LOW QUALITY PROTEIN: F-box and le...  58.9    4e-07   
ref|XP_004855094.1|  PREDICTED: protein AMN1 homolog isoform X2       58.2    4e-07   
gb|ETE70898.1|  F-box/LRR-repeat protein 20                           58.9    4e-07   
ref|XP_005531467.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    5e-07   
gb|EFX66450.1|  hypothetical protein DAPPUDRAFT_302690                58.9    5e-07   
ref|XP_009474114.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    5e-07   
gb|KFV18535.1|  F-box/LRR-repeat protein 20                           58.9    5e-07   
ref|XP_007908058.1|  PREDICTED: F-box/LRR-repeat protein 20           58.9    5e-07   
ref|XP_009985327.1|  PREDICTED: F-box/LRR-repeat protein 20           58.5    5e-07   
ref|XP_007482381.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    5e-07   
gb|AAL75965.1|AF467461_1  PpaA                                        58.5    5e-07   
ref|XP_007482383.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    5e-07   
ref|XP_003536746.1|  PREDICTED: F-box/LRR-repeat protein 7-like       58.5    5e-07   
gb|KHN37361.1|  F-box/LRR-repeat protein 4                            58.5    5e-07   
ref|XP_004074238.1|  PREDICTED: F-box/LRR-repeat protein 2            58.5    5e-07   
ref|XP_004881083.1|  PREDICTED: protein AMN1 homolog                  57.8    5e-07   
emb|CEP12872.1|  hypothetical protein                                 58.9    5e-07   
gb|EGI65879.1|  F-box/LRR-repeat protein 20                           58.5    6e-07   
gb|KFO04049.1|  F-box/LRR-repeat protein 7                            57.8    6e-07   
gb|EZA48578.1|  F-box/LRR-repeat protein                              58.5    6e-07   
ref|XP_007899899.1|  PREDICTED: F-box/LRR-repeat protein 7            58.5    6e-07   
ref|XP_011347997.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
ref|XP_011053675.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
gb|KFP91090.1|  F-box/LRR-repeat protein 7                            57.8    6e-07   
ref|XP_007482382.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
ref|XP_009926758.1|  PREDICTED: F-box/LRR-repeat protein 7            57.8    6e-07   
ref|XP_002940984.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
ref|XP_003768320.1|  PREDICTED: F-box/LRR-repeat protein 20           58.5    6e-07   
ref|XP_004918730.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
ref|XP_004548103.1|  PREDICTED: F-box/LRR-repeat protein 20-like      58.5    6e-07   
ref|XP_001235091.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    6e-07   
ref|XP_003786473.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    7e-07   
ref|XP_003466773.2|  PREDICTED: F-box/LRR-repeat protein 7            58.5    7e-07   
ref|XP_004497244.1|  PREDICTED: F-box/LRR-repeat protein 4-like       58.5    7e-07   
ref|XP_009872260.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    7e-07   
ref|XP_004684312.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    7e-07   
ref|XP_004948637.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.5    7e-07   
ref|XP_009509877.1|  PREDICTED: F-box/LRR-repeat protein 20           58.2    7e-07   
ref|XP_004948638.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    7e-07   
ref|XP_007142754.1|  hypothetical protein PHAVU_007G014200g           58.2    7e-07   
ref|XP_009936860.1|  PREDICTED: F-box/LRR-repeat protein 7-like       57.4    7e-07   
ref|XP_007191583.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  58.2    7e-07   
ref|XP_003968885.1|  PREDICTED: F-box/LRR-repeat protein 20-like      58.2    7e-07   
ref|XP_011053674.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    7e-07   
ref|XP_004455014.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    7e-07   
ref|XP_004604014.1|  PREDICTED: F-box/LRR-repeat protein 2            58.2    7e-07   
ref|XP_009907486.1|  PREDICTED: F-box/LRR-repeat protein 7            58.2    7e-07   
ref|XP_002933169.1|  PREDICTED: F-box/LRR-repeat protein 7            58.2    7e-07   
ref|XP_004707168.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    7e-07   
gb|KFV76563.1|  F-box/LRR-repeat protein 7                            58.2    8e-07   
gb|KFP89734.1|  F-box/LRR-repeat protein 20                           57.8    8e-07   
ref|XP_007486895.1|  PREDICTED: F-box/LRR-repeat protein 7            58.2    8e-07   
gb|AFK44520.1|  unknown                                               58.2    8e-07   
emb|CDS32125.1|  fbxl20                                               58.2    8e-07   
ref|XP_004455013.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    8e-07   
ref|XP_009869314.1|  PREDICTED: F-box/LRR-repeat protein 20           58.2    8e-07   
ref|XP_008481415.1|  PREDICTED: F-box/LRR-repeat protein 7-like       57.4    8e-07   
emb|CEI89059.1|  hypothetical protein RMCBS344292_03432               57.8    8e-07   
ref|XP_004676400.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.8    8e-07   
ref|XP_008288944.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  58.2    9e-07   
ref|XP_007447757.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.8    9e-07   
emb|CAG10004.1|  unnamed protein product                              57.8    9e-07   
ref|XP_008288945.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  58.2    9e-07   
ref|XP_006126276.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  58.2    9e-07   
ref|XP_010135828.1|  PREDICTED: F-box/LRR-repeat protein 7            58.2    9e-07   
ref|XP_006787825.1|  PREDICTED: F-box/LRR-repeat protein 20-like      57.8    9e-07   
ref|XP_006995975.1|  PREDICTED: protein AMN1 homolog isoform X3       57.0    1e-06   
ref|XP_004676399.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.8    1e-06   
ref|XP_006126277.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  57.8    1e-06   
ref|XP_006817466.1|  PREDICTED: protein AMN1 homolog                  55.5    1e-06   
ref|XP_010197160.1|  PREDICTED: F-box/LRR-repeat protein 2            57.4    1e-06   
ref|XP_006995973.1|  PREDICTED: protein AMN1 homolog isoform X1       57.0    1e-06   
ref|XP_006995974.1|  PREDICTED: protein AMN1 homolog isoform X2       57.0    1e-06   
gb|KFO90582.1|  F-box/LRR-repeat protein 7                            57.8    1e-06   
ref|XP_009806846.1|  PREDICTED: F-box/LRR-repeat protein 20           57.8    1e-06   
gb|KFP30490.1|  F-box/LRR-repeat protein 2                            57.4    1e-06   
ref|XP_009081836.1|  PREDICTED: F-box/LRR-repeat protein 2            57.4    1e-06   
ref|XP_002513122.1|  glucose regulated repressor protein, putative    57.8    1e-06   
ref|XP_006027688.1|  PREDICTED: F-box/LRR-repeat protein 7            57.8    1e-06   
ref|XP_009926075.1|  PREDICTED: F-box/LRR-repeat protein 20           57.8    1e-06   
gb|KFP73034.1|  F-box/LRR-repeat protein 2                            57.4    1e-06   
ref|XP_005317386.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.4    1e-06   
ref|XP_011047086.1|  PREDICTED: F-box protein At3g58530               57.4    1e-06   
ref|XP_007125300.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.8    1e-06   
gb|EDM05910.1|  F-box and leucine-rich repeat protein 20, isoform...  57.4    1e-06   
ref|XP_008420120.1|  PREDICTED: F-box/LRR-repeat protein 2            57.8    1e-06   
gb|EDL10763.1|  mCG17791, isoform CRA_c                               55.5    1e-06   
ref|XP_004635333.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.4    1e-06   
ref|XP_003444098.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  57.8    1e-06   
ref|XP_010212900.1|  PREDICTED: F-box/LRR-repeat protein 20           57.8    1e-06   
ref|XP_008571816.1|  PREDICTED: F-box/LRR-repeat protein 20           57.8    1e-06   
ref|XP_010391457.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  57.8    1e-06   
ref|XP_010371270.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.4    1e-06   
ref|XP_003781826.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  57.4    1e-06   
ref|XP_002187503.1|  PREDICTED: F-box/LRR-repeat protein 7            57.8    1e-06   
gb|KFP53526.1|  F-box/LRR-repeat protein 7                            57.8    1e-06   
ref|XP_006737657.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  57.4    1e-06   
ref|XP_010225575.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
dbj|BAG57520.1|  unnamed protein product                              57.4    1e-06   
dbj|BAG50882.1|  unnamed protein product                              57.4    1e-06   
ref|XP_004409032.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 3  57.4    1e-06   
ref|NP_071608.1|  F-box/LRR-repeat protein 20                         57.0    1e-06   
ref|XP_006165306.1|  PREDICTED: F-box/LRR-repeat protein 7            57.8    1e-06   
gb|EMC86979.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_010706793.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  57.4    1e-06   
ref|XP_006117148.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  57.4    1e-06   
ref|XP_005530938.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KFB36222.1|  AGAP003285-PA-like protein                            57.4    1e-06   
ref|XP_004409031.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  57.4    1e-06   
gb|KFZ62696.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_010170806.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_010706792.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  57.8    1e-06   
ref|XP_009698447.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_426048.3|  PREDICTED: F-box/LRR-repeat protein 7 isoform X4    57.4    1e-06   
gb|KGL72338.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_009480179.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_005484356.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_005010776.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KGL92233.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_009286270.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KFV42986.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_006117147.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  57.4    1e-06   
gb|KDP21897.1|  hypothetical protein JCGZ_03035                       57.4    1e-06   
ref|XP_010076187.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KFW83758.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_010569759.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_009882041.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_005153415.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_004675991.1|  PREDICTED: protein AMN1 homolog                  56.2    1e-06   
ref|XP_009970093.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_009512755.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  57.4    1e-06   
gb|EOB07802.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_009470315.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KFQ65474.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
ref|XP_007245724.1|  PREDICTED: F-box/LRR-repeat protein 2            57.4    1e-06   
ref|XP_003555835.1|  PREDICTED: F-box/LRR-repeat protein 2-like       57.4    1e-06   
ref|XP_005301166.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
ref|XP_008633279.1|  PREDICTED: F-box/LRR-repeat protein 20           57.4    1e-06   
gb|KFP77813.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
gb|KFP58344.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   
gb|KHN23111.1|  F-box/LRR-repeat protein 4                            57.4    1e-06   
ref|XP_009678681.1|  PREDICTED: F-box/LRR-repeat protein 7            57.4    1e-06   
gb|KFV10680.1|  F-box/LRR-repeat protein 7                            57.4    1e-06   



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC+NVTDK++SAI +LHG +LE LN++GC  VTDA+L AI++ C +L +LD+SK  
Sbjct  537  MNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCRYVTDATLVAISNNCWLLSELDLSKCG  596

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA+LAG  A+Q +LQILSLSGC + SDK LP+L KLG +L GLNIQ+C GIS   
Sbjct  597  ITDSGIASLAG--AVQLNLQILSLSGCSMLSDKSLPFLQKLGQTLMGLNIQHCNGISSSA  654

Query  362  VDLLVERLWRCDILS  406
            VDLL+E+LWRCDIL+
Sbjct  655  VDLLLEQLWRCDILA  669



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+NVTDK++SAI +LHG +LE LN++GC  VTDA+L AI++ C +L +LD+SK  
Sbjct  537  VNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCKYVTDATLVAISNNCWLLSELDLSKCG  596

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA+LAG  A+Q +LQILSLSGC + S+K LP+L KLG +L GLNIQ+C GIS   
Sbjct  597  ITDSGIASLAG--AVQLNLQILSLSGCSMLSNKSLPFLQKLGQTLMGLNIQHCNGISSSA  654

Query  362  VDLLVERLWRCDILS  406
            VDLL+E+LWRCDIL+
Sbjct  655  VDLLLEQLWRCDILA  669



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD+ +SA+AKLHG TLE+L L+GC  V+D  L AIA+ C +L DLD+SK  
Sbjct  511  VNLSGCINLTDQVVSAMAKLHGRTLEVLILDGCTKVSDLGLLAIAENCQLLSDLDVSKCA  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SDFG+ ALA  S  Q SLQ+LS+SGC L SDKCLP L K+G +L GLN+Q+C  IS R 
Sbjct  571  ISDFGLMALARSS--QLSLQVLSVSGCSLVSDKCLPALKKVGRTLLGLNLQHCTAISTRS  628

Query  362  VDLLVERLWRCDILS  406
            VDLL+E LWRCDIL+
Sbjct  629  VDLLLEELWRCDILA  643



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK  +AIAKLHG TLE LNL+GC CVTDA+L AIA++CS+L +LD+SKSR
Sbjct  408  VNLSGCVNLTDKVTAAIAKLHGCTLEELNLDGCKCVTDATLFAIAEHCSLLSELDVSKSR  467

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G AALAG  A Q  L+ILSLSGC L S++ L  + KLG +L GLNIQ+C G+    
Sbjct  468  ITDAGTAALAG--ADQLCLRILSLSGCNLVSNRGLLSVEKLGQTLMGLNIQHCYGVKSDA  525

Query  362  VDLLVERLWRCDIL  403
            +DLL ERLWRCDIL
Sbjct  526  LDLLAERLWRCDIL  539



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V LSGC+NVTD  + A+AK HG TLE+LNL GCG VTDA L AIAD C VL +LD+SK  
Sbjct  509  VGLSGCVNVTDNVVIALAKYHGGTLEVLNLEGCGKVTDAGLVAIADDCLVLNELDVSKCA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFG+A LA   + Q SLQILSLSGC + SDKCLP+L KLG SL G+N+QNC  IS   
Sbjct  569  ITDFGVATLA--RSKQLSLQILSLSGCSMLSDKCLPFLVKLGQSLMGMNLQNCNSISSSV  626

Query  362  VDLLVERLWRCDILS  406
            +D+LV RL+RCDILS
Sbjct  627  IDMLVGRLFRCDILS  641



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  ++DASL AIAD C +L DLD+SK  
Sbjct  513  VNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASLMAIADNCPLLCDLDVSKCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+DFGIA+LA G+ +  +LQILSLSGC + SDK L  L KLG +L GLN+Q+C  IS   
Sbjct  573  VTDFGIASLAHGNYL--NLQILSLSGCSMVSDKSLGALRKLGQTLLGLNLQHCNAISTNS  630

Query  362  VDLLVERLWRCDILS  406
            VD+LVE+LWRCD+LS
Sbjct  631  VDMLVEQLWRCDVLS  645



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N+SGC N+TDK ISA+A++HG TLE+LNL GC  V + SL AIA+ C +L DLD+S   
Sbjct  503  INVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCA  562

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+DFG+AALA   A Q +LQILSLSGC   S+KCLP L KLG  L GLN+Q+C GIS + 
Sbjct  563  VTDFGVAALA--RADQLNLQILSLSGCTEISEKCLPALRKLGQLLVGLNLQHCSGISKKS  620

Query  362  VDLLVERLWRCDIL  403
            VDLLVE+LWRCDIL
Sbjct  621  VDLLVEQLWRCDIL  634



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  ++DASL AIAD C +L DLD+SK  
Sbjct  513  VNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASLMAIADNCPLLCDLDVSKCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+DFGIA+LA G+ +  +LQILSLSGC + SDK L  L KLG +L GLN+Q+C  IS   
Sbjct  573  VTDFGIASLAHGNYL--NLQILSLSGCSMVSDKSLGALRKLGQTLLGLNLQHCNAISTNS  630

Query  362  VDLLVERLWRCDILS  406
            VD+LVE+LWRCD+LS
Sbjct  631  VDMLVEQLWRCDVLS  645



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N+SGC N+TDK ISA+A++HG TLE+LNL GC  V + SL AIA+ C +L DLD+S   
Sbjct  521  INVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCA  580

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+DFG+AALA   A Q +LQILSLSGC   S+KCLP L KLG  L GLN+Q+C GIS + 
Sbjct  581  VTDFGVAALA--RADQLNLQILSLSGCTEISEKCLPALRKLGQLLVGLNLQHCSGISKKS  638

Query  362  VDLLVERLWRCDIL  403
            VDLLVE+LWRCDIL
Sbjct  639  VDLLVEQLWRCDIL  652



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  ++ +A+LHGETL+LLNL+GC  +TDASL AIA  C VLRDLDISK  
Sbjct  541  VNLSGCMNLTDVVVTTMARLHGETLQLLNLDGCRKITDASLMAIASNCLVLRDLDISKCA  600

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGI AL+  S  Q  LQILSLSGC+  SDK +P+L  +G +L GLN+Q C  IS   
Sbjct  601  ITDFGIVALS--STKQLDLQILSLSGCLHVSDKSMPFLKNMGQNLVGLNLQRCNSISSST  658

Query  362  VDLLVERLWRCDIL  403
            +++LVE LWRCDIL
Sbjct  659  IEILVEHLWRCDIL  672



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG TLE+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  515  VNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCA  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+L  G A Q +LQILS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  575  ITDFGIASL--GHADQLNLQILSVSGCPLVSDKSLPALVKMGQTLHGLNLQHCNAISSST  632

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  633  VDRLVEQLWRCDILS  647



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+NVTDK +S++AKLHG TLE++NL GC  ++DA L AIA  C +L DLD+S+  
Sbjct  498  VNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMISDAGLVAIAGNCPLLSDLDVSRCA  557

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+LA   A Q +LQIL++SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  558  ITDFGIASLA--CADQLNLQILAMSGCPLVSDKSLPALVKMGQTLLGLNLQHCKAISSST  615

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  616  VDRLVEQLWRCDILS  630



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG TLE+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  519  VNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCA  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+L  G A Q +LQILS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  579  ITDFGIASL--GHADQLNLQILSVSGCPLVSDKSLPALVKMGQTLHGLNLQHCNAISSST  636

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  637  VDRLVEQLWRCDILS  651



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+NVTD+++S I +LHG +LE LN++ C  VTDA+L AI++ C +L++LDISK  
Sbjct  537  VNLSGCVNVTDRSVSFITELHGGSLESLNVDECPYVTDATLLAISNNCWLLKELDISKCG  596

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA+LA  S ++ +LQILSLSGC + SDK +P+L KLG +L GLNIQ+C G+S R 
Sbjct  597  ITDSGIASLA--STVRLNLQILSLSGCSMLSDKSVPFLQKLGQTLVGLNIQHCNGVSSRC  654

Query  362  VDLLVERLWRCDILS  406
            VDLL+E+LWRCDILS
Sbjct  655  VDLLLEQLWRCDILS  669



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+NVTDK +S++AKLHG TLE++NL GC  ++DA L AI   C +L DLD+S+  
Sbjct  514  VNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMISDAGLVAITGNCPLLSDLDVSRCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+LA   A Q +LQIL++SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITDFGIASLA--CADQLNLQILAMSGCPLVSDKSLPALVKMGQTLLGLNLQHCKAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+ AIA+ C++L DLD+SK+ 
Sbjct  535  VNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLSDLDVSKTA  594

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D+G+AALA  SA   ++QILSLSGC L S++ +P+L KLG +L GLN+Q C  IS   
Sbjct  595  ITDYGVAALA--SAKHLNVQILSLSGCSLISNQSVPFLRKLGQTLLGLNLQQCNTISSSM  652

