BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS103A01

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFQ00710.1|  pyrophosphate-energized vacuolar membrane proteon...    291   7e-90   Ipomoea batatas [batate]
gb|KJB23659.1|  hypothetical protein B456_004G108700                    276   7e-85   Gossypium raimondii
ref|XP_009598387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    278   8e-85   Nicotiana tomentosiformis
ref|XP_009779977.1|  PREDICTED: pyrophosphate-energized vacuolar ...    277   1e-84   Nicotiana sylvestris
emb|CAA58700.1|  inorganic pyrophosphatase                              277   1e-84   Nicotiana tabacum [American tobacco]
ref|XP_010323159.1|  PREDICTED: vacuolar-type H+-pyrophosphatase ...    276   2e-84   
gb|KJB23657.1|  hypothetical protein B456_004G108700                    276   3e-84   Gossypium raimondii
gb|KHG19866.1|  Pyrophosphate-energized vacuolar membrane proton ...    276   4e-84   Gossypium arboreum [tree cotton]
ref|XP_007013601.1|  Inorganic H pyrophosphatase family protein i...    273   3e-83   
ref|NP_001265905.1|  vacuolar-type H+-pyrophosphatase                   273   4e-83   
ref|XP_011084078.1|  PREDICTED: pyrophosphate-energized vacuolar ...    274   4e-83   
ref|XP_006359496.1|  PREDICTED: pyrophosphate-energized vacuolar ...    273   4e-83   Solanum tuberosum [potatoes]
ref|XP_007013600.1|  Inorganic H pyrophosphatase family protein i...    272   8e-83   
gb|KJB53982.1|  hypothetical protein B456_009G014500                    268   9e-83   Gossypium raimondii
gb|KHN15033.1|  Pyrophosphate-energized vacuolar membrane proton ...    271   1e-82   Glycine soja [wild soybean]
ref|XP_007155080.1|  hypothetical protein PHAVU_003G171500g             271   1e-82   Phaseolus vulgaris [French bean]
ref|XP_003542656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   3e-82   Glycine max [soybeans]
ref|XP_004251737.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   4e-82   Solanum lycopersicum
ref|XP_009595111.1|  PREDICTED: pyrophosphate-energized vacuolar ...    270   4e-82   Nicotiana tomentosiformis
ref|XP_010097004.1|  Pyrophosphate-energized vacuolar membrane pr...    270   6e-82   Morus notabilis
ref|XP_011017877.1|  PREDICTED: pyrophosphate-energized vacuolar ...    270   8e-82   Populus euphratica
gb|ABF85694.1|  inorganic pyrophosphatase                               269   1e-81   Nicotiana rustica [wild tobacco]
ref|XP_006350116.1|  PREDICTED: pyrophosphate-energized vacuolar ...    269   1e-81   Solanum tuberosum [potatoes]
ref|XP_003609464.1|  Vacuolar proton-inorganic pyrophosphatase          268   1e-81   
ref|XP_009628297.1|  PREDICTED: pyrophosphate-energized vacuolar ...    269   1e-81   Nicotiana tomentosiformis
gb|KDP30223.1|  hypothetical protein JCGZ_17005                         269   1e-81   Jatropha curcas
ref|XP_006381091.1|  Pyrophosphate-energized vacuolar membrane pr...    269   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_009796113.1|  PREDICTED: pyrophosphate-energized vacuolar ...    269   2e-81   Nicotiana sylvestris
ref|XP_007204643.1|  hypothetical protein PRUPE_ppa001782mg             269   2e-81   Prunus persica
gb|KJB53981.1|  hypothetical protein B456_009G014500                    269   2e-81   Gossypium raimondii
gb|KJB83229.1|  hypothetical protein B456_013G236400                    269   2e-81   Gossypium raimondii
ref|XP_004508424.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   2e-81   Cicer arietinum [garbanzo]
ref|XP_008242846.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   2e-81   
ref|XP_011078537.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   3e-81   Sesamum indicum [beniseed]
ref|XP_006389422.1|  Pyrophosphate-energized vacuolar membrane pr...    268   3e-81   Populus trichocarpa [western balsam poplar]
emb|CDP10479.1|  unnamed protein product                                268   3e-81   Coffea canephora [robusta coffee]
emb|CAA58701.1|  inorganic pyrophosphatase                              268   3e-81   Nicotiana tabacum [American tobacco]
gb|KHG04918.1|  Pyrophosphate-energized vacuolar membrane proton ...    268   3e-81   Gossypium arboreum [tree cotton]
ref|XP_003609463.1|  Vacuolar proton-inorganic pyrophosphatase          268   3e-81   Medicago truncatula
ref|XP_010250265.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   4e-81   Nelumbo nucifera [Indian lotus]
gb|KJB83230.1|  hypothetical protein B456_013G236400                    268   4e-81   Gossypium raimondii
gb|AHA38114.1|  vacuolar H+-pyrophosphatase                             266   2e-80   Sesuvium portulacastrum [sea-purslane]
dbj|BAA23649.1|  proton pyrophosphatase                                 266   2e-80   Vigna radiata [mung bean]
ref|XP_006474386.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   2e-80   
sp|P21616.4|AVP_VIGRR  RecName: Full=Pyrophosphate-energized vacu...    266   2e-80   Vigna radiata var. radiata [golden gram]
gb|AAC49175.1|  pyrophosphatase                                         266   2e-80   Vigna radiata [mung bean]
ref|XP_009791988.1|  PREDICTED: pyrophosphate-energized vacuolar ...    266   2e-80   Nicotiana sylvestris
ref|XP_009363953.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   4e-80   Pyrus x bretschneideri [bai li]
gb|KDO73437.1|  hypothetical protein CISIN_1g004159mg                   264   4e-80   Citrus sinensis [apfelsine]
ref|XP_011020230.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   4e-80   Populus euphratica
ref|XP_011073387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   4e-80   Sesamum indicum [beniseed]
ref|XP_010097186.1|  Pyrophosphate-energized vacuolar membrane pr...    265   4e-80   Morus notabilis
ref|XP_011081989.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   5e-80   Sesamum indicum [beniseed]
dbj|BAA33149.1|  proton-translocating inorganic pyrophosphatase         265   6e-80   Cucurbita moschata [ayote]
gb|KHF98453.1|  Pyrophosphate-energized vacuolar membrane proton ...    265   6e-80   Gossypium arboreum [tree cotton]
ref|XP_006453118.1|  hypothetical protein CICLE_v10007524mg             265   7e