Query  362  VDLLVERLWRCDIL  403
            V++LVE+LWRCDIL
Sbjct  653  VNMLVEQLWRCDIL  666



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC NVTDK +S++A LHG TLE LNL+GC  ++DASL AIA+ C++L DLD+SK  
Sbjct  511  VNLSGCTNVTDKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCS  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA   A Q +LQILSLSGC L SD+ LP L K+G +L GLNIQ+C  I+   
Sbjct  571  ITDAGIAALA--HAQQINLQILSLSGCALVSDRSLPALRKVGRTLLGLNIQHCNAINSST  628

Query  362  VDLLVERLWRCDILS  406
            VD+LVE LWRCDILS
Sbjct  629  VDMLVELLWRCDILS  643



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++  LHG TLELLNL GC  +++ASL AIA++C +L DLD+S   
Sbjct  509  VNLSGCVNLTDKVVSSLVNLHGWTLELLNLEGCKNISNASLVAIAEHCQLLSDLDVSMCA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GIA+LA   A Q +LQ+LSLSGC L +D+ LP L KLG++L GLNIQ+C  IS   
Sbjct  569  ISDAGIASLA--HAKQLNLQVLSLSGCTLVTDRSLPALRKLGHTLLGLNIQHCNSISSSA  626

Query  362  VDLLVERLWRCDILS  406
            V++LVE LWRCDILS
Sbjct  627  VEMLVELLWRCDILS  641



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +TDASLA IA+ C  LR+LD+SK  
Sbjct  515  VNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKITDASLATIANNCLFLRELDVSKCA  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KLG +L GLN+Q+C  +S+R 
Sbjct  575  ITDSGLAALS--SADQINLQVLSISGCSEISHKSLPSLKKLGQTLVGLNLQHCTALSYRS  632

Query  362  VDLLVERLWRCDILS  406
            ++LLVE LWRCDIL+
Sbjct  633  IELLVESLWRCDILA  647



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  514  VNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++FGIA+LA   A Q +LQ+LS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITNFGIASLA--HADQLNLQMLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C N+TD+ + A+A+LHGETLELLNL+GC  +TDASLAA+A+ C +L DLD+SK  
Sbjct  515  VNLSDCSNLTDEVVLALARLHGETLELLNLDGCQKITDASLAALAESCPLLNDLDVSKCS  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+ AL+ GS  Q +LQILS SGC + S+KC P L +LG +L GLN+Q+C  IS   
Sbjct  575  ITDTGVVALSHGS--QHNLQILSFSGCSMISNKCRPALEQLGRTLVGLNLQHCNSISSNS  632

Query  362  VDLLVERLWRCDILS  406
            ++LL E LWRCDILS
Sbjct  633  IELLTENLWRCDILS  647



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL AIA+ C  L DLD+SK  
Sbjct  524  VNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCA  583

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIA ++  SA Q +LQ+LSLSGC   S+K LP L K+G +L GLN+QNC  IS   
Sbjct  584  VTDSGIAVMS--SAEQLNLQVLSLSGCSEVSNKSLPCLKKMGRTLVGLNLQNCSSISSST  641

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  642  VELLVESLWRCDILS  656



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++  LHG TLE+LNL GC  +++ASLAAIA++C +L DLD S   
Sbjct  511  VNLSGCVNLTDKVVSSLVNLHGWTLEILNLEGCINISNASLAAIAEHCQLLCDLDFSMCT  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA   A Q +LQILSLSGC L +D+ LP L KLG++L GLNIQ+C  IS   
Sbjct  571  ISDSGITALA--HAKQINLQILSLSGCTLVTDRSLPALRKLGHTLLGLNIQHCNSISSSA  628

Query  362  VDLLVERLWRCDILS  406
            V++LVE LWRCDILS
Sbjct  629  VEMLVEHLWRCDILS  643



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN++GC+N+TD+ + ++A+LH ETLE+LNL+GC  VTDASL AIAD C +L DLD+SK  
Sbjct  514  VNITGCLNLTDEVVLSLARLHSETLEVLNLDGCRKVTDASLVAIADNCPLLNDLDVSKCS  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQILS+SGC + ++K +P L KLG SL GLN+Q+C  IS   
Sbjct  574  ITDSGVAALSHG--VQVNLQILSISGCSMVTNKSVPALKKLGESLVGLNLQHCNAISSSR  631

Query  362  VDLLVERLWRCDILS  406
            V++LVE LWRCDILS
Sbjct  632  VEILVEDLWRCDILS  646



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  ++ +AK HG TL+LLNL+GC  +TDASL AIA+ CSVLRDLDISK  
Sbjct  539  VNLSGCLNLTDAVVTTMAKHHGGTLQLLNLDGCRKITDASLIAIANNCSVLRDLDISKCV  598

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AA++  SA    LQILSLSGC   SDK +P+L  LG +L GLN+Q C  IS   
Sbjct  599  ITDLGVAAMS--SANLLDLQILSLSGCYQVSDKSMPFLKSLGQNLVGLNLQQCNSISSST  656

Query  362  VDLLVERLWRCDILS  406
            ++LL+E LWRCDILS
Sbjct  657  IELLMEHLWRCDILS  671



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG TL+ +NL GC  V+DA LAAIA  C++L DLD+SK  
Sbjct  514  VNLSGCVNLTDKVVSSLADLHGWTLKAVNLEGCRRVSDAGLAAIAGNCTLLSDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+LA   A Q +LQILS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITDFGIASLA--HADQLNLQILSVSGCPLVSDKSLPALVKIGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG TLE++NL+GC  V+DA LAAIA  C++L DLD+SK  
Sbjct  514  VNLSGCVNLTDKVVSSLADLHGWTLEVVNLDGCRRVSDAGLAAIAGNCTLLSDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+LA   A   +LQILS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITDFGIASLA--HADLLNLQILSVSGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  514  VNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  514  VNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  574  ITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  632  VDRLVEQLWRCDILS  646



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  562  VNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA  621

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  622  ITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  679

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  680  VDRLVEQLWRCDILS  694



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA LAAIA  C++L DLD+S+  
Sbjct  562  VNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCA  621

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+G +L GLN+Q+C  IS   
Sbjct  622  ITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSST  679

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  680  VDRLVEQLWRCDILS  694



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ ISA+A++HG +LELLNL+GC  +TDASL AI   C  L DLD+SK  
Sbjct  516  VNLSGCMNLTDEVISALARIHGGSLELLNLDGCRKITDASLKAITHNCLFLSDLDVSKCA  575

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIA L+  SA + +LQ+LSLSGC   S+K  P+L KLG +L GLN+QNC  IS   
Sbjct  576  VTDSGIATLS--SADRLNLQVLSLSGCSEVSNKSFPFLKKLGRTLMGLNLQNCSSISSNT  633

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  634  VELLVESLWRCDILS  648



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD+ +S +A+LHG TLELLNL+GC  +TD+S+AAIA  C  L DLD+SK  
Sbjct  519  VNLSGCMSLTDEVVSVLARLHGGTLELLNLDGCRKITDSSVAAIARGCLFLSDLDLSKCA  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIA LA  SA Q +LQ+LSLSGC   S+K  P+L KLG +L GLN+Q+C  IS   
Sbjct  579  VTDSGIAVLA--SADQLNLQVLSLSGCSEVSNKSFPFLKKLGRTLLGLNLQHCSAISSST  636

Query  362  VDLLVERLWRCDILS  406
            VDLLVE LWRCDILS
Sbjct  637  VDLLVENLWRCDILS  651



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL AIA+ C  L DLD+SK  
Sbjct  523  VNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCA  582

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GI  L+  SA Q +LQ+LSLSGC   S+K LP L K+G +L GLN+QNC  IS   
Sbjct  583  VTDSGITMLS--SAEQLNLQVLSLSGCSEVSNKILPCLKKMGRTLVGLNLQNCCSISSST  640

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  641  VELLVESLWRCDILS  655



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL AIA+ C  L DLD+SK  
Sbjct  500  VNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCA  559

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GI  L+  SA Q +LQ+LSLSGC   S+K LP L K+G +L GLN+QNC  IS   
Sbjct  560  VTDSGITILS--SAEQLNLQVLSLSGCSEVSNKILPCLKKMGRTLVGLNLQNCSSISSST  617

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  618  VELLVESLWRCDILS  632



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  ++ I KLHG TLE+LNL+GC C+TD SL AIA  CS+L +LD+S+ R
Sbjct  537  VNLSGCVNLTDNLVAEITKLHGGTLEILNLDGCRCITDVSLKAIARNCSLLSELDVSQCR  596

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LAG  A Q  L++LS++GC L SDK LP+L  +G SL GLNIQ+C GIS   
Sbjct  597  ITDSGIAILAG--AEQLFLRVLSVAGCSLVSDKSLPFLALVGKSLVGLNIQHCCGISCGT  654

Query  362  VDLLVERLWRCDILS  406
            V+ L+E LWRCDILS
Sbjct  655  VNQLLEHLWRCDILS  669



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +SA+ + HG TLE+LNL+GCG +TD SL AIA+ C +L DLD+SK  
Sbjct  513  VNLSGCVNLTDKVVSALTEQHGWTLEVLNLDGCGKITDESLTAIAENCLMLSDLDVSKCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+  LA   + Q +LQI S++GC + SDK LP + K+G++L GLNIQ+C  IS   
Sbjct  573  ISDSGLMVLA--RSNQLNLQIFSVAGCSMISDKSLPAIVKMGHTLLGLNIQHCNAISSST  630

Query  362  VDLLVERLWRCDILS  406
            VDLLVERLWRCDILS
Sbjct  631  VDLLVERLWRCDILS  645



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL AIA+ C  L DLD+SK  
Sbjct  524  VNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCA  583

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIA ++  SA Q +LQ+LSLSGC   S+K LP L K+G +L GLN+Q C  IS   
Sbjct  584  VTDSGIAVMS--SAEQLNLQVLSLSGCSEVSNKSLPCLKKMGRTLVGLNLQKCSSISSST  641

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  642  VELLVESLWRCDILS  656



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N+TD+ + A+A+LHGETLE+L+L+GC  +TDASLAAIAD C  LR+LD+SK  
Sbjct  480  VNLNGCLNLTDEVVVALARLHGETLEVLSLDGCRKITDASLAAIADNCLFLRELDVSKCA  539

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A LA   A + +LQ+LS+SGC   S K L  L KLG +L GLN+QNC  IS+R 
Sbjct  540  ITDSGLAFLA--CADRINLQVLSISGCSEISHKSLSSLKKLGKTLVGLNLQNCTAISNRS  597

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDIL+
Sbjct  598  VELLVESLWRCDILA  612



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +SA+ + HG TLE+LNL GC  +TDASLAAIA+ C +L +LD+SKS 
Sbjct  519  VNLSGCLNLSDKAVSALTEQHGWTLEVLNLEGCEKITDASLAAIAENCFLLSELDVSKSA  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+  LA   + Q +LQI S SGC + SD+ LP L KLG +L GLN+Q+C  IS   
Sbjct  579  ISDSGLMVLA--RSKQLNLQIFSASGCSMISDRSLPALVKLGQTLLGLNLQHCNAISTSA  636

Query  362  VDLLVERLWRCDILS  406
            +DLLVERLWRCDILS
Sbjct  637  IDLLVERLWRCDILS  651



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N+TDK + ++  LHGETLE+LNL+GC  +TDASL AIA+ C  LR+LD+SK  
Sbjct  515  VNLNGCLNLTDKXVVSLVSLHGETLEVLNLDGCRKITDASLVAIANNCLFLRELDVSKCA  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KLG +L GLN+Q+C  IS+R 
Sbjct  575  ITDSGLAALS--SAEQINLQVLSISGCSEISHKSLPSLKKLGXTLMGLNLQHCTAISNRS  632

Query  362  VDLLVERLWRCDILS  406
            ++LLV+ LWRCDIL+
Sbjct  633  IELLVDSLWRCDILA  647



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+NVTD+++S I +LHG +LE LN++ C  VTD +L AI++ C +L++LD+SK  
Sbjct  533  VNLSGCVNVTDRSVSFITELHGGSLESLNVDECRYVTDMTLLAISNNCWLLKELDVSKCG  592

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A+LA  S ++ +LQILSLSGC + SDK +P+L KLG +L GLNIQ+C G+S   
Sbjct  593  ITDSGVASLA--STVRLNLQILSLSGCSMLSDKSVPFLQKLGQTLMGLNIQHCNGVSSSC  650

Query  362  VDLLVERLWRCDILS  406
            VDLL+E+LWRCDILS
Sbjct  651  VDLLLEQLWRCDILS  665



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+ C+N+TD+ + ++A+LHGETLELLNL+GC  VTDASL AIA+ C +L DLD+SK  
Sbjct  513  VNLTDCLNLTDEVVLSLARLHGETLELLNLDGCRKVTDASLVAIANNCPLLNDLDVSKCS  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQILS+SGC + + K +P L KLG SL GLN+Q+C  IS   
Sbjct  573  ITDSGVAALSHG--VQVNLQILSISGCSMVTKKSVPSLIKLGESLVGLNLQHCNAISSSR  630

Query  362  VDLLVERLWRCDILS  406
            V+++VE LWRCDILS
Sbjct  631  VEIIVEDLWRCDILS  645



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +  I+ LHG TLELLNLNGC  ++DASL AI + C +L DLDISK  
Sbjct  520  VNLSGCVNLSDKVVQTISNLHGWTLELLNLNGCK-ISDASLVAIGENCQLLTDLDISKCT  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  + I  +LQILS+SGC + SDK LP L KLG +L GLN+Q C  IS R 
Sbjct  579  ITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRA  636

Query  362  VDLLVERLWRCDIL  403
            V+LL E+LWRCDIL
Sbjct  637  VELLTEQLWRCDIL  650



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +  I+ LHG TLELLNL+GC  ++DASL AIA+ C +L DLDISK  
Sbjct  520  VNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-ISDASLVAIAENCQLLTDLDISKCT  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  + I  +LQILS+SGC + SDK LP L KLG +L GLN+Q C  IS R 
Sbjct  579  ITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRA  636

Query  362  VDLLVERLWRCDIL  403
            V+LL E+LWRCDIL
Sbjct  637  VELLTEQLWRCDIL  650



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN++DK +S + + HG TLE+LNL+GC  +TDASL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCINLSDKVVSVMTEQHGWTLEMLNLDGCRRITDASLVAIAENCFLLYDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
             +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KLG +L GLN+Q+C  IS   
Sbjct  574  TTDSGIAAMA--RSKQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDIL  403
            VD+LVERLWRCDIL
Sbjct  632  VDILVERLWRCDIL  645



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+TDK +S++A LHG TLE LNL+GC  ++DASL AIA+ C++L DLD+SK  
Sbjct  512  VNLSGCTNITDKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCT  571

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA   A Q +LQILSLSGC L SD+ L  L KLG++L GLNIQ+C  I++  
Sbjct  572  ITDAGIAVLA--HAEQINLQILSLSGCTLVSDRSLTALRKLGHTLLGLNIQHCNAINNST  629

Query  362  VDLLVERLWRCDILS  406
            VD LVE LWRCDILS
Sbjct  630  VDTLVEFLWRCDILS  644



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC NVT+K +S++A LHG TLE LNL+GC  ++DASL AIA+ C++L DLD+SK  
Sbjct  512  VNLSGCTNVTNKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCA  571

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI ALA   A Q +LQ+LSLSGC L SD+ LP L +LG++L GLNIQ+C  I+   
Sbjct  572  ITDAGIEALA--HAKQINLQVLSLSGCTLVSDRSLPALRELGHTLLGLNIQHCNAINSST  629

Query  362  VDLLVERLWRCDILS  406
            VD LVE LWRCDILS
Sbjct  630  VDTLVELLWRCDILS  644



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TD  +SA+A+LHG TLELLNL+GC  +TDASLAAIAD C +L DLD+S+  
Sbjct  507  VNLTGCWNLTDHIVSALARLHGGTLELLNLDGCWNITDASLAAIADNCLLLNDLDVSRCA  566

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+  +A   SLQ+LSLSGC   S+K  P+L  LG +L GLN+QNC  IS   
Sbjct  567  ITDAGIAVLS--NANHLSLQVLSLSGCSEVSNKSSPFLTTLGQTLLGLNLQNCNAISSNT  624

Query  362  VDLLVERLWRCDILS  406
            ++LLVE LWRCDIL+
Sbjct  625  IELLVENLWRCDILA  639



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+ +LHG TLELLNL+GC  +TDASL A+AD C  L DLD+S+  
Sbjct  560  VNLSGCLNLTDEVVLALTRLHGGTLELLNLDGCRRITDASLVAVADNCVFLSDLDVSRCA  619

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+   A Q +LQ+LS SGC   S+K +P+L KLG +L GLN+Q+C  IS R 
Sbjct  620  ITDSGVAALS--HAEQLNLQVLSFSGCSGVSNKSMPFLKKLGKTLVGLNLQHCNSISSRT  677

Query  362  VDLLVERLWRCDIL  403
            V+LLVE LWRCD L
Sbjct  678  VELLVESLWRCDTL  691



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN++DK +  + + HG TLE+LNL+GC  +TDASL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
             +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KLG +L GLN+Q+C  IS   
Sbjct  574  TTDSGIAAMA--RSQQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDIL  403
            VD+LVERLWRCDIL
Sbjct  632  VDILVERLWRCDIL  645



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN++DK +  + + HG TLE+LNL+GC  +TDASL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
             +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KLG +L GLN+Q+C  IS   
Sbjct  574  TTDSGIAAMA--RSQQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDIL  403
            VD+LVERLWRCDIL
Sbjct  632  VDILVERLWRCDIL  645



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +S +A+LHG TLE +NL GC  ++D+ L AI + C +L DLDIS+  
Sbjct  513  VNLSGCVNLTDKAVSVMAELHGWTLEKVNLEGCRMISDSGLVAIGENCPLLSDLDISRCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFGIA+LA   A Q +LQILS+SGC   SDK LP L K+G +L GLN+Q C  IS   
Sbjct  573  ITDFGIASLA--LAGQLNLQILSVSGCSCVSDKSLPALVKMGETLLGLNLQQCNAISSST  630

Query  362  VDLLVERLWRCDILS  406
            VD LVE+LWRCDILS
Sbjct  631  VDRLVEQLWRCDILS  645



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK + A+ +LHG TLELLNL+GC  +TDASL AIA+ C  L DLD+S+S 
Sbjct  504  VNLSGCLNITDKVVLALTRLHGGTLELLNLDGCRRITDASLMAIAESCVFLSDLDVSRSA  563

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D G+AAL+   A Q +LQ+LS SGC   S+K L  L KLG +L GLN+Q+C  IS R 
Sbjct  564  VTDSGVAALS--RAEQLNLQVLSFSGCSRVSNKSLSSLKKLGKTLLGLNLQHCNSISIRT  621

Query  362  VDLLVERLWRCDIL  403
            V+LLVE LW+CDIL
Sbjct  622  VELLVETLWKCDIL  635



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+ +LHG T+ELLNL+GC  +TDASL A+AD C  L DLD+S+  
Sbjct  509  VNLSGCLNLTDEVVLALTRLHGGTVELLNLDGCRRITDASLVAVADNCVFLNDLDVSRCA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+AAL+   A Q +LQ++S SGC+  S+K +P+L +LG +L GLN+Q+C  IS R 
Sbjct  569  ISDSGVAALS--HAEQLNLQVVSFSGCLGVSNKSMPFLKQLGKTLVGLNLQHCNSISART  626

Query  362  VDLLVERLWRCDIL  403
            V+LLVE LWRCDIL
Sbjct  627  VELLVECLWRCDIL  640



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +TDASLA IA  C  LR+LD+SK  
Sbjct  515  VNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKITDASLATIASNCLFLRELDVSKCA  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KLG +L GLN+Q+C  + +  
Sbjct  575  ITDSGLAALS--SADQINLQVLSVSGCSEISHKSLPSLKKLGQTLVGLNLQHCTALGNGS  632

Query  362  VDLLVERLWRCDILS  406
            ++LLVE LWRCDIL+
Sbjct  633  IELLVESLWRCDILA  647



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +TDASLAA+A+ C  L DLD+S+  
Sbjct  513  VNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRITDASLAAVAENCVFLSDLDVSRCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAAL+   A Q +LQ+LS SGC   S+K + +L KLG +L GLN+Q+C  IS + 
Sbjct  573  ITDVGIAALS--HAEQLNLQVLSFSGCSGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQT  630

Query  362  VDLLVERLWRCDIL  403
            ++LLVE LWRCDIL
Sbjct  631  IELLVESLWRCDIL  644



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  VTDASL AIAD C +L DLD+SK  
Sbjct  509  VNLTHCMNVTDEVVLSLARLHGETLELLNLDGCRKVTDASLVAIADNCLLLNDLDVSKCS  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + ++K    L  LG SL GLN+Q+C  I    
Sbjct  569  ITDSGVAALSQG--VQMNLQVLSLSGCSMVTNKSFSSLRTLGESLIGLNLQHCSSIGSSR  626

Query  362  VDLLVERLWRCDILS  406
            V+ LVE LWRCDILS
Sbjct  627  VEALVEDLWRCDILS  641



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC NVTD  I++IA+LHG+TLE+LNL+GC  +TD SLAAIA+ CSVL +LDIS SR
Sbjct  550  VNLSGCYNVTDDIIASIAELHGKTLEILNLDGCKSITDLSLAAIAENCSVLSELDISTSR  609

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+ LA  +A Q S+QI SL GC   + K LP L  LG +L GLNI+ C GIS   
Sbjct  610  ITDIGISTLA--AAKQLSMQIFSLGGCSSVTGKSLPSLVSLGRTLIGLNIRQCDGISFET  667

Query  362  VDLLVERLWRCDI  400
            +D+L++ LWRC+I
Sbjct  668  IDILLDDLWRCNI  680



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  +TDASL AIAD C +L +LD SK  
Sbjct  525  VNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKITDASLVAIADACLLLNELDASKCA  584

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D G+A L+  S+ Q +LQ+LSLSGC   S+K LP+L +LG SL GLN++NC  IS   
Sbjct  585  VTDAGLAVLS--SSEQINLQVLSLSGCSEVSNKSLPFLERLGKSLVGLNLKNCHSISSGT  642

Query  362  VDLLVERLWRCDIL  403
            V  +VE LWRCDIL
Sbjct  643  VGTIVENLWRCDIL  656



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC N+TD  +  IAK+HGETLE+LNL+GC  VTD SL AIA  C  + +LD+S+  
Sbjct  528  LNLSGCANLTDNVVVEIAKVHGETLEVLNLDGCRFVTDVSLMAIAKNCLFMSELDVSQCG  587

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D+GIA LA   A Q SLQI S++GC L SDK L  L  LG SL GLNIQ+C G+S+  
Sbjct  588  ITDYGIAVLA--RAEQLSLQIFSIAGCSLVSDKSLSSLGMLGKSLLGLNIQHCSGLSYGA  645

Query  362  VDLLVERLWRCDILS  406
            V+LL+E+LWRCDILS
Sbjct  646  VNLLLEKLWRCDILS  660



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +S + + HG TLE+LNL+GC  +TDASL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
             +D GIAA+A  +  Q +LQ+LS+SGC + SDK L  L KLG +L GLN+Q+C  IS   
Sbjct  574  TTDSGIAAMARSN--QLNLQVLSMSGCSMISDKSLLALIKLGRTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD+LVERLWRCDILS
Sbjct  632  VDVLVERLWRCDILS  646



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+TD+ +SAI+     TLE LNL GC  +TDASL +IA+ C +L DLD+S   
Sbjct  509  VNLSGCSNLTDRVVSAISVQSDWTLEALNLEGCTKITDASLISIAENCQILSDLDVSNCA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+DFG+  LA  S+ + SLQILSLSGC + +DK +P L KLG +L GLN+QNC  IS   
Sbjct  569  VTDFGVQGLA--SSNKLSLQILSLSGCSMVTDKSMPALGKLGRTLLGLNVQNCQSISTAN  626

Query  362  VDLLVERLWRCDIL  403
            VDLL+E+LWRCDIL
Sbjct  627  VDLLIEQLWRCDIL  640



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSG   +TD  + AI++LHGETLE+L+L+GC  +TD S+ AIA  CSVL +LD+S+  
Sbjct  534  VNLSGSAKLTDNVVMAISELHGETLEVLHLDGCQYITDLSMLAIARNCSVLSELDVSQCG  593

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A LA  SA Q SLQI SL+GC L SDK LP+L  LG +L GLNIQ+C GIS   
Sbjct  594  ITDSGVAVLA--SAEQLSLQIFSLAGCSLVSDKSLPFLVLLGKTLVGLNIQHCRGISCGT  651

Query  362  VDLLVERLWRCDILS  406
            VDLLV++LWRCDILS
Sbjct  652  VDLLVDQLWRCDILS  666



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+ +LHG TLELLNL+G   +TDASL A+AD C  L DLD+S+  
Sbjct  509  VNLSGCLNLTDEIVLALTRLHGGTLELLNLDGRPRITDASLVAVADNCVFLSDLDVSRCA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+AAL+   A Q +LQ++S SGC+  S+K +P+L +LG +L GLN+Q+C  IS R 
Sbjct  569  ISDSGVAALS--HAEQLNLQVVSFSGCLGVSNKSMPFLKQLGKTLVGLNLQHCNSISART  626

Query  362  VDLLVERLWRCDIL  403
            V+LLVE LWRCDIL
Sbjct  627  VELLVESLWRCDIL  640



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N+TDK + ++  LHG+TLE+LNL+GC  +TDASL  IA+ C  LR+LD+SK  
Sbjct  515  VNLNGCLNLTDKVVVSLVSLHGDTLEVLNLDGCRKITDASLVTIANNCLFLRELDVSKCA  574

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+  SA Q +LQ+LS+S C   S K LP L KLG +L GLN+Q+C  IS+R 
Sbjct  575  ITDSGLAALS--SAEQINLQVLSISSCSEISHKSLPSLKKLGQTLMGLNLQHCTAISNRS  632

Query  362  VDLLVERLWRCDILS  406
            ++LLV+ LWRCDIL+
Sbjct  633  IELLVDSLWRCDILA  647



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V LSGC  +TD T++ IAKLHG+TL+LL L+GC CVTDASL  IA  C VL +LD+S+  
Sbjct  508  VKLSGCDKLTDNTVTVIAKLHGDTLDLLKLDGCRCVTDASLIEIASNCMVLSELDVSRCG  567

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI  LA   A+Q SL   S++GC L SD+ LP+L +LG ++ GLN+Q C GI+   
Sbjct  568  ITDSGIKVLA--EAVQMSLLTFSIAGCSLVSDESLPFLVELGKTMVGLNVQYCGGITSGA  625

Query  362  VDLLVERLWRCDILS  406
            VDLLV++LWRCDILS
Sbjct  626  VDLLVDQLWRCDILS  640



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +  +A LHG TLE+LNL GC  ++DASL AIA  C +L DLD+SK  
Sbjct  508  VNLSGCVNLSDKAVCIMADLHGWTLEMLNLEGCK-ISDASLVAIAKNCQLLSDLDVSKCA  566

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  +  Q  LQILS+SGC   SDK +P L KLG +L GLN+Q C  IS   
Sbjct  567  ITDSGIAALARSN--QIKLQILSMSGCSKVSDKSMPSLRKLGQTLLGLNLQQCKAISSST  624

Query  362  VDLLVERLWRCDIL  403
            VDL VE+LWRCDIL
Sbjct  625  VDLFVEQLWRCDIL  638



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  VTDASL AIAD C +L DLD+SK  
Sbjct  510  VNLTHCLNVTDEVVLSLARLHGETLELLNLDGCRRVTDASLVAIADNCLLLNDLDVSKCS  569

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + ++K    L  LG SL GLN+Q+C  I    
Sbjct  570  ITDSGLAALSQG--VQLNLQVLSLSGCSMVTNKSFSSLRTLGESLIGLNLQHCNAIGSSR  627

Query  362  VDLLVERLWRCDILS  406
            ++ LVE LWRCDILS
Sbjct  628  IEALVEDLWRCDILS  642



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TDK +SA+A+LHG TLE+LNL+GC  +TDASL AIA+   VL DLD+SK  
Sbjct  507  VNLTGCWNLTDKVVSALARLHGGTLEVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCA  566

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GIA L+  S    SLQ+LSLSGC   S+K  P+L KLG +L GLN+QNC  I    
Sbjct  567  ISDAGIALLSRASLP--SLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSST  624

Query  362  VDLLVERLWRCDILS  406
            ++LLVE+LWRCDIL+
Sbjct  625  MELLVEKLWRCDILA  639



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +  +A LHG TLE++NL+GC  ++D S+ AIA+ C +L DLD+SK  
Sbjct  565  VNLSGCVNLSDKAVCVMADLHGWTLEMINLDGCK-ISDGSVVAIAENCLLLSDLDVSKCS  623

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA   + Q +LQILS+SGC + SDK LP L KLG +L GLN+Q C  IS   
Sbjct  624  ITDSGIAALA--RSNQINLQILSVSGCTMVSDKSLPSLGKLGQTLLGLNLQQCKAISSSA  681

Query  362  VDLLVERLWRCDIL  403
            VDLLVE+LWRCDIL
Sbjct  682  VDLLVEQLWRCDIL  695



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL AIAD CS+L DLD+SK  
Sbjct  506  VNLSDCLNLTDQVVLSLAARHGETLELLNLDGCRKVTDASLVAIADNCSLLNDLDVSKCA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KLG  L GLN+Q+C  IS   
Sbjct  566  ITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVPSLKKLGECLLGLNLQHC-SISCSS  622

Query  362  VDLLVERLWRCDILS  406
            V+LL E LWRCDI S
Sbjct  623  VELLAEDLWRCDIFS  637



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GCINVTD+ +  I   HG TL++L L+GC  VTDAS+ AIA  C +L DLD+SK  
Sbjct  511  VNLRGCINVTDRVVLPIVNSHGWTLQVLCLDGCKRVTDASMMAIAGNCPMLSDLDVSKCA  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA G+  Q SL+ILSL+GC+  SDK +P L KLG SLAGLNI+ C  IS RG
Sbjct  571  ITDTGIAALARGN--QISLEILSLAGCISVSDKSMPALKKLGQSLAGLNIKRCSAISSRG  628

Query  362  VDLLVERLWRCDIL  403
            V  L E LW CDIL
Sbjct  629  VSKLQEHLWTCDIL  642



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK IS++ KLHG TLELLNL+GC  VTD+SL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCC  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFG+AALA   A QF+LQ+LS+ GC   +D+ L  L KLG+SL GLN+Q+C  IS R 
Sbjct  574  ITDFGVAALA--QANQFNLQLLSVYGCSALTDQSLLALVKLGDSLLGLNLQHCNSISTRS  631

Query  362  VDLLVERLWRCDIL  403
            ++LL+ +L RCDIL
Sbjct  632  IELLLAQLHRCDIL  645



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  ++DASL AIAD C +L +LD SK  
Sbjct  529  VNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKISDASLVAIADACLLLNELDASKCA  588

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A L+  S+ Q +LQ+LSLSGC   S+K LP+L +LG SL GLN++NC  IS   
Sbjct  589  ITDAGLAVLS--SSEQINLQVLSLSGCSEVSNKSLPFLERLGKSLVGLNLKNCHSISSGT  646

Query  362  VDLLVERLWRCDIL  403
            V  +VE LWRCDIL
Sbjct  647  VGTIVENLWRCDIL  660



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TDK +S I+   G TLE LNL GC  +TDA+L +IA  C +L DLD+S   
Sbjct  508  VNLAGCSNLTDKVVSVISAQSGWTLEALNLEGCTKITDATLVSIAGSCQILSDLDVSNCS  567

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFG+ ALA  S+ Q +LQILSL+GC L +DK +P L KLG +L GLN+Q C  IS   
Sbjct  568  ITDFGVQALA--SSNQLTLQILSLAGCPLVTDKSVPALRKLGRTLLGLNVQQCRSISSAT  625

Query  362  VDLLVERLWRCDIL  403
            +DLL+E LWRCDIL
Sbjct  626  IDLLIEHLWRCDIL  639



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK IS++ KLHG TLELLNL+GC  VTD+SL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCC  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFG+AALA   A QF+LQ+LS+ GC   +D+ L  L KLG+SL GLN+Q+C  IS R 
Sbjct  574  ITDFGVAALA--QANQFNLQLLSVFGCSALTDQSLLALVKLGDSLLGLNLQHCNSISTRS  631

Query  362  VDLLVERLWRCDIL  403
            ++LL+ +L RCDIL
Sbjct  632  IELLLAQLHRCDIL  645



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+ DK +  +A LHG TLE+LNL+GC  V+DA L AIA+ C VL DLD+SK  
Sbjct  521  VNLSGCPNLGDKVVCKMADLHGWTLEMLNLDGCK-VSDAGLVAIAENCRVLSDLDVSKCT  579

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  + I  +LQILS+SGC L SDK LP L KLG +L GLN+Q C  IS   
Sbjct  580  ITDSGIAALACSNLI--NLQILSVSGCNLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGA  637

Query  362  VDLLVERLWRCDIL  403
            VDLLVE+LWRCDIL
Sbjct  638  VDLLVEQLWRCDIL  651



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +TDASLAA A+ C  L DLD+S   
Sbjct  513  VNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRITDASLAAAAENCVFLSDLDVSSCA  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAAL+   A Q +LQ+LS SGC   S+K + +L KLG +L GLN+Q+C  IS + 
Sbjct  573  ITDVGIAALS--HAEQLNLQVLSFSGCSGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQT  630

Query  362  VDLLVERLWRCDIL  403
            ++LLVE LWRCDIL
Sbjct  631  IELLVESLWRCDIL  644



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC+N+TD+   A A+LH ETLE+LNL+GC  +TDASL AIA  C  LR+LD+SKS 
Sbjct  508  LNLSGCVNLTDEVAVAAARLHRETLEVLNLDGCRKITDASLEAIAANCLFLRELDVSKSG  567

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A L+     Q +LQ+LS+SGC   S+K L  L ++G SL GLN+Q+C  IS+R 
Sbjct  568  ITDSGLAVLS--CTEQVALQVLSISGCSEVSNKSLSSLKRMGQSLLGLNLQHCTAISNRS  625

Query  362  VDLLVERLWRCDILS  406
            V+LL+E LWRCDIL+
Sbjct  626  VELLIESLWRCDILA  640



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC N+TDK ISAI+  +G TLE+L ++GC  +TDASL +IA+ C +L DLD+SK  
Sbjct  501  VNFSGCSNLTDKVISAISARNGWTLEVLTVDGCNKITDASLVSIAENCQILSDLDLSKCS  560

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS+SGC + +DK LP L +LG++L GLN+Q C  +S   
Sbjct  561  ISDIGIQALA--SSDKLKLQILSMSGCSMVTDKSLPALVRLGSTLLGLNLQQCRSVSSST  618

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  619  VDFLVERLYKCDILS  633



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +TDAS+ +IA+ C +L DLD+SK  
Sbjct  508  INLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCS  567

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA   A Q +LQI S+SGC   SDK L  L KLG +L GLNIQ+C  IS   
Sbjct  568  ITDSGIATLA--CAKQPNLQIFSISGCSFVSDKSLADLIKLGETLVGLNIQHCNAISSST  625

Query  362  VDLLVERLWRCDILS  406
            VDLLVE+LWRCDILS
Sbjct  626  VDLLVEQLWRCDILS  640



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+NVTD  ++ + K HG TL++LNL GC  +TD SL AIAD CSV+ DLD+S   
Sbjct  522  VNLNGCVNVTDDLVTTLVKAHGSTLKMLNLRGCKKITDRSLLAIADGCSVIEDLDLSSCS  581

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA Q  LQILSL+ C   + K LP+L  LG S+ GLN+Q+C  IS RG
Sbjct  582  VSDYGVAVLA--SARQLQLQILSLASCSKVTVKSLPFLGNLGQSMVGLNLQHCSLISTRG  639

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDI+S
Sbjct  640  MKLLEEKLWWCDIIS  654



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL AI + C  L  LD+SK  
Sbjct  499  VNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCA  558

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KLG +L GLN+QNC  I+   
Sbjct  559  ITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSST  616

Query  362  VDLLVERLWRCDILS  406
            V  LVE LWRCDILS
Sbjct  617  VARLVESLWRCDILS  631



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +  I+ LHG TLELLNL+GC  ++DASL AIA+ C +L DLDISK  
Sbjct  520  VNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-ISDASLVAIAENCQLLTDLDISKCT  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  + I  +LQILS+SGC + SDK LP L KLG +L GLN+Q C  IS R 
Sbjct  579  ITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRA  636

Query  362  VDLLVERLWR  391
            V+LL E+LWR
Sbjct  637  VELLTEQLWR  646



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GCIN++D+ ++A+A+LHGET+++LNL+GC  +TD SL+ IA  C +L DLD+S S 
Sbjct  483  LNLNGCINLSDECVTAVARLHGETIKVLNLDGCRKITDVSLSTIASSCPLLSDLDVSNSA  542

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIAAL+     Q +LQILS+SGC   S+K LPYL +LG SL GLN+Q C  +S   
Sbjct  543  VTDSGIAALSCSE--QLNLQILSISGCSKISNKSLPYLIQLGKSLVGLNLQYCNSLSSSS  600

Query  362  VDLLVERLWRCDIL  403
            VD+L+  LWRCDIL
Sbjct  601  VDMLMGNLWRCDIL  614



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL AI + C  L  LD+SK  
Sbjct  500  VNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCA  559

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KLG +L GLN+QNC  I+   
Sbjct  560  ITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSST  617

Query  362  VDLLVERLWRCDILS  406
            V  LVE LWRCDILS
Sbjct  618  VARLVESLWRCDILS  632



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +TDAS+ +IA+ C +L DLD+SK  
Sbjct  558  INLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCS  617

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA   A Q +LQI S+SGC   SDK L  L KLG +L GLNIQ+C  IS   
Sbjct  618  ITDSGIATLA--CAKQPNLQIFSISGCSFVSDKSLADLIKLGETLVGLNIQHCNAISSST  675

Query  362  VDLLVERLWRCDILS  406
            VDLLVE+LWRCDILS
Sbjct  676  VDLLVEQLWRCDILS  690



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK +SA+A+ HG TLE+LNL GC  ++D  L AIAD C +L +LD+S+  
Sbjct  565  VNLSGCVNLTDKVVSAMAESHGWTLEMLNLEGCVKISDVGLVAIADDCPLLSELDVSRCA  624

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++DFG+AALA   A   +LQILSLSGC L +DK +  L K G +L GLN+Q+C  IS+  
Sbjct  625  ITDFGLAALA--RANHLNLQILSLSGCSLITDKSMAALGKTGQTLVGLNLQHCKAISNST  682

Query  362  VDLLVERLWRCDILS  406
            VD L+  LWRCDILS
Sbjct  683  VDRLLGELWRCDILS  697



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +TDASL AIA+   VL DLD+SK  
Sbjct  507  VNLTGCWNLTDNIVSALARLHGGTLEVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCA  566

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A L+  S    SLQ+LSLSGC   S+K  P+L KLG +L GLN+QNC  I    
Sbjct  567  ITDAGVAVLSRASLP--SLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSST  624

Query  362  VDLLVERLWRCDILS  406
            ++LLVE+LWRCDIL+
Sbjct  625  MELLVEKLWRCDILA  639



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+ +K +  +A LHG TLE+LNL+GC  ++DA L AIA+ C +L DLD+SK  
Sbjct  521  VNLSGCPNLGNKVVCKMADLHGWTLEMLNLDGCK-ISDAGLVAIAENCQLLSDLDVSKCT  579

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA  + I  +LQILS+SGC L SDK LP L KLG +L GLN+Q C  IS   
Sbjct  580  ITDSGIAALARSNLI--NLQILSVSGCNLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGA  637

Query  362  VDLLVERLWRCDIL  403
            VDLLVE+LWRCDIL
Sbjct  638  VDLLVEQLWRCDIL  651



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL AI + C  L  LD+SK  
Sbjct  597  VNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCA  656

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KLG +L GLN+QNC  I+   
Sbjct  657  ITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSST  714

Query  362  VDLLVERLWRCDILS  406
            V  LVE LWRCDILS
Sbjct  715  VARLVESLWRCDILS  729



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+N+TD+ +S+I + HG TL++LNL+ C  +TDAS+ +IA+ C +L DLD+SK  
Sbjct  499  INLNGCVNLTDEVVSSIMEHHGSTLKMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCS  558

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA   A Q +LQI S+SGC   S+K L  L  LG +L GLNIQ+C  IS   
Sbjct  559  ITDSGIATLA--HAKQLNLQIFSISGCSFVSEKSLADLINLGETLVGLNIQHCNAISSST  616

Query  362  VDLLVERLWRCDILS  406
            VDLLVE+LWRCDILS
Sbjct  617  VDLLVEQLWRCDILS  631



>dbj|BAF01819.1| putative glucose regulated repressor protein [Arabidopsis thaliana]
Length=384

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL +IA  C +L DLDISK  
Sbjct  252  INFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA  311

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP +  LG++L GLN+Q C  IS+  
Sbjct  312  ISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNST  369

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  370  VDFLVERLYKCDILS  384



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC N+TD  +S +A LHG TLELLNL+GC  +TDASL AIAD C +L DLD+SK  
Sbjct  518  VNLVGCWNLTDNIVSVLATLHGGTLELLNLDGCRKITDASLVAIADNCLLLNDLDVSKCA  577

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+  SA Q +LQ+LSLS C   ++K  P L KLG +L GLN+QNC  I    
Sbjct  578  ITDAGIAVLS--SAKQLTLQVLSLSNCSGVTNKSAPSLKKLGQTLVGLNLQNCNSIGCNT  635

Query  362  VDLLVERLWRCDILS  406
            V+ LVE LWRCDIL+
Sbjct  636  VEFLVENLWRCDILA  650



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC  +TD+ +SAI+  +G TLE+LN++GC  ++DASL +IA  C +L DLD+SK  
Sbjct  490  VNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKISDASLVSIAANCQILSDLDLSKCS  549

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSDFGI ALA  S+ +  LQILS++GC + +DK LP + KLG++L GLN+Q C  +S   
Sbjct  550  VSDFGIQALA--SSDKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCST  607

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  608  VDFLVERLYKCDILS  622



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD  I+A+AK HG TL++LNL  C  VTD SL AIAD CS+L DLD+S+  
Sbjct  528  VNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCT  587

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+A LA  SA+Q  L++LSL+GC   + K LP+L  +G SL GLN+QNC  IS +G
Sbjct  588  ISDHGVADLA--SAMQLKLRVLSLAGCSTLTQKSLPFLGNMGRSLVGLNLQNCNLISTQG  645

Query  362  VDLLVERLWRCDIL  403
            +  L E+LW CDIL
Sbjct  646  IGALEEKLWWCDIL  659



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC N+TDK ISAI   +G TLE+LN++GC  ++DAS+ +IA  C +L DLD+SK  
Sbjct  504  VNFSGCSNLTDKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCS  563

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP + +LG++L GLN+Q C  IS+  
Sbjct  564  ISDSGIQALA--SSEKLKLQILSMAGCSMVTDKSLPAIVRLGSTLLGLNLQQCRSISNST  621

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  622  VDFLVERLYKCDILS  636



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+N+TD+ +S++ + HG TL++LNL+ C  +TDAS+ +IA+ C +L DLD+SK  
Sbjct  508  INLNGCVNLTDEVVSSLMEHHGSTLKMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCS  567

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA   A Q +LQI S+SGC   S+K L  L  LG +L GLNIQ+C  IS   
Sbjct  568  ITDSGIATLA--HAKQLNLQIFSISGCSFVSEKSLADLINLGETLVGLNIQHCNAISSST  625

Query  362  VDLLVERLWRCDILS  406
            VDLLVE+LWRCDILS
Sbjct  626  VDLLVEQLWRCDILS  640



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGCI VTD+ +  I  L G+TL  LNL GC  VTD SL  IA YC++L++LDISK  
Sbjct  403  LNLSGCIEVTDRAVFVIVNLFGKTLLSLNLEGCRKVTDQSLGFIAHYCAILQELDISKCG  462

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+ +LA  SA  + LQILSLSGC+  +DK LP++ K+G +L GLN+Q C GIS R 
Sbjct  463  ITDNGLVSLA--SAASYCLQILSLSGCMQITDKGLPFIGKIGETLIGLNLQQCRGISSRA  520

Query  362  VDLLVERLWRCDIL  403
             DLL   LWRCD+L
Sbjct  521  RDLLATHLWRCDLL  534



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC  +TD+ +SAI+  +G TLE+LN++GC  ++DASL +IA  C +L DLD+SK  
Sbjct  491  VNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKISDASLVSIAANCQILSDLDLSKCS  550

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSDFGI ALA  S+ +  LQILS++GC + +DK LP + KLG++L GLN+Q C  +S   
Sbjct  551  VSDFGIQALA--SSEKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCST  608

Query  362  VDLLVERLWRCDILS  406
            VD +VERL++CDILS
Sbjct  609  VDFVVERLYKCDILS  623



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL +IA  C +L DLDISK  
Sbjct  472  INFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA  531

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP +  LG++L GLN+Q C  IS+  
Sbjct  532  ISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNST  589

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  590  VDFLVERLYKCDILS  604



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL AIAD C +L DLD+SK  
Sbjct  452  VNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCS  511

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL  SL GLN+Q+C  IS   
Sbjct  512  ITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGM  569

Query  362  VDLLVERLWRCDILS  406
            V+ L E LWRCDILS
Sbjct  570  VEQLAESLWRCDILS  584



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL +IA  C +L DLDISK  
Sbjct  496  INFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA  555

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP +  LG++L GLN+Q C  IS+  
Sbjct  556  ISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNST  613

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  614  VDFLVERLYKCDILS  628



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +2

Query  5    NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRV  184
            NLSGCIN+TD+++ A+AKLHGE+LELL+  GCG VTD+ L A++ +C  L+DLDIS+  +
Sbjct  518  NLSGCINLTDRSVMALAKLHGESLELLSFEGCGKVTDSGLMAVSSFCVCLKDLDISRCTI  577

Query  185  SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV  364
            +D G+A L+    ++  LQILSLS C+  +DK LP L     SL GLN+QNC  +S+  V
Sbjct  578  TDNGLAYLSRAKGLR--LQILSLSACLGITDKSLPLLGNFAGSLVGLNLQNCKMVSNGAV  635

Query  365  DLLVERLWRCDIL  403
            +LL E+LWRCDIL
Sbjct  636  ELLGEQLWRCDIL  648



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N++D  +S +A+LHG TLELLNL+GC  +TDASL AIADYC +L+DLD+SK  
Sbjct  518  VNLAGCGNLSDNIVSELARLHGGTLELLNLDGCRKITDASLVAIADYCHLLKDLDVSKCG  577

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+  +A Q +LQ+LSLS C   + K  P L  LG +L GLN+Q C  I    
Sbjct  578  ITDAGIAVLS--NARQLTLQVLSLSNCSGVTCKSGPSLTNLGQTLVGLNLQYCNSIGSNT  635

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDIL+
Sbjct  636  VELLVENLWRCDILA  650



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+TD+ +  +AK HGETLE+LNL GC  +TD+SL+AIA+ C  L+DLD+SK  
Sbjct  499  VNLSGCFNLTDEVVYYLAKFHGETLEVLNLEGCRRITDSSLSAIAESCLFLKDLDMSKCG  558

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+     + +LQ+LS+SGC   S+K L  L KLG +L GLNI+ C  I++R 
Sbjct  559  ITDSGVAALSRAEK-RLNLQVLSVSGCSEVSNKSLVPLKKLGRTLLGLNIRGCNSITNRI  617

Query  362  VDLLVERLWRCDILS  406
            + LL E LWRCDILS
Sbjct  618  IQLLKESLWRCDILS  632



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC N+TD+ ISAI+  +G TLE+LN++GC  ++DASL AIA  C +L DLDISK  
Sbjct  498  VNFSGCSNLTDRVISAISARNGWTLEVLNVDGCTQISDASLVAIAANCQILSDLDISKCA  557

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+    LQILS++GC L +DK LP + +LG++L GLN+Q C  IS   
Sbjct  558  ISDCGIQALA--SSDNLKLQILSMAGCSLVTDKSLPAIVRLGSTLLGLNLQQCRSISFST  615

Query  362  VDLLVERLWRCDILS  406
            VD LVE+L++CDILS
Sbjct  616  VDFLVEQLYKCDILS  630



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL AIAD C +L DLD+SK  
Sbjct  522  VNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCS  581

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL  SL GLN+Q+C  IS   
Sbjct  582  ITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGM  639

Query  362  VDLLVERLWRCDILS  406
            V+ L E LWRCDILS
Sbjct  640  VEQLAESLWRCDILS  654



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL AIAD C +L DLD+SK  
Sbjct  525  VNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCS  584

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL  SL GLN+Q+C  IS   
Sbjct  585  ITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGM  642

Query  362  VDLLVERLWRCDILS  406
            V+ L E LWRCDILS
Sbjct  643  VEQLAESLWRCDILS  657



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V DASL AIAD C VL DLD+S+  
Sbjct  509  VNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+AL  G  + F+L +LSL+GC L S+K L  L KLG+SL GLNI+NC  IS R 
Sbjct  569  ITDAGISALTRG--VLFNLDVLSLAGCSLVSNKSLSALKKLGDSLEGLNIKNCKSISSRT  626

Query  362  VDLLVERLWRCDIL  403
            V+ LVE LW CDIL
Sbjct  627  VNKLVEHLWMCDIL  640



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD  I+A+AK HG TL++LNL  C  VTD SL AIAD CS+L DLD+S+  
Sbjct  528  VNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCT  587

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+A LA   A+Q  L++LSL+GC   + K LP+L  +G SL GLN+QNC  IS +G
Sbjct  588  ISDHGVAVLA--YAMQLKLRVLSLAGCSGLTQKSLPFLGNMGRSLVGLNLQNCNLISTQG  645

Query  362  VDLLVERLWRCDIL  403
            +  L E+LW CDIL
Sbjct  646  IGALEEKLWWCDIL  659



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  ++ + K HG TL++LNL+GC  +TD SL AIAD CSV  DLD+S S 
Sbjct  523  VNLSGCVNLTDALVTMLVKAHGSTLKMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSS  582

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD+G+A LA  SA Q +L  LSL+ C   +DK LP+L  +G S+ GLN+Q+C  IS  G
Sbjct  583  ISDYGVAVLA--SARQLNLCTLSLASCSKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHG  640

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDI+S
Sbjct  641  IGLLEEKLWWCDIIS  655



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +N SGC ++TDK ISAI   +G TLE+LN++GC  ++DAS+ +IA  C +L DLD+SK  
Sbjct  499  MNFSGCSSLTDKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCS  558

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP + +LG++L GLN+Q C  IS+  
Sbjct  559  ISDSGIQALA--SSEKLKLQILSMAGCSMVTDKSLPAIVRLGSTLLGLNLQQCRSISNST  616

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  617  VDFLVERLYKCDILS  631



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+T+  ++ + K HG TL++LNL+GC  +TD SL AIAD CSV  DLD+S S 
Sbjct  321  VNLSGCVNLTEALVTMLVKAHGSTLKMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSS  380

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD+G+A LA  SA Q +L  LSL+ C   +DK LP+L  +G S+ GLN+Q+C  IS  G
Sbjct  381  ISDYGVAVLA--SARQLNLCTLSLASCSKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHG  438

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDI+S
Sbjct  439  IGLLEEKLWWCDIIS  453



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + ++   HG TLE+L+L+GC  V+DASL AIA  C VL DLD+S+  
Sbjct  504  VNLSGCVNLTDRVVLSMVNSHGWTLEVLSLDGCKRVSDASLMAIAGSCPVLADLDVSRCA  563

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA G   QF+L++LSL+GC L SDK +P L KLG SLAGLNI+ C  IS R 
Sbjct  564  ITDTGIAALARGK--QFNLEVLSLAGCALVSDKSVPALKKLGRSLAGLNIKLCNAISSRS  621

Query  362  VDLLVERLWRCDIL  403
            VD L+  L  CDIL
Sbjct  622  VDKLLGHLCMCDIL  635



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD  ++A+ K HG TL++LNL GC  VTD SL  IAD CS+L DLD+S+  
Sbjct  541  VNLSGCVDLTDAVVTALVKAHGTTLQMLNLEGCKKVTDKSLLVIADSCSLLDDLDMSRCM  600

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            + D+G+A LA  SA Q  L++LSL+GC   + K LP L  +G SL GLN+QNC  IS +G
Sbjct  601  IGDYGVAILA--SASQLKLRVLSLAGCSKLTQKSLPLLGNMGRSLVGLNLQNCKLISTQG  658

Query  362  VDLLVERLWRCDIL  403
            +  L E+LW CDIL
Sbjct  659  IGALEEKLWWCDIL  672



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC+++TD  ++A+ K HG TL++LNL GC  VTD SL  IAD CS L DLD+S+  
Sbjct  530  VNLRGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKVTDKSLLVIADSCSFLDDLDMSRCM  589

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            + D+GIA LA  SA Q  L++LSL+GC   + K LP+L  +G SL GLN+QNC  IS +G
Sbjct  590  IGDYGIAVLA--SASQLKLRVLSLAGCSNLTQKILPFLGNMGRSLVGLNLQNCKLISTQG  647

Query  362  VDLLVERLWRCDIL  403
            +  L E+LW CDI 
Sbjct  648  IGALEEKLWWCDIF  661



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL AIADYC +L DLD+SK  
Sbjct  506  VNLSDCLNLTDQVVLSLATRHGETLELLNLDGCRKVTDASLVAIADYCPLLNDLDVSKCA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KLG +L GLN+Q+C  +S   
Sbjct  566  ITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSS  622

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  623  VELLVEDLWRCDILS  637



>gb|KHM99176.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=161

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC N+    +SA+ K+HG TLELLNL+GC  +TDAS  AIA    V+ DLD+SK  
Sbjct  29   VNLIGCWNLIANIVSALVKIHGGTLELLNLDGCWKITDASSVAIAKNFIVINDLDVSKCA  88

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +++ GIA L+   A Q SLQ+LSLSGC   S+K  P+L KLG +L GLN+QNC  I    
Sbjct  89   ITNAGIAILS--RANQPSLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSDI  146

Query  362  VDLLVERLWRCDILS  406
            ++LLVE+LWRC IL+
Sbjct  147  MELLVEKLWRCHILA  161



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL +IA  C +L DLD+SK  
Sbjct  497  VNFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDLSKCA  556

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+ ALA  S+ +  LQILS++GC + +DK +P +  LG++L GLN+Q C  IS+  
Sbjct  557  ISDSGVHALA--SSDKLKLQILSVAGCSMVTDKSMPAIVGLGSTLLGLNLQQCRSISNST  614

Query  362  VDLLVERLWRCDILS  406
            V+ LVERL++CDILS
Sbjct  615  VEFLVERLYKCDILS  629



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC+++TD  ++ + K HG TL++LNLNGC  +TD SL A+AD CS+L DLD+S   
Sbjct  520  VNLCGCVDLTDDLVTLLVKAHGSTLKMLNLNGCKKITDRSLLAVADSCSMLDDLDLSCCS  579

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA Q +L +LSLS C   + K +P+L  LG S+ GLN+QNC  IS  G
Sbjct  580  VSDYGVAVLA--SARQLNLHVLSLSSCSKVTQKIVPFLGNLGKSMVGLNLQNCSLISTHG  637

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDI+S
Sbjct  638  IVLLEEKLWWCDIIS  652



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN +GC N+TD+ ISAI   +G TLE+LN++GC  ++DASL +IA  C +L DLD+SK  
Sbjct  496  VNFNGCSNLTDRVISAITARNGWTLEVLNVDGCSKISDASLVSIAANCQILSDLDLSKCS  555

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+    LQILSL+GC + +D+ LP +  LG++L GLN+Q C  IS+  
Sbjct  556  ISDCGIQALA--SSDNLKLQILSLAGCSMVTDESLPAIVSLGSTLLGLNLQQCRSISNST  613

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  614  VDFLVERLYKCDILS  628



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL A+ D C +L DLD+SK  
Sbjct  471  VNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCA  530

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L    A   S+++LS+S C   S+ C+P+L KLG +L GLNI+ C  I    
Sbjct  531  ITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNE  588

Query  362  VDLLVERLWRCDIL  403
            ++ LVE LWRCDIL
Sbjct  589  IEFLVENLWRCDIL  602



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL A+A  C  + DLDIS + 
Sbjct  489  VNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTL  548

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  549  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  607

Query  362  VDLLVERLWRCDIL  403
            VD  +E+LWRCDIL
Sbjct  608  VDTFLEQLWRCDIL  621



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +TDASL  IA+ C VL DLD+SK  
Sbjct  507  VNLAGCWNLTDNIVSALARLHGGTLEVLNLDGCMKITDASLVTIANNCLVLNDLDVSKCA  566

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+   A   SLQ+LSLSGC   S+KC+P+L  LG +L GLNIQNC  IS   
Sbjct  567  ITDAGIAVLS--RASLLSLQVLSLSGCSDVSNKCVPFLTILGQTLIGLNIQNCNSISSST  624

Query  362  VDLLVERLWRCDIL  403
            ++LLVE+LWRCDIL
Sbjct  625  MELLVEKLWRCDIL  638



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL A+ D C +L DLD+SK  
Sbjct  467  VNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCA  526

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L    A   S+++LS+S C   S+ C+P+L KLG +L GLNI+ C  I    
Sbjct  527  ITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNE  584

Query  362  VDLLVERLWRCDILS*T*SAVRVWGI*SSV  451
            ++ LVE LWRCDIL    +    W I S++
Sbjct  585  IEFLVENLWRCDILFHENTVTESWLIVSTL  614



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL A+A  C  + DLDIS + 
Sbjct  485  VNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTL  544

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  545  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  603

Query  362  VDLLVERLWRCDIL  403
            VD  +E+LWRCDIL
Sbjct  604  VDTFLEQLWRCDIL  617



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL A+A  C  + DLDIS + 
Sbjct  489  VNLSGCINVSDSTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTL  548

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  549  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  607

Query  362  VDLLVERLWRCDIL  403
            VD  +E+LWRCDIL
Sbjct  608  VDTFLEQLWRCDIL  621



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL A+ D C +L DLD+SK  
Sbjct  522  VNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCA  581

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L    A   S+++LS+S C   S+ C+P+L KLG +L GLNI+ C  I    
Sbjct  582  ITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNE  639

Query  362  VDLLVERLWRCDIL  403
            ++ LVE LWRCDIL
Sbjct  640  IEFLVENLWRCDIL  653



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VN SGC ++TDK +SAI   +G TLE+LN++GC  ++DAS+ +IA  C +L DLD+SK  
Sbjct  500  VNFSGCSSLTDKVVSAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCS  559

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK L  + +LG++L GLN+Q C  IS+  
Sbjct  560  ISDSGIQALA--SSDKLKLQILSMAGCSMVTDKSLAAIVRLGSTLLGLNLQQCRSISNST  617

Query  362  VDLLVERLWRCDILS  406
            VD LVERL++CDILS
Sbjct  618  VDFLVERLYKCDILS  632



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+A+LHGETLELLNL+GC  +TDASL AIAD C +L DLD+SK  
Sbjct  531  VNLSGCLNLTDEVVLAMARLHGETLELLNLDGCRKITDASLVAIADNCLLLNDLDLSKCA  590

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAAL+ G   + +LQILS+SGC   S+K +P L KLG +L GLN+Q+C  IS   
Sbjct  591  ITDSGIAALSCGE--KLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSS  648

Query  362  VDLLVERLWRCDIL  403
            V+LL+E LWRCDIL
Sbjct  649  VELLMESLWRCDIL  662



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ + ++A+LHGETLELLNL+GC  VTD SL AIAD C +L DLD+S   
Sbjct  506  VNLSDCLNLTDQVVLSLARLHGETLELLNLDGCRKVTDESLMAIADNCPLLNDLDVSTCA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+A L+ G  +Q +LQ+LSLSGC + S+K +PYL KLG +L GLN+Q+C  +S   
Sbjct  566  ITDSGVAGLSCG--VQVNLQVLSLSGCSMVSNKSVPYLKKLGENLLGLNLQHC-SVSCSA  622

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  623  VELLVEDLWRCDILS  637



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N++DK +S + + HG TLE+LNL+GC  +TDASL AIA+ C +L DLD+SK  
Sbjct  514  VNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCA  573

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
             +D GIAA+A  +  Q +LQ+LS+SGC + SDK LP L KLG +L GLN+Q+C  IS   
Sbjct  574  ATDSGIAAMARSN--QLNLQVLSMSGCSMVSDKSLPALIKLGGTLLGLNLQHCNAISSST  631

Query  362  VDLLVERLWRCDILS  406
            VD+LVERLWRCDILS
Sbjct  632  VDVLVERLWRCDILS  646



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ + ++A+LHGETLELLNL+GC  VTDASL AIAD C +L DLD+S   
Sbjct  506  VNLSDCLNLTDRVVLSLARLHGETLELLNLDGCRKVTDASLVAIADNCPLLNDLDVSTCA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KLG +L GLN+Q+C  +S   
Sbjct  566  ITDSGVAALSCG--VQANLQVLSLSGCSMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSA  622

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  623  VELLVEDLWRCDILS  637



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SA++  HG TLE LNL+GC  +TD SL A+A  C  + DLDIS + 
Sbjct  488  VNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTL  547

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  548  VSDQGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  606

Query  362  VDLLVERLWRCDIL  403
            VD L+E+LWRCDIL
Sbjct  607  VDTLLEQLWRCDIL  620



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SAI+  HG  +E LNL+GC  +TDASL A+A  C  + DLDIS + 
Sbjct  297  VNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTL  356

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  357  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  415

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  416  VDNLLEHLWRCDIL  429



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC N+TD  +++I +LHGE LE+LNL+GCG +TD SL AIA  C  L +LDIS+ R
Sbjct  464  VNLSGCHNLTDNAVASIVELHGENLEVLNLDGCGNITDLSLDAIARNCWSLNELDISRCR  523

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA LA  +A + ++++LSL  C L +DK L  L  LG +L GLNIQ+C GIS   
Sbjct  524  ITDTGIAILA--AAKRLNMKVLSLGSCPLVTDKSLNSLIALGRTLVGLNIQHCRGISSET  581

Query  362  VDLLVERLWRCDIL  403
            + +L++ LWRCD+L
Sbjct  582  ISVLLDDLWRCDVL  595



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+++TD  ++A+ K HG TL++LNL GC  VTD SL  IAD CS L DLD+S+  
Sbjct  530  VNLSGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKVTDKSLLLIADSCSFLDDLDMSRCM  589

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            + D+GIA LA  SA Q  +++LSL+GC   + K +P+L  +G SL GLN+QNC  IS + 
Sbjct  590  IGDYGIAVLA--SASQLKMRVLSLAGCSNLTQKIVPFLGNMGRSLVGLNLQNCKLISTQE  647

Query  362  VDLLVERLWRCDIL  403
            +  L E+LW CDI 
Sbjct  648  IGALEEKLWWCDIF  661



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+ C N+TD  + ++AKL G TLE+LNLNGC  +TD+SL+A+A+ C  LRDLD+SK  
Sbjct  504  VNLTSCFNLTDGVVYSLAKLQGGTLEVLNLNGCRRITDSSLSAMAENCMFLRDLDVSKCG  563

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA+L+     + +LQ+LS+SGC   S+K L  L KLG +L GLNI+ C  I++  
Sbjct  564  ITDSGIASLSRAEK-RLNLQVLSVSGCSEVSNKSLVSLKKLGRTLLGLNIRGCDSITNET  622

Query  362  VDLLVERLWRCDILS  406
            V  LVE LWRCDILS
Sbjct  623  VQRLVESLWRCDILS  637



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL AIADYC +L DLD+SKS 
Sbjct  506  VNLSDCLNLTDQVVLSLAMRHGETLELLNLDGCRKVTDASLVAIADYCPLLIDLDVSKSA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +  L KLG +L GLN+Q+C  +S   
Sbjct  566  ITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVLSLKKLGENLLGLNLQHC-SVSCSS  622

Query  362  VDLLVERLWRCDILS  406
            V+LLVE LWRCDILS
Sbjct  623  VELLVEALWRCDILS  637



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+AKLHGETLE+LNL+GC  +TDASLAAIA+ C +L DLD+SK  
Sbjct  510  VNLSGCLNLTDEVVVALAKLHGETLEMLNLDGCRKITDASLAAIAENCLLLSDLDLSKCA  569

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D  I+ALA  S+ + +LQ+LSLSGC   ++K    L KLG +L GLN+Q+C  IS   
Sbjct  570  ITDSSISALA--SSKKINLQVLSLSGCSDVTNKSASCLKKLGETLVGLNLQHCNSISSST  627

Query  362  VDLLVERLWRCDILS  406
             +LLVE LWRCDIL+
Sbjct  628  AELLVESLWRCDILA  642



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N++D+ + ++   HG TLE+L+L+GC  V DASL AIA  C +L DLD+S+  
Sbjct  503  VNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCA  562

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA G   Q +L++LSL+GC L SDK +P L K+G SLAGLNI+ C GIS R 
Sbjct  563  ITDTGIAALARGK--QINLEVLSLAGCALVSDKSVPALKKMGCSLAGLNIKRCKGISSRS  620

Query  362  VDLLVERLWRCDIL  403
            V+ L E L  CDIL
Sbjct  621  VNKLQEHLCMCDIL  634



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS CINV+D T+SAI+  HG TLE LNL+GC  +TD SL A+A  C  + DLDIS + 
Sbjct  457  VNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTL  516

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  517  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  575

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  576  VDTLIENLWRCDIL  589



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SAI+  HG  +E LNL+GC  +TDASL A+A  C  + DLDIS + 
Sbjct  488  VNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTL  547

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  548  VSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  606

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  607  VDNLLEHLWRCDIL  620



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TDK+I A+A+LHG TL+L+NL GC  +TD SL AIAD   VL +LD+S   
Sbjct  482  VNLSGCLNLTDKSILALARLHGATLQLVNLEGCRKITDQSLVAIADNLLVLNELDVSNCA  541

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA   A   +L ILSL+GC   + + LP L +LG +L GLN++ C  IS+  
Sbjct  542  VSDRGLIALA--RAQHINLLILSLAGCCGITSRSLPSLERLGKTLVGLNLKGCNSISNGS  599

Query  362  VDLLVERLWRCDIL  403
            +++LVE LWRCDIL
Sbjct  600  IEVLVENLWRCDIL  613



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D T+SA++  HG TLE LN++GC  +TDASL A+A  C  + DLD+S + 
Sbjct  489  VNLSGCINVSDNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTL  548

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  549  VSDQGVKALA-SSPNHLNLQVLSIGGCSGVTDKSKACIQKLGRTLLGLNIQRCGRISSST  607

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  608  VDNLLEHLWRCDIL  621



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+NVTD  ++ + K+HG +L++LNL+GC  +TD SL AI + CSVL DLD+S   
Sbjct  522  INLTGCVNVTDDLVTMLIKVHGSSLKMLNLHGCRKITDRSLLAITESCSVLDDLDLSSCS  581

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA Q +L ILSL+ C   + K LP+L  LG S+ GLN+Q+C  IS  G
Sbjct  582  VSDYGVALLA--SARQLNLHILSLASCSQVTLKSLPFLGNLGLSIVGLNLQDCSLISAHG  639

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDI+S
Sbjct  640  LRLLEEKLWWCDIIS  654



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+N+TD  +SAI   HG TLE LNL+GC  +TDASL ++A  C  + DLD+S SR
Sbjct  491  VNLSCCLNLTDSAVSAIVTRHGLTLESLNLDGCRNITDASLVSVAKNCYSINDLDVSNSR  550

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQI S+ GC   +D+    + KLG +L GLNIQ C  IS   
Sbjct  551  VSDLGIEALA-TSPNHLNLQIFSIGGCSAVTDESQASIQKLGRTLLGLNIQRCSKISSST  609

Query  362  VDLLVERLWRCDIL  403
            +D L+E+LWRCDIL
Sbjct  610  IDALLEQLWRCDIL  623



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C+NVTD  ++ + K HG TL++ NL+GC  +TD SL AIAD CS L +LD+S   
Sbjct  518  VNLSNCVNVTDVLVAMLVKSHGGTLKVFNLDGCKQITDRSLLAIADGCSELDNLDLSSCS  577

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD+G+A LA  SA Q +L+ILSL+ C   + K LP+L  +G+S+ GLN+Q+C  IS  G
Sbjct  578  ISDYGVAVLA--SARQLNLRILSLASCSKVTQKSLPFLGNMGSSMVGLNLQHCRLISTYG  635

Query  362  VDLLVERLWRCDILS  406
            + LL E+LW CDILS
Sbjct  636  IGLLEEKLWWCDILS  650



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL  C+N++DK +  +  LH  TLE LNL+GC  ++DASL AIA+ C +L DLD+SK  
Sbjct  482  VNLKDCVNLSDKGVCRLTNLHRWTLETLNLDGCK-ISDASLFAIAENCRLLGDLDVSKCA  540

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAALA    I  ++QILS+SGC + SDK LP L  LG +L GLN+Q C  IS   
Sbjct  541  ITDSGIAALAHSDLI--NVQILSVSGCSMVSDKSLPSLRNLGKTLLGLNLQQCKAISRSA  598

Query  362  VDLLVERLWRCDIL  403
            +DLLV++LWRC+IL
Sbjct  599  IDLLVQQLWRCNIL  612



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+NVTD T+SA++  HG TLE L+L+GC  +TDASL  +A  C  + DLD+S + 
Sbjct  483  LNLNGCVNVTDNTVSAVSFSHGSTLESLSLDGCKNITDASLVTVAKNCYSVNDLDVSNTL  542

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    SLQ+LSL GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  543  VSDHGIKALA-SSPNHLSLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSST  601

Query  362  VDLLVERLWRCDIL  403
            VD L+E+LWRCDIL
Sbjct  602  VDSLLEQLWRCDIL  615



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS CINV+D T+SAI+  HG TLE LNL+GC  +T+ASL A+A  C  + DLDIS + 
Sbjct  490  VNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTL  549

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  550  VSDHGIKALA-SSPNHLNLQVLSIGGCSSITDKSKACIQKLGRTLLGLNIQRCGRISSST  608

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  609  VDTLLENLWRCDIL  622



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C N+T++ + A+A+ HG TLELLNL  C  +TD SL A+AD C +L DLD+++  
Sbjct  504  VNLSHCSNLTEEVVFALARCHGGTLELLNLENCQKITDESLTALADSCPLLNDLDLARCT  563

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+ AL+ G  +  +LQILSLSGC + S++ +  L K+G +L GLNIQ+C  IS   
Sbjct  564  ITDAGVNALSRG--VHTNLQILSLSGCSMVSNESMHALEKMGKTLLGLNIQHCNSISSGK  621

Query  362  VDLLVERLWRCDILS  406
            +++L E LWRCDILS
Sbjct  622  IEILTENLWRCDILS  636



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCINV+D  +SAI+  HG TLE LN++GC  +TDASL A+A  C  + DLD+S + 
Sbjct  488  VNLSGCINVSDNAVSAISVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTL  547

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  548  VSDQGVKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSST  606

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  607  VDNLLEHLWRCDIL  620



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+ CIN++D ++ AI +LHGE+++ L+L+GC  +TD SL AIA  C +L DLD+S   
Sbjct  493  LNLNSCINLSDASVLAIVRLHGESVKELSLDGCRKITDTSLFAIAGNCPLLNDLDVSNCS  552

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GIAAL+  S+ + +LQILS+SGC   S+K LPYL +LG  L GLN+++C  +S   
Sbjct  553  VTDSGIAALS--SSQKLNLQILSISGCTNISNKSLPYLIQLGKRLIGLNLKHCSSLSLST  610

Query  362  VDLLVERLWRCDIL  403
            VD+LV  LWRCDIL
Sbjct  611  VDMLVGNLWRCDIL  624



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD  +  I   HG TLE LNL+ C  +TD SL A++  C  + DLD+S SR
Sbjct  491  VNLSGCINITDNAVLTIVTRHGCTLESLNLDTCKNITDTSLIAVSKNCYSINDLDVSNSR  550

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQI S+ GC   +DK L  L KLG++L GL+I++C  IS   
Sbjct  551  VSDVGIEALA-SSPNHLNLQIFSIGGCSAVTDKSLASLQKLGHTLLGLSIRHCSKISSSA  609

Query  362  VDLLVERLWRCDIL  403
            +D L+E+LWRCDIL
Sbjct  610  IDALLEQLWRCDIL  623



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V LSGCINV D T+SA++  HG TLE LN++GC  +TDASL A+A  C  + DLD+S + 
Sbjct  489  VKLSGCINVADNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTL  548

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  549  VSDQGVKALA-SSPNHLNLQVLSIGGCSGVTDKSKACIQKLGRALLGLNIQRCGRISSST  607

Query  362  VDLLVERLWRCDIL  403
            VD L+E LWRCDIL
Sbjct  608  VDNLLEHLWRCDIL  621



>ref|XP_004170235.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like, 
partial [Cucumis sativus]
Length=509

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +TD SL AIAD   VL +LD+S   
Sbjct  377  VNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCA  436

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA   A   +L ILSL+GC   +   LP L  LG +L GLN++ C  IS+  
Sbjct  437  VSDRGLIALA--RAQHINLSILSLAGCCGITGTSLPCLEILGKTLVGLNLEGCNSISNGS  494

Query  362  VDLLVERLWRCDIL  403
            +++LVE LWRCDIL
Sbjct  495  IEVLVENLWRCDIL  508



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL A+AD C +L DLD+SK  
Sbjct  501  VNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNITDASLVAVADDCLLLNDLDVSKCA  560

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+   A   S+++LS+S C   S+KC+P+L KLG +L+GLNI+NC  I    
Sbjct  561  ITDAGIAVLS--RADHLSMRVLSMSDCSGISNKCVPFLVKLGPALSGLNIKNCNSIDSNA  618

Query  362  VDLLVERLWRCDILS  406
            ++ LVE LWRCDIL+
Sbjct  619  IEFLVENLWRCDILA  633



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +TD SL AIAD   VL +LD+S   
Sbjct  482  VNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCA  541

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+ ALA   A   +L ILSL+GC   +   LP L  LG +L GLN++ C  IS+  
Sbjct  542  VSDRGLIALA--RAQHINLSILSLAGCCGITGTSLPCLEILGKTLVGLNLEGCNSISNGS  599

Query  362  VDLLVERLWRCDIL  403
            +++LVE LWRCDIL
Sbjct  600  IEVLVENLWRCDIL  613



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            + LSGC N+TD+ ISAI   +G TLE+LN +GC  +TDASL +IA  C +L DLDIS+  
Sbjct  497  IKLSGCSNLTDRVISAITARNGWTLEVLNRDGCSNITDASLVSIAANCQILSDLDISECA  556

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI ALA  S+ +  LQILS++GC + +DK LP +  LG++L GLN+Q C  IS+  
Sbjct  557  ISDSGIQALA--SSDKLKLQILSVAGCSMVTDKRLPAIVGLGSTLLGLNLQQCRSISNSP  614

Query  362  VDLLVERLWRCDILS  406
            VD LV  L++CD LS
Sbjct  615  VDFLVGSLYKCDALS  629



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL A+AD C +L DLD+SK  
Sbjct  501  VNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNITDASLVAVADDCLLLNDLDVSKCA  560

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIA L+   A   S+++LS+S C   S+KC+P+L KLG +L+GLNI+NC  I    
Sbjct  561  ITDAGIAVLS--RADHLSMRVLSMSDCSGISNKCVPFLVKLGPALSGLNIKNCNSIDSNA  618

Query  362  VDLLVERLWRCDILS*T*SAVRVW  433
            ++ LVE LWRCDIL    +    W
Sbjct  619  IEFLVENLWRCDILFHENTVTESW  642



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+NV+D T+SA++  HG TLE L+L+GC  +TDAS+  ++  C  + DLD+S + 
Sbjct  483  LNLNGCVNVSDNTVSAVSFSHGSTLESLSLDGCKNITDASVVTVSKNCYSVNDLDVSNTL  542

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LSL GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  543  VSDHGIKALA-SSPNHLNLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSST  601

Query  362  VDLLVERLWRCDIL  403
            VD L+E+LWRCDIL
Sbjct  602  VDSLLEQLWRCDIL  615



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+GC+NV+D  +SA++  HG TLE L+L+GC  +TDASL  ++  C  + DLD+S + 
Sbjct  483  LNLNGCVNVSDNAVSAVSFSHGSTLESLSLDGCKNITDASLVTVSKNCYSVNDLDVSNTL  542

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD GI ALA  S    +LQ+LSL GC   +DK    + KLG +L GLNIQ C  IS   
Sbjct  543  VSDHGIKALA-SSPNHLNLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSST  601

Query  362  VDLLVERLWRCDIL  403
            VD L+E+LWRCDIL
Sbjct  602  VDSLLEQLWRCDIL  615



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD+ + A+A+LHG TLELLNL+GC  +TDASL AIAD C +L DLD+SK  
Sbjct  506  VNLSGCLNLTDEVVLAMARLHGXTLELLNLDGCRKITDASLVAIADNCLLLNDLDLSKCA  565

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GIAAL+ G   + +LQILS+SGC   S+K +P L KLG +L GLN+Q+C  IS   
Sbjct  566  ITDSGIAALSCGE--KLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSS  623

Query  362  VDLLVERLWRCDIL  403
            V+LL+E LWR  I+
Sbjct  624  VELLMESLWRFSII  637



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +SA+ K HG++L+ ++L GCG +TDASL AI++ CS L +LD+SK  
Sbjct  358  VDLSGCKNITDAAVSALVKGHGKSLKQVSLEGCGKITDASLLAISENCSELAELDLSKCM  417

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A LA  SA    L++LSLSGC   + K +P+L  +G SL GLN+Q C  I +  
Sbjct  418  VSDNGVAMLA--SAKHLKLRVLSLSGCSKVTQKIVPFLGNMGQSLEGLNLQFCNMIGNHN  475

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  476  IASLEKQLWWCDILA  490



>gb|ACF81449.1| unknown [Zea mays]
Length=206

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++ C+ L +LD+S   
Sbjct  74   VDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  133

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  134  VSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  191

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  192  IASLEKKLWWCDILA  206



>ref|XP_002437255.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
 gb|EER88622.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
Length=303

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL AI++ CS L +LD+S   
Sbjct  172  VDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCM  231

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  +A Q  L+ILSLSGC+  + K +P+L  + +SL GLN+Q N +G  +R
Sbjct  232  VSDYGVAVLA--AAKQLKLRILSLSGCMKVTQKSVPFLGSMSSSLEGLNLQFNFIG--NR  287

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LWRCDIL+
Sbjct  288  NIASLEKQLWRCDILA  303



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD ++S I    G++L+ L ++GC  VTDA+L  I + C  L  LD+SK  
Sbjct  481  VNLSGCVNITDISVSYIVNKCGKSLKYLLVDGCKNVTDATLVEIWNSCWTLNVLDVSKCG  540

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI  L+  SAIQ  LQILSLSGC L SD  LP+L  L  +L GLNIQ+C  IS + 
Sbjct  541  ITDSGITTLS--SAIQLQLQILSLSGCPLVSDNSLPFLLDLTQNLQGLNIQHCPNISSKT  598

Query  362  VDLLVERLWRCDILS  406
            VD LVE   RCDILS
Sbjct  599  VDALVEINPRCDILS  613



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 2/121 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V DASL AIAD C VL DLD+S+  
Sbjct  509  VNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECA  568

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI+AL  G  + F+L +LSL+GC L S+K L  L KLG+SL GLNI+NC  IS R 
Sbjct  569  ITDAGISALTRG--VLFNLDVLSLAGCSLVSNKSLSALKKLGDSLEGLNIKNCKSISSRT  626

Query  362  V  364
            V
Sbjct  627  V  627



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+ AIA+ C++L DLD+SK+ 
Sbjct  503  VNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLSDLDVSKTA  562

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL  316
            ++D+G+AALA  SA   ++QILSLSGC L S++ +P+L KLG +L
Sbjct  563  ITDYGVAALA--SAKHLNVQILSLSGCSLISNQSVPFLRKLGQTL  605



>ref|NP_001132560.1| F-box family member [Zea mays]
Length=375

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++ C+ L +LD+S   
Sbjct  243  VDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  302

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  303  VSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  360

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  361  IASLEKKLWWCDILA  375



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++ C+ L +LD+S   
Sbjct  388  VDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  447

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  448  VSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  505

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  506  IASLEKKLWWCDILA  520



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++ C+ L +LD+S   
Sbjct  511  VDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  571  VSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  628

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  629  IASLEKKLWWCDILA  643



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 95/136 (70%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL AI++ CS L +LD+S   
Sbjct  497  VDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSRITDASLFAISESCSQLAELDLSNCM  556

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  +A Q  L+ILSLSGC+  + K +P+L  + +SL GLN+Q N +G  + 
Sbjct  557  VSDYGVAVLA--AAKQLKLRILSLSGCMKVTQKSVPFLGSMSSSLEGLNLQFNFIG--NH  612

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LWRCDIL+
Sbjct  613  NIASLEKQLWRCDILA  628



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 95/136 (70%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL AI++ CS L +LD+S   
Sbjct  495  VDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCM  554

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  +A Q  L++LSLSGC+  + K +P+L  + +SL GLN+Q N +G  + 
Sbjct  555  VSDYGVAVLA--AAKQLRLRVLSLSGCMKVTQKSVPFLGSMSSSLEGLNLQFNFIG--NH  610

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LWRCDIL+
Sbjct  611  NIASLEKQLWRCDILA  626


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 5/118 (4%)
 Frame = +2

Query  26   VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIA  202
            VTD  ISA+A+   E L  L L     VTDA LA +A  C  L  LDIS    ++D G+A
Sbjct  159  VTDAGISALARGCPE-LRSLTLWDVPQVTDAGLAEVAAECHSLERLDISGCPMITDKGLA  217

Query  203  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV  376
            A+A G      L+ L++ GC   +++ L  + +    L  ++I+NC  +  +GV  LV
Sbjct  218  AVAQGCP---ELKSLTIEGCSGVANEGLKAVGRFCAKLQAVSIKNCALVDDQGVSGLV  272



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  IA+ C  L +LD+S   
Sbjct  522  VDLSGCKNITDVAVSSLVKAHGKSLKKVSLEGCSKITDASLFTIAESCMELAELDLSNCM  581

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A L+  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  582  VSDYGVAILS--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  639

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  640  IVSLEKKLWWCDILA  654



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL AI++ C+ L +LD+SK  
Sbjct  379  VDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCM  438

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A LA  SA    L++LSLSGC   + K + +L  +G SL GLN+Q C  I +  
Sbjct  439  VSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHN  496

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  497  IASLEKQLWWCDILA  511



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL AI++ C+ L +LD+SK  
Sbjct  528  VDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCM  587

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A LA  SA    L++LSLSGC   + K + +L  +G SL GLN+Q C  I +  
Sbjct  588  VSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHN  645

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  646  IASLEKQLWWCDILA  660



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++ C+ L +LD+S   
Sbjct  523  VDLSGCKNITDVAVSSLVKGHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  582

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A LA  SA    L++LSLSGC   + K +P+L  LG SL GLN+Q C  I +  
Sbjct  583  VSDHGVAILA--SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHN  640

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  641  IASLEKQLWWCDILA  655



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL AI++ C+ L +LD+SK  
Sbjct  521  VDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCM  580

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A LA  SA    L++LSLSGC   + K + +L  +G SL GLN+Q C  I +  
Sbjct  581  VSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHN  638

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  639  IASLEKQLWWCDILA  653



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   
Sbjct  459  VDLNGCENLTDATVSALVKAHGSSLARLSLEGCSKITDASLFAISEGCTDLAELDLSNCM  518

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  519  VSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NH  574

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  575  NIASLEKQLWWCDILA  590



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   
Sbjct  496  VDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCM  555

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  556  VSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NH  611

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  612  NIASLEKQLWWCDILA  627



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   
Sbjct  533  VDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCM  592

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  593  VSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NH  648

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  649  NIASLEKQLWWCDILA  664



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V L+GC ++TD  +SA+AK HG +L  L+L GC  +TDASL AI++ CS L +LD+S   
Sbjct  495  VGLNGCESLTDAAVSALAKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCM  554

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  +A Q  L++LSLSGC+  + K +P+L  + +SL  LN+Q N +G  + 
Sbjct  555  VSDYGVAVLA--AARQLKLRVLSLSGCMKVTQKSVPFLGSMSSSLEALNLQFNFIG--NH  610

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LWRCDIL+
Sbjct  611  NIASLEKQLWRCDILA  626



>gb|EMS45959.1| hypothetical protein TRIUR3_29988 [Triticum urartu]
Length=383

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  ISA+ K HG +L  L+L GC  +TDASL AI++ CS L +LD+S   
Sbjct  252  VDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKITDASLFAISESCSELAELDLSNCM  311

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A L+  SA +  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  312  VSDYGVAVLS--SAERLKLRVLSLSGCLKVTPKSVPFLGSMPASLEGLNLQFNFIG--NH  367

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  368  NIASLEKQLWWCDILA  383



>gb|EMT32544.1| hypothetical protein F775_30491 [Aegilops tauschii]
Length=452

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  ISA+ K HG +L  L+L GC  ++DASL AI++ CS L +LD+S   
Sbjct  321  VDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKISDASLFAISESCSELAELDLSNCM  380

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA +  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  381  VSDYGVAVLA--SAERLKLRVLSLSGCLKVTPKSVPFLGSMPASLEGLNLQFNFIG--NH  436

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  437  NIASLEKQLWWCDILA  452



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 25/135 (19%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLS C  +TDK I A+A+LHG TLELLNL GC  VTDASL AIAD C  L DLD+SK  
Sbjct  519  VNLSDCGILTDKVIIALAELHGATLELLNLEGCKKVTDASLVAIADSCLFLNDLDVSKCS  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+AAL+ G  +  +LQ                       +L GLN+Q+C  IS   
Sbjct  579  ITDSGVAALSNG--VHLNLQ-----------------------TLVGLNLQHCNSISSSS  613

Query  362  VDLLVERLWRCDILS  406
            ++ LVE LWRCDILS
Sbjct  614  IERLVENLWRCDILS  628



>gb|AFA36487.1| EIN3-binding F-box protein, partial [Lolium perenne]
Length=263

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD  ISA+ K HG +L  L+L  C  +TDASL AI++ C  L +LD+S   
Sbjct  132  VDLNGCENLTDAAISALVKAHGGSLAHLSLESCSKITDASLFAISESCYELAELDLSNCM  191

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA    L+ILSLSGC+  + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  192  VSDYGVAVLA--SAAGLKLRILSLSGCLKVTQKSVPFLGSMPASLEGLNLQFNFIG--NH  247

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  248  NIASLEKQLWWCDILA  263



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L  +++ C+ L +L++S   
Sbjct  390  VDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM  449

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K + +L  LG S+ GLN+Q C  I +  
Sbjct  450  VSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHN  507

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  508  IASLEKKLWWCDILA  522



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC N+TD +ISA+ K HG +L  L+L GC  ++DASL AI++ C  L +LD+S   
Sbjct  511  VDLNGCENLTDASISALVKAHGNSLTHLSLEGCSKISDASLFAISESCCELAELDLSNCM  570

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHR  358
            VSD+G+A LA  SA Q  L++LSLSGC   + K +P+L  +  SL GLN+Q N +G  + 
Sbjct  571  VSDYGVAVLA--SAGQLKLRVLSLSGCFKVTQKSVPFLGSMPVSLEGLNLQFNFIG--NH  626

Query  359  GVDLLVERLWRCDILS  406
             +  L ++LW CDIL+
Sbjct  627  NIASLEKQLWWCDILA  642



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L  +++ C+ L +L++S   
Sbjct  519  VDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM  578

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K + +L  LG S+ GLN+Q C  I +  
Sbjct  579  VSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHN  636

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  637  IASLEKKLWWCDILA  651



>ref|NP_001058023.1| Os06g0605900 [Oryza sativa Japonica Group]
 dbj|BAF19937.1| Os06g0605900, partial [Oryza sativa Japonica Group]
Length=122

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +2

Query  32   DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA  211
            D T+SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   VSD+G+A LA
Sbjct  1    DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  60

Query  212  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHRGVDLLVERLW  388
              SA Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  +  +  L ++LW
Sbjct  61   --SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NHNIASLEKQLW  116

Query  389  RCDILS  406
             CDIL+
Sbjct  117  WCDILA  122



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K+HG++++ ++L GC  +TDASL +I++ C+ L +LD+S   
Sbjct  524  VDLSGCKNITDLAVSSLVKVHGKSVKQVSLEGCSKITDASLFSISENCTELAELDLSNCM  583

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A+LA  S   F L++LSL GC   + + +P+L  +G  L GLNIQ C  I +  
Sbjct  584  VSDSGVASLASTS--NFKLRVLSLFGCSNVTQRSVPFLGNMGK-LEGLNIQFCNMIGNHN  640

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  641  IASLEKQLWWCDILA  655



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L  +++ C+ L +L++S   
Sbjct  622  VDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM  681

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD+G+A LA  SA    L++LSLSGC   + K + +L  LG S+ GLN+Q C  I +  
Sbjct  682  VSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHN  739

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  740  IASLEKKLWWCDILA  754



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = +2

Query  38   TISAIAKLHGETLELLNLNGCGCVTDASLAAIADY---CSVLRDLDISKSRVSDFGIAAL  208
            T S    L   +L  +N +GC  +TD  ++AI+     C +L DLD+SK  VSDFGI AL
Sbjct  476  TESGFLHLLQNSLVKVNFSGCSGLTDRVVSAISARNANCQILSDLDLSKCSVSDFGIQAL  535

Query  209  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLW  388
            A  S+ +  LQILS++GC + +DK LP + KLG++L GLN+Q C  +S   VD L+ERL+
Sbjct  536  A--SSEKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFLLERLY  593

Query  389  RCDILS  406
            +CDILS
Sbjct  594  KCDILS  599



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD T+S++ K HG++++ ++L GC  +TDASL  I++ C+ L +LD+S   
Sbjct  518  VDLSGCKNITDVTVSSLVKAHGKSVKQVSLEGCSKITDASLFCISENCTELAELDLSNCM  577

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A+LA  SA  F L++LSL GC   +   + +L  +G  L GLN+Q C  I +  
Sbjct  578  VSDSGVASLA--SAKHFKLRVLSLFGCSNVTQASVQFLGSMGK-LEGLNLQYCNMIGNHN  634

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDI++
Sbjct  635  IASLEKQLWWCDIVA  649



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++++ ++L GC  +TDASL  I++ C+ L +LD+S   
Sbjct  808  VDLSGCKNITDVAVSSLVKAHGKSVKQVSLEGCSKITDASLFCISENCTELAELDLSNCM  867

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A+LA  SA  F L++LSL GC   +   + +L  +G  L GLN+Q C  I +  
Sbjct  868  VSDSGVASLA--SAKHFKLRVLSLFGCSKVTQVGVQFLGSMGK-LEGLNLQYCNMIGNHN  924

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  925  IASLEKQLWWCDILA  939



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+ AIA+ C++L DLD+SK+ 
Sbjct  635  VNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLSDLDVSKTA  694

Query  182  VSDFGIAALAGGSAIQFSLQILSLSG  259
            ++D+G+AALA  SA   ++QILSLSG
Sbjct  695  ITDYGVAALA--SAKHLNVQILSLSG  718



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC N+TD  +S++ K HG++++ ++L GC  +TDASL  I++ C+ L  LD+S   
Sbjct  353  VDLSGCKNITDVAVSSLVKAHGKSVKQISLEGCSKITDASLFCISENCTELAGLDLSNCM  412

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+A+LA  SA  F L+ LSL GC   +   + +L  +G  L GLN+Q C  I +  
Sbjct  413  VSDSGVASLA--SAKHFKLRALSLFGCSKVTQVSVQFLGSMGK-LEGLNLQYCNMIGNHN  469

Query  362  VDLLVERLWRCDILS  406
            +  L ++LW CDIL+
Sbjct  470  IASLEKQLWWCDILA  484



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC  +TD ++  I  L G+ L  L L+ C  +TD SL  IA+ C+ L DL +S  R
Sbjct  523  VDLSGCSRITDWSVFVITSLIGDKLRSLMLDWCEKLTDLSLKMIAERCACLLDLGLSGCR  582

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+  L   S +Q  L+++S +GCV  SD+ L YL  L   L GLN+ +C  ++  G
Sbjct  583  ISDDGVYCLV-ASKLQ-CLEVVSFAGCVGISDQSLHYLRMLRCYLVGLNLMHCPKLTKEG  640

Query  362  VDLLVERLWRCDIL  403
            +D + E LW CD+L
Sbjct  641  IDRMRENLWWCDLL  654



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+LSGC  V+D ++ A+    G  +  L+L+GC  V DASL AIA  C+ + DLD+S+  
Sbjct  488  VSLSGCARVSDDSVVALCNGCGGGIRTLSLDGCVQVGDASLEAIARLCTCINDLDLSQCA  547

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            VSD G+  LA       SL+I SLSGC   S+ C+ +L ++G  L GLN+ +C G+S   
Sbjct  548  VSDLGLEFLARMGCT--SLRIFSLSGCSRISNGCMSFLKEVGAGLVGLNLMHCGGLSRMA  605

Query  362  VDLLVERLWRCDILS  406
            ++ L   L +CDI S
Sbjct  606  IERLKGSLSKCDIAS  620


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = +2

Query  74   LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILS  250
            LE L+L  CG + DA L AIA  C++LR LD+     V+D G+ A+A  S+   +L  L+
Sbjct  197  LESLSLWECGSIGDAGLEAIAMGCTLLRKLDLRNCPLVTDKGLVAIAKTSS---NLSSLT  253

Query  251  LSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVER  382
            L  C    D  L    K  N++  L++ NC  I   G+  +V R
Sbjct  254  LEACPNVGDPALEATSKCSNNIKSLSLNNCPCIGDEGLRSMVSR  297



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V++SG   +TD ++ AI  + GE L  L L+GC  ++D SL  I++ C  L DL +S+  
Sbjct  512  VDMSGSSGITDLSVYAITSIVGEKLRCLILDGCERLSDLSLKMISERCPCLIDLGLSRCC  571

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD GI  L   S     L++LSL GCV  +D+CL YL  +  SL GL++++C  ++  G
Sbjct  572  ISDDGIFCLT--STQMRCLKVLSLGGCVGITDRCLNYLLMIRGSLVGLDLKHCPQLTKEG  629

Query  362  VDLLVERLWRCDIL  403
            +D + E LW CD+L
Sbjct  630  IDAISETLWWCDLL  643



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL+GC+N++D+ + ++   HG TLE+L+L+GC  V DASL AIA  C +L DLD+S+  
Sbjct  548  VNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCA  607

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVL  268
            ++D GIAALA G   Q +L++LSL+GC +
Sbjct  608  ITDTGIAALARGK--QINLEVLSLAGCAI  634



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 83/135 (61%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLS C+ +TDK I  +++   E L+ + L+GC  V+D S+  +A  C  L++LD+S   
Sbjct  462  LNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKVSDKSVGVLASQCRSLQELDVSNCS  520

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI A+    ++  +L+ LSLSGC   +D+ LP + K+ +SL  LN++NC G +   
Sbjct  521  ITDDGIVAVV--ISVGPTLKTLSLSGCSRVTDESLPTIQKMCDSLTALNLKNCSGFTAAA  578

Query  362  VDLLVERL-WRCDIL  403
            ++  V  L  RCDIL
Sbjct  579  LEKFVSDLGTRCDIL  593



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLS C+ +TDK I  +++   E L+ + L+GC  V+D S+  +A  C  L++LD+S   
Sbjct  514  LNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKVSDKSVGVLASQCRSLQELDVSNCS  572

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D GI A+    ++  +L+ LSLSGC   +D+ LP + K+ +SL  LN++NC G +   
Sbjct  573  ITDDGIVAVV--ISVGPTLKTLSLSGCSRVTDESLPTIQKMCDSLTALNLKNCSGFTAAA  630

Query  362  VDLLVERL-WRCDIL  403
            ++     L  RCDIL
Sbjct  631  LEKFESDLGTRCDIL  645



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 80/162 (49%), Gaps = 30/162 (19%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS---  172
            ++L  C+ + D  +         +L  L++  C     ASLA +   C  L  +D+S   
Sbjct  386  LSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGSASLAMVGKLCPQLHHVDLSGLD  445

Query  173  -------------------------KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASD  277
                                     K  ++D GIAAL+ G   + +LQILS+SGC   S+
Sbjct  446  GMTDAGLLPLLESYNCLLLNDLDLSKCAITDSGIAALSCGE--KLNLQILSVSGCSKVSN  503

Query  278  KCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  403
            K +P L KLG +L GLN+Q+C  IS   V+LL+E LWRCDIL
Sbjct  504  KSMPSLCKLGKTLLGLNLQHCNKISSSSVELLMESLWRCDIL  545



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 3/132 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+ C N+TD  ++AIA  H   LE L L+GC  V D+ L  +A  C  L++LD+S + 
Sbjct  496  LNLTNCKNITDVVVAAIAS-HCGDLERLILDGCYQVGDSGLQMLAAACPSLKELDLSGTS  554

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+ +L     +   LQ L+L+GC+  +D+ L  +     SL  LN++NC  +S  G
Sbjct  555  ITDSGLRSLVISRGLW--LQGLTLTGCINLTDESLSLIEDYCPSLGALNLRNCPLLSREG  612

Query  362  VDLLVERLWRCD  397
            +  L  +LW CD
Sbjct  613  LSALESQLWSCD  624



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 76/132 (58%), Gaps = 3/132 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NL+ C N+TD  ++AIA   G+ LE L L+GC  V D  L  +A  C +L++LD+S + 
Sbjct  486  LNLTNCKNITDVAVAAIASRCGD-LERLILDGCYQVGDNGLQTLATECPLLKELDLSGTS  544

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            ++D G+ +L     +   LQ L+ +GC+  +D+ L  +      L  LN++NC  ++  G
Sbjct  545  ITDSGLRSLVTSQGL--FLQGLTFTGCINLTDESLSSIEDFCPLLGSLNLRNCPLLTREG  602

Query  362  VDLLVERLWRCD  397
            +  L  +LW CD
Sbjct  603  LSSLESQLWSCD  614



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC  +T++ ++A+A     +L LL L+GC  VTD  +  +A     +++L ++   
Sbjct  413  LNLSGCTRLTNRALAAVASFC-PSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGCD  471

Query  182  VSDFGIAAL--AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH  355
            V+D G+ AL  A GS    SL+ LSL+GC   +D+ L  +    N+L  LN+++C G+S 
Sbjct  472  VTDDGMVALVLAKGS----SLKTLSLAGCGRVTDRSLLVMKTACNALEALNVKDCKGLSR  527

Query  356  RGVDLLVERLWRCDI  400
              ++     LWRC +
Sbjct  528  AKLEWFEAGLWRCQL  542



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            VNL GCINVTDK +  I   HG T ++L L+GC  VTDAS  AIA  C +L DLD+SK  
Sbjct  512  VNLRGCINVTDKVVLPIVNSHGCTRQVLCLDGCTRVTDASTMAIAGNCPMLSDLDVSKCA  571

Query  182  VSDFGIAALA  211
            ++D GIAALA
Sbjct  572  ITDTGIAALA  581



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLSGC  +T++ ++A+A     +L LL L+GC  VTD  +  +A     +++L ++   
Sbjct  499  LNLSGCTRLTNRALAAVASFC-PSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGCD  557

Query  182  VSDFGIAAL--AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH  355
            V+D G+ AL  A GS    SL+ LSL+GC   +D+ L  +    N+L  LN+++C G+S 
Sbjct  558  VTDDGMVALVLAKGS----SLKTLSLAGCGRVTDRSLLAMKTACNTLEALNVKDCKGLSR  613

Query  356  RGVDLLVERLWRCDI  400
              ++     LWRC +
Sbjct  614  AKLEWFEAGLWRCHL  628



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 58/106 (55%), Gaps = 2/106 (2%)
 Frame = +2

Query  83   LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC  262
            L+L+GC  VTD SL AIA  C  L +LD+S  R+SD G+  LA        LQ LSL+GC
Sbjct  464  LDLSGCRLVTDRSLRAIAQRCQELEELDLSGCRISDQGVECLASEGPSW--LQALSLAGC  521

Query  263  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  400
               +DK L  L  L  SL  LN+  C GIS   +    E  + CD+
Sbjct  522  AEITDKSLEALQTLCVSLESLNVTRCPGISQEAISSFKEVCFFCDV  567



>gb|AAL67490.1|AF459405_1 putative glucose-induced repressor-like protein [Narcissus pseudonarcissus]
Length=85

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +2

Query  152  LRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI  331
            L +L +SK+ ++D+GIA LA  SA   +L+ILS SGC   + + LP    +G +L GLN+
Sbjct  3    LEELYMSKADITDYGIALLA--SARHLNLRILSFSGCSKVTPRSLPLFGNIGPTLVGLNL  60

Query  332  QNCVGISHRGVDLLVERLWRCDILS  406
            Q C  I   G   + E++W CDI++
Sbjct  61   QQCDLIKAHGTAAIEEKMWWCDIIA  85



>ref|NP_001172897.1| Os02g0281150 [Oryza sativa Japonica Group]
 dbj|BAH91626.1| Os02g0281150 [Oryza sativa Japonica Group]
Length=367

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK--  175
            +NLSGC N++DK +  +A  + E L+ LN+  C  +TD  L  +   CS L  L++    
Sbjct  201  LNLSGCKNISDKGMQLVAD-NYEGLKKLNITRCIKLTDDGLQEVLQKCSSLESLNLYALS  259

Query  176  --SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLNIQNCVG  346
               RV+D G+ A+A G     SLQ+LSL G V  +D CL  L K    SL  L++  C+G
Sbjct  260  RCVRVTDVGVVAIAQGCR---SLQLLSLFGIVGVTDVCLEALSKHCSRSLTTLDVNGCIG  316

Query  347  ISHRGVDLLV  376
            I    VDL V
Sbjct  317  IKWWEVDLFV  326



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 69/125 (55%), Gaps = 3/125 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L+GC  V + ++ AI +    +L+ L L GCG V D   A IA  C+ L +LD+    
Sbjct  473  VDLTGCTRVGNWSVWAITRECKASLKRLVLRGCGRVNDRGAAVIARRCAKLVELDLGGCD  532

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLNIQNCVGISHR  358
            +SD G+  LA    I   L+++SL+GC   +D+ L  L K +G  L  +N+  C G+S  
Sbjct  533  ISDEGVKKLARDEPID--LEVISLAGCTRITDRSLLVLKKYMGPGLERVNVAGCTGVSKA  590

Query  359  GVDLL  373
             ++ L
Sbjct  591  VINWL  595



>emb|CBJ28117.1| Hypothetical leucine rich repeat calmodulin binding protein [Ectocarpus 
siliculosus]
Length=1536

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/136 (34%), Positives = 69/136 (51%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            ++L  CI VTD  +  IA+ H   L  LN+ GC  VT+  L ++A  C  +  LD +  +
Sbjct  209  LSLRNCIEVTDVGMWCIAR-HTTALRELNVGGCHSVTNIGLRSLAICCDNMEQLDFTSCT  267

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            R++D G+  + GG    +SL+ LSL GC   SD  +  + KL   L  LNI  C  +   
Sbjct  268  RLTDLGLRVIGGGC---WSLKSLSLEGCSHVSDTGVAEIAKLSTGLTYLNISRCERVGEY  324

Query  359  GVDLLVERLWRCDILS  406
            G   L++    C  L+
Sbjct  325  GDRALIQLGRSCHQLT  340


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 44/139 (32%), Positives = 71/139 (51%), Gaps = 23/139 (17%)
 Frame = +2

Query  8    LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-V  184
            L+GC  +T K++ A+A+     L  L+L+GCG V +  L  +A  C+ LR L+I++ R V
Sbjct  381  LTGCGGITGKSVRALAR-GCSKLRDLSLSGCGGVGNGDLKELARGCTSLRHLNIAQCRQV  439

Query  185  SDFGIAALAGG-----------------SAIQ----FSLQILSLSGCVLASDKCLPYLHK  301
            +  G+AALA G                 SA++     + Q L+LSGC   ++  +  +  
Sbjct  440  NAHGLAALARGLKNLTELDVGGCEKVDDSALRALCSMNAQFLNLSGCSAITEMGVTGIAM  499

Query  302  LGNSLAGLNIQNCVGISHR  358
               +L+ LN+  C GI  R
Sbjct  500  NCTALSSLNVTGCPGIGRR  518



>gb|ETE73360.1| F-box/LRR-repeat protein 7, partial [Ophiophagus hannah]
Length=444

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC  +R+L +S  R
Sbjct  230  LDMSDCFVLEDEGLHTIAT-HCTQLTHLYLRRCIRITDEGLRYLMIYCPSIRELSVSDCR  288

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             VSDFG+  +A    ++F L+ LS++ CV  +D  L Y+ K  + L  LN + C GI+  
Sbjct  289  FVSDFGMREIA---KLEFRLRYLSIAHCVRITDVGLRYITKYCSKLRYLNARGCEGITDH  345

Query  359  GVDLLVE  379
            G++ L +
Sbjct  346  GIEYLAK  352



>ref|XP_007426934.1| PREDICTED: F-box/LRR-repeat protein 7 [Python bivittatus]
Length=444

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC  +R+L +S  R
Sbjct  230  LDMSDCFVLEDEGLHTIAT-HCTQLTHLYLRRCIRITDEGLRYLMIYCPSIRELSVSDCR  288

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             VSDFG+  +A    ++F L+ LS++ CV  +D  + Y+ K  + L  LN + C GI+  
Sbjct  289  FVSDFGMREIA---KLEFRLRYLSIAHCVRITDVGIRYITKYCSKLRYLNARGCEGITDH  345

Query  359  GVDLLVE  379
            GV+ L +
Sbjct  346  GVEYLAK  352



>gb|EFA03310.1| hypothetical protein TcasGA2_TC013252 [Tribolium castaneum]
Length=861

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-  178
            +NL+GC  +TD + +A +K H   L+ LNL+GC  +TD SL A++D C  L  ++IS S 
Sbjct  547  LNLNGCKKLTDASCTAFSK-HCSKLQKLNLDGCSAITDNSLKALSDGCPNLTHINISWSN  605

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             V++ G+ ALA G      L+     GC   + + +  L +  + L  +N+  C  I+  
Sbjct  606  NVTENGVEALARGCR---KLKSFISKGCKQITSRAVICLARFCDQLEVVNLLGCCHITDE  662

Query  359  GVDLLVER  382
             V  L E+
Sbjct  663  AVQALAEK  670


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            VNL GC ++TD+ + A+A+     L  L L+GC  +TDASL A+A  C++L  L+++  S
Sbjct  651  VNLLGCCHITDEAVQALAE-KCPKLHYLCLSGCSALTDASLIALAQKCTLLSTLEVAGCS  709

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            + +D G  ALA        L+ + L  CVL +D  L +L      +  L + +C  I+  
Sbjct  710  QFTDAGFQALARSCRY---LEKMDLDECVLITDNTLIHLAMGCPRIEYLTLSHCELITDE  766

Query  359  GV  364
            G+
Sbjct  767  GI  768



>ref|XP_785847.3| PREDICTED: F-box/LRR-repeat protein 7-like [Strongylocentrotus 
purpuratus]
Length=543

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            ++++ C  +TD  + AIAK H   L  LN+ GC  V+D SL A++  C  LR LD+ K  
Sbjct  406  LSVAKCELITDMGVYAIAK-HCYKLRYLNVRGCVLVSDKSLEALSRGCPRLRSLDVGKCP  464

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             ++D G+ ++A       SL+ LSL GC+  +D+ +  L ++   L  LNIQ+C  +S  
Sbjct  465  LITDHGLVSIATNCQ---SLRKLSLKGCLHVTDQVIEVLAQVCPDLQQLNIQDCDEVSRE  521

Query  359  GVDLL  373
               LL
Sbjct  522  AYRLL  526



>ref|XP_009059139.1| hypothetical protein LOTGIDRAFT_164359 [Lottia gigantea]
 gb|ESO90056.1| hypothetical protein LOTGIDRAFT_164359 [Lottia gigantea]
Length=406

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 71/125 (57%), Gaps = 5/125 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  + D  +  IA +H   L+ L L  C  +TD S+  +A+YCS LR+L +S  R
Sbjct  193  LDMTDCFALDDDGLGVIA-MHCSQLQFLYLRRCVQLTDESMQYLANYCSTLRELSVSDCR  251

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             ++D G+  L   S +  +L+ LS++ C   SD  + YL K  + L  LN++ C G+S  
Sbjct  252  NITDLGLRDL---SKLGDNLRYLSVAKCDRMSDVGVRYLAKFCSKLRYLNVRGCEGVSDE  308

Query  359  GVDLL  373
             ++LL
Sbjct  309  SLELL  313


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 65/133 (49%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  ++D  +  +AK   + L  LN+ GC  V+D SL  ++  C  LR LD+ K  
Sbjct  271  LSVAKCDRMSDVGVRYLAKFCSK-LRYLNVRGCEGVSDESLELLSASCPRLRSLDVGKCD  329

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            +SD G+  L+        L+ LSL  C   +DK +  L      L  LNIQ+C  IS  G
Sbjct  330  ISDQGLVVLSQNCP---QLRKLSLKACDSITDKGVVQLAYYCRGLQQLNIQDC-NISVEG  385

Query  362  VDLLVERLWRCDI  400
               +     RC I
Sbjct  386  YKRVKRYCRRCII  398



>dbj|GAN11538.1| conserved hypothetical protein [Mucor ambiguus]
Length=807

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLS C  VTD     + +     LE L+LN C  +TD SLA +A  C  L  LD+S  R
Sbjct  538  LNLSQCFYVTDDGFGRLIE-QLPNLETLDLNSCWLLTDKSLALLAATCPRLNRLDLSNCR  596

Query  182  -VSDFGI-AALAGGSAIQF-SLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNIQNCVGI  349
             +SD GI   L    A  F  L+ LSLS C   SD  + YL +   N+L  LNIQ C  I
Sbjct  597  KISDIGIFKMLDEKQARGFPELKELSLSYCKKLSDMTMSYLAEFCSNTLESLNIQRCTRI  656

Query  350  SHRG  361
            + +G
Sbjct  657  TDQG  660



>ref|XP_007365012.1| RNI-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF62300.1| RNI-like protein [Dichomitus squalens LYAD-421 SS1]
Length=446

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 74/136 (54%), Gaps = 6/136 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KS  178
            +N++GC+ +TD+ +  I KL  + L  +++ G G VTDA + AIA  C+ LR +DIS   
Sbjct  241  LNVAGCVELTDRAMHEICKLR-DHLSEIDVAGLGRVTDAGVFAIASTCTRLRSVDISFMP  299

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            R++D  I  LA        L+ L+ +G    +D+   +L +    LA L++  C  ++  
Sbjct  300  RLTDLAIQELATLP----RLRRLAAAGLPRVTDQAAFFLAEHARGLAQLHLSFCTRLTLE  355

Query  359  GVDLLVERLWRCDILS  406
            GV  L+ RL   + LS
Sbjct  356  GVRALLRRLAELEYLS  371



>gb|KFB45523.1| Dsec\GM15616-PA-like protein [Anopheles sinensis]
Length=494

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 73/129 (57%), Gaps = 7/129 (5%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            +NLS C++VTD  +  +A++    LE LNL  C  ++D  +A + D CS +  LD+S   
Sbjct  333  INLSFCVSVTDSGLKHLARM--SRLEELNLRACDNISDIGMAYLTDGCSSISTLDVSFCD  390

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            +V+D  +  ++ G    F L+ LSLS C + +D+ L  + K  + L  LNI  C  I+ R
Sbjct  391  KVADQAMVHISQG---LFQLRSLSLSACQI-TDEGLSRIAKSLHDLETLNIGQCSRITDR  446

Query  359  GVDLLVERL  385
            G++ + E L
Sbjct  447  GLETVAEEL  455



>ref|XP_009032915.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
 gb|EGB11841.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
Length=330

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-  178
            ++L+GC  VTD  +S +A   G TLE+ NL GC  +T+A   AIAD+C V+R +D+  + 
Sbjct  94   LDLNGCEMVTDVGVSWVAHQAGATLEVFNLRGCNRLTNAGCRAIADHCHVIRVVDLRGAR  153

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASD--------KCLPYLHKLGNSLAGLNIQ  334
            RV+D G+  L  G+A+  +L+ L +S   L +D        + L  L +    L  L++ 
Sbjct  154  RVTDVGVRVL--GAALGDTLETLDISSMHLVTDGVDRGFGFEGLLALAQDVTRLKCLHLD  211

Query  335  NCVGISHRGVDLLVE  379
             C  +S+R ++ L +
Sbjct  212  GCFQVSNRALNALAK  226



>ref|XP_009592242.1| PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana tomentosiformis]
Length=412

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 5/119 (4%)
 Frame = +2

Query  26   VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIA  202
            VTD  +S IA      L++L+L  C  +TD  +AAI    S L+ LDIS  R ++D G++
Sbjct  91   VTDSDLSVIAAAFS-CLKILSLQNCKGITDNGMAAIGSSLSYLQSLDISYCRKITDKGLS  149

Query  203  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE  379
            A+A G      L+ L L+GC   SD  L  L K  +SL  L +Q C  I++ G+ +LVE
Sbjct  150  AVAEGCR---DLRTLHLAGCRFVSDSLLEALSKNCHSLEELGLQGCTNITNSGLSVLVE  205


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            ++L+GC  V+D  + A++K +  +LE L L GC  +T++ L+ + + C  ++ LDI+K S
Sbjct  161  LHLAGCRFVSDSLLEALSK-NCHSLEELGLQGCTNITNSGLSVLVEGCRRIKHLDINKCS  219

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             V D GI++++   A   +L+ L L  C    D+ +  L     +L  L I  C  IS  
Sbjct  220  NVGDIGISSVS--KACSLTLRTLKLLDCYKVGDESILSLASYCKNLETLVIGGCRNISDE  277

Query  359  GV  364
             +
Sbjct  278  SM  279



>gb|EFX86579.1| hypothetical protein DAPPUDRAFT_208061 [Daphnia pulex]
Length=431

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            +NL+ C  +TD T  A+++ H   L+ LNL+ C  +TD +L A+AD C  L  +D+S   
Sbjct  117  LNLNQCKRITDSTCLALSR-HCVKLQRLNLSSCPAITDQALKALADGCPQLVYIDLSWCD  175

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             VS  G+  LA G      L      GC+L  D  L +L +  + L  +NIQ C+ ++  
Sbjct  176  LVSQNGVEVLAKGCP---GLMTFHCRGCILIGDDALTHLARFCSRLHTVNIQGCLEVTDV  232

Query  359  GV  364
            GV
Sbjct  233  GV  234


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            VN+ GC+ VTD  ++ +A+   E +  L L+GCG +TDA+L++++ +C  L  L++++ S
Sbjct  221  VNIQGCLEVTDVGVARLARSCPE-MRYLCLSGCGHLTDATLSSLSQHCPQLATLEVARCS  279

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
              +D G  ALA    +   L+ + L  CVL +D  L YL      L  L++ +C  I+  
Sbjct  280  LFTDIGFQALARNCHL---LKRMDLEECVLITDAALSYLAAGCPRLEKLSLSHCELITDD  336

Query  359  GV  364
            G+
Sbjct  337  GI  338



>ref|XP_003727308.1| PREDICTED: protein AMN1 homolog [Strongylocentrotus purpuratus]
Length=264

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V L  C+++ D +  A+A+   + +EL NL GC  +TDASL AI   C +L+ L+IS+++
Sbjct  125  VYLRRCVSLEDPSTIALAQSCHQLMEL-NLGGCIRLTDASLQAIGQNCRMLKSLNISRTK  183

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG  361
            V+D GI +L  G   Q SL+ L L+ C+  SD+ +  +      +A L    C  I+ R 
Sbjct  184  VTDEGIFSLCNGVCKQ-SLKELHLNNCIHLSDEAVEAVVNFCPKIAILLFHGCPCITDRS  242



>ref|XP_008870641.1| hypothetical protein H310_07119 [Aphanomyces invadans]
 gb|ETW00506.1| hypothetical protein H310_07119 [Aphanomyces invadans]
Length=1046

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 45/129 (35%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            VNL G INVTD  +         +L +L++  C  +TD SLAAI  +C  LR +++    
Sbjct  223  VNLEGLINVTDAGMVKFVA-GCRSLRVLHVKRCVQITDRSLAAIGAHCRHLRSINLCGCG  281

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            RV+  G+A+L  G++    LQ + + GC L +++ L  +     +L  LN+  C  I+  
Sbjct  282  RVTTDGMASLVRGAS---QLQAIDVQGCNLLTEEFLCVVATHLPALQLLNVNGCQQITDN  338

Query  359  GVDLLVERL  385
            GV  LVE L
Sbjct  339  GVRTLVEHL  347



>ref|XP_001630901.1| predicted protein [Nematostella vectensis]
 gb|EDO38838.1| predicted protein, partial [Nematostella vectensis]
Length=225

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  17   CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDF  193
            C  VTD +++ +A  H   L+ LNL G   +T+  L AIA  C  L  L +S  SRVSD 
Sbjct  77   CHAVTDTSLTHVAN-HCPGLQRLNLTGKSLITNRGLGAIARSCGDLEQLFLSGCSRVSDR  135

Query  194  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL  373
            G+  LA        L+ LSLS C+  +DK L  + +  +SL  L++  CV I+ RG+  L
Sbjct  136  GVRTLASKCP---KLEKLSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKAL  192


 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 73/127 (57%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-  178
            +NL+G   +T++ + AIA+  G+ LE L L+GC  V+D  +  +A  C  L  L +S   
Sbjct  98   LNLTGKSLITNRGLGAIARSCGD-LEQLFLSGCSRVSDRGVRTLASKCPKLEKLSLSNCL  156

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            R++D  ++A++   +   SL+ L LSGCV  +D+ +  L +    L  +N+++  GIS  
Sbjct  157  RLTDKSLSAISRKCS---SLKTLDLSGCVKITDRGIKALSRYSEHLTDINLKDTTGISIE  213

Query  359  GVDLLVE  379
            G++LL  
Sbjct  214  GIELLAR  220



>gb|KFO34898.1| F-box/LRR-repeat protein 20 [Fukomys damarensis]
Length=858

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 69/145 (48%), Gaps = 25/145 (17%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            ++L GC+ V D  +   A+ +   +E+LNLNGC   TDA+  +++ +CS LR LD++  +
Sbjct  84   LSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCT  142

Query  179  RVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGCVLASDKCLP  289
             +++  + AL+ G  +   L I                       L L GC    D+ L 
Sbjct  143  SITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALK  202

Query  290  YLHKLGNSLAGLNIQNCVGISHRGV  364
            Y+      L  LN+Q C+ I+  G+
Sbjct  203  YIGAHCPELVTLNLQTCLQITDEGL  227



>gb|EFX60588.1| hypothetical protein DAPPUDRAFT_71291 [Daphnia pulex]
Length=154

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 4/114 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  ++D  I  I + H   L  LNL GC  V+D SL  +A  CS LR LD+ K  
Sbjct  19   LSVAKCDQISDAGIKQIGR-HCYKLRYLNLRGCEAVSDDSLEVLARTCSRLRALDLGKCD  77

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCV  343
            ++D G+  LA       +L+ LS+  C L +D+ +  +      L  LNIQ+C+
Sbjct  78   ITDRGLRLLAEHCP---NLKKLSVKSCELVTDEGVRSIAYYCRGLRQLNIQDCL  128



>gb|ETN67361.1| partner of paired [Anopheles darlingi]
Length=493

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            +NLS C++VTD  +  +A++    L+ LNL  C  ++D  +A + + CS +  LD+S   
Sbjct  332  INLSFCVSVTDSGLKHLARM--SCLKELNLRACDNISDIGMAYLTEGCSAIATLDVSFCD  389

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            +V+D  +  ++ G    F L+ LSLS C + +D+ L  + K  + L  LNI  C  I+ R
Sbjct  390  KVADQAMVHISQG---LFQLRSLSLSACQI-TDEGLSRIAKSLHDLETLNIGQCSRITDR  445

Query  359  GVDLLVERL  385
            G++++ E L
Sbjct  446  GLEMIAEEL  454



>ref|XP_008107062.1| PREDICTED: F-box/LRR-repeat protein 7 isoform X2 [Anolis carolinensis]
 ref|XP_008107063.1| PREDICTED: F-box/LRR-repeat protein 7 isoform X2 [Anolis carolinensis]
Length=444

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +R+L +S  R
Sbjct  230  LDMSDCFVLEDEGLHTIAA-HCTQLTHLYLRRCIRITDEGLRYLMIYCTFIRELSVSDCR  288

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C GI+  
Sbjct  289  FVSDFGMREIA---KLESRLRYLSIAHCARITDVGIRYITKYCSKLRYLNARGCEGITDH  345

Query  359  GVDLLVE  379
            GV+ L +
Sbjct  346  GVEYLAK  352



>emb|CDS16257.1| fbxl20 [Echinococcus granulosus]
Length=467

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 72/131 (55%), Gaps = 2/131 (2%)
 Frame = +2

Query  11   SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVS  187
            S CI +TD  ++A+A+ +   LE L+L  C  VTDA+L  +A YC  +  L +S   +++
Sbjct  311  SQCIQITDAGLAALAR-NCVNLEKLDLEYCSQVTDATLVQLATYCPRINTLVLSHCDQIT  369

Query  188  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD  367
            D GI  L GG      LQ L++  C L +D  L  L  +  +L  +++ +C  I+ +G++
Sbjct  370  DEGITRLVGGLCGPQQLQRLAMDNCPLLTDSSLEMLGSVCQNLCQVDLYDCQLITRQGIE  429

Query  368  LLVERLWRCDI  400
             L ++  R  I
Sbjct  430  NLKQQNPRLKI  440



>emb|CEI94275.1| hypothetical protein RMCBS344292_08489 [Rhizopus microsporus]
Length=333

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 74/131 (56%), Gaps = 11/131 (8%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI----  169
            ++L+GC  +TD  I ++A  H   L  L+L  CG ++DAS++ IA+ C  L  L++    
Sbjct  149  ISLAGCNKITDSFIISVAH-HCPRLSHLDLRACGQISDASISVIAEKCRNLHHLNVGRVR  207

Query  170  SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLNIQNCVG  346
             + R+S   I+ +A  + +     +L L+GC + +D+CL  L K  GN L  +++ NC  
Sbjct  208  DRDRISIQSISLIAKYTKV----AVLGLAGCDM-TDECLVMLAKHRGNKLERISVNNCYK  262

Query  347  ISHRGVDLLVE  379
            +++R +   V+
Sbjct  263  LTNRTIQAFVK  273



>ref|XP_008107061.1| PREDICTED: F-box/LRR-repeat protein 7 isoform X1 [Anolis carolinensis]
Length=491

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +R+L +S  R
Sbjct  277  LDMSDCFVLEDEGLHTIAA-HCTQLTHLYLRRCIRITDEGLRYLMIYCTFIRELSVSDCR  335

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C GI+  
Sbjct  336  FVSDFGMREIA---KLESRLRYLSIAHCARITDVGIRYITKYCSKLRYLNARGCEGITDH  392

Query  359  GVDLLVE  379
            GV+ L +
Sbjct  393  GVEYLAK  399



>ref|XP_009173095.1| hypothetical protein T265_08903 [Opisthorchis viverrini]
 gb|KER23171.1| hypothetical protein T265_08903 [Opisthorchis viverrini]
Length=564

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            + ++ C  +TD  ++A+A++  + LE L+L  C  VTDASLA +A +C  L +L +S   
Sbjct  405  LEIARCTAITDIGLTAVARVCNK-LEKLDLEDCALVTDASLAQLAVHCPHLNNLILSHCD  463

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            +++D GIA LA G      LQ L++  C L +D  L +L      L  L++ +C  I+ +
Sbjct  464  QITDEGIARLAEGLCGPDQLQELAMDNCPLLTDTALEHLGSNCRRLQRLDLYDCQQITKQ  523

Query  359  GV  364
            G+
Sbjct  524  GI  525



>gb|EUB63603.1| F-box/LRR-repeat protein 2 [Echinococcus granulosus]
Length=551

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 72/131 (55%), Gaps = 2/131 (2%)
 Frame = +2

Query  11   SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVS  187
            S CI +TD  ++A+A+ +   LE L+L  C  VTDA+L  +A YC  +  L +S   +++
Sbjct  395  SQCIQITDAGLAALAR-NCVNLEKLDLEYCSQVTDATLVQLATYCPRINTLVLSHCDQIT  453

Query  188  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD  367
            D GI  L GG      LQ L++  C L +D  L  L  +  +L  +++ +C  I+ +G++
Sbjct  454  DEGITRLVGGLCGPQQLQRLAMDNCPLLTDSSLEMLGSVCQNLCQVDLYDCQLITRQGIE  513

Query  368  LLVERLWRCDI  400
             L ++  R  I
Sbjct  514  NLKQQNPRLKI  524



>gb|KFQ73642.1| F-box/LRR-repeat protein 20 [Phoenicopterus ruber ruber]
Length=422

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 71/145 (49%), Gaps = 25/145 (17%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            ++L GC+ V D  +   A+ +   +E+LNLNGC  +TDA+  +++ +CS LR LD++  +
Sbjct  82   LSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKITDATCTSLSKFCSKLRHLDLASCT  140

Query  179  RVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGCVLASDKCLP  289
             +++  + AL+ G  +   L I                       LSL GC    D+ L 
Sbjct  141  SITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALSLKGCTQLEDEALK  200

Query  290  YLHKLGNSLAGLNIQNCVGISHRGV  364
            Y+      L  LN+Q C+ I+  G+
Sbjct  201  YIGAHCPELVTLNLQTCLQITDDGL  225



>dbj|GAA54333.1| F-box and leucine-rich repeat protein 2/20 [Clonorchis sinensis]
Length=699

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S  178
            + ++ C  +TD  ++A+A++  + LE L+L  C  VTDASLA +A +C  L +L +S   
Sbjct  547  LEIARCTAITDIGLTAVARVCNK-LEKLDLEDCALVTDASLAQLAVHCPHLNNLILSHCD  605

Query  179  RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
            +++D GIA LA G      LQ L++  C L +D  L +L      L  L++ +C  I+ +
Sbjct  606  QITDEGIARLAEGLCGPDQLQELAMDNCPLLTDTALEHLGSNCRRLQRLDLYDCQQITKQ  665

Query  359  GV  364
            G+
Sbjct  666  GI  667



>emb|CDJ03778.1| fbxl20 [Echinococcus multilocularis]
 emb|CDS41060.1| fbxl20 [Echinococcus multilocularis]
Length=479

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 72/131 (55%), Gaps = 2/131 (2%)
 Frame = +2

Query  11   SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVS  187
            S CI +TD  ++A+A+ +   LE L+L  C  VTDA+L  +A YC  +  L +S   +++
Sbjct  323  SQCIQITDAGLAALAR-NCVNLEKLDLEYCSQVTDATLVQLATYCPRINTLVLSHCDQIT  381

Query  188  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD  367
            D GI  L GG      LQ L++  C L +D  L  L  +  +L  +++ +C  I+ +G++
Sbjct  382  DEGITRLVGGLCGPQQLQRLAMDNCPLLTDSSLEMLGSVCQNLCQVDLYDCQLITRQGIE  441

Query  368  LLVERLWRCDI  400
             L ++  R  I
Sbjct  442  NLKQQNPRLKI  452



>ref|XP_004611387.1| PREDICTED: protein AMN1 homolog [Sorex araneus]
Length=216

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            V+L  C ++TD  + A A+ H   L ++ LNGC  +TDA+L A+ ++CSVL+ +D S ++
Sbjct  77   VSLKWCHSLTDDGVLAFAR-HCRLLRIVQLNGCSGLTDAALRALGEHCSVLQCIDFSFTQ  135

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDK  280
            VSD G+ AL  G   Q  L+ +++  C   +D+
Sbjct  136  VSDDGVVALVSGPCAQ-KLEEINMGYCANLTDE  167



>ref|XP_010243424.1| PREDICTED: F-box protein At3g58530 [Nelumbo nucifera]
Length=376

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 78/178 (44%), Gaps = 56/178 (31%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD-----  166
            +NLSGC N+TDK++  IA  + E LE LNL  C  VTD  L  +   C +LR L+     
Sbjct  191  LNLSGCKNITDKSLHLIADNYQE-LEFLNLTRCVKVTDGGLQQVLLKCCLLRSLNLYALS  249

Query  167  ----------------------------------ISKSR------------VSDFGIAAL  208
                                              I+K +            ++D G+ A+
Sbjct  250  SFTDEAYKKIAVLAHLRFLDLCGAQNLSDQGLSCIAKCKNLVSLNLTWCVQITDVGVIAI  309

Query  209  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNIQNCVGISHRGVDLLVE  379
            A G     SL+ LSL G V  +D+CL  L +   N+LA L++  C+GI  R  D L++
Sbjct  310  AEGCC---SLEFLSLFGIVGVTDRCLEVLSRFCSNTLATLDVNGCIGIKRRSRDELLQ  364



>gb|EPB81854.1| hypothetical protein HMPREF1544_11403 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=806

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 63/124 (51%), Gaps = 5/124 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            +NLS C  +TD     +       +E L+LN C  +TD SLA +A  C  L  LD+S  R
Sbjct  537  LNLSQCFYITDDGFQRLMD-QLPNVESLDLNSCWLLTDKSLALLAVNCPRLTRLDLSNCR  595

Query  182  -VSDFGIAALAGGSAIQ--FSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNIQNCVGI  349
             +SD GI  +      +    L+ LSLS C   SD  + +L +   N+L  LNIQ C  I
Sbjct  596  KISDIGIFKMLDEKQTRGFLGLKELSLSYCKKLSDMTMSHLAEFCSNTLESLNIQRCTRI  655

Query  350  SHRG  361
            S +G
Sbjct  656  SDQG  659



>gb|ELT99813.1| hypothetical protein CAPTEDRAFT_133834 [Capitella teleta]
Length=405

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 5/125 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C N+ D  +  IA  +   L  L L  C  +TD  +  +A+YCS LR+  IS  R
Sbjct  191  LDMTDCFNLEDSGLQIIAS-YCSQLVYLYLRRCYKITDIGVQYVANYCSNLREFSISDCR  249

Query  182  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  358
             V+DF +  L   S ++ +L+ LS++ C   SD  + Y+ +    L  LN++ C G+S  
Sbjct  250  NVTDFCLREL---SKLESNLRYLSVAKCEKLSDVGVKYIARYCRKLRYLNVRGCEGVSDD  306

Query  359  GVDLL  373
             V++L
Sbjct  307  SVEML  311


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  ++D  +  IA+ +   L  LN+ GC  V+D S+  +A  C  L+ LDI K  
Sbjct  269  LSVAKCEKLSDVGVKYIAR-YCRKLRYLNVRGCEGVSDDSVEMLARSCRRLKSLDIGKCD  327

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC  340
            V+D G+  LA       +L+ LSL  C   +D+ +  L      L  LNIQ+C
Sbjct  328  VTDDGLRVLAEHCP---NLRKLSLKSCEAITDRGIVSLVHRCRQLQQLNIQDC  377



>gb|EKC18517.1| F-box/LRR-repeat protein 7 [Crassostrea gigas]
Length=673

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  ++D  I  + K H   L  LNL GC  V+D S+  +A +CS ++ LDI K  
Sbjct  538  LSVAKCDKISDVGIIQLCK-HCTKLRYLNLRGCEAVSDDSMDVLARHCSKIKSLDIGKCD  596

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC  340
            V+D G+  LA        L+ LSL  C   +D  + ++ K    L   NIQ+C
Sbjct  597  VTDEGLCVLAQNCP---QLKKLSLKSCDAITDAGVKFVAKSCRQLQQFNIQDC  646



>ref|XP_011418884.1| PREDICTED: F-box/LRR-repeat protein 7-like isoform X2 [Crassostrea 
gigas]
Length=618

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = +2

Query  2    VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  181
            ++++ C  ++D  I  + K H   L  LNL GC  V+D S+  +A +CS ++ LDI K  
Sbjct  483  LSVAKCDKISDVGIIQLCK-HCTKLRYLNLRGCEAVSDDSMDVLARHCSKIKSLDIGKCD  541

Query  182  VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC  340
            V+D G+  LA        L+ LSL  C   +D  + ++ K    L   NIQ+C
Sbjct  542  VTDEGLCVLAQNCP---QLKKLSLKSCDAITDAGVKFVAKSCRQLQQFNIQDC  591



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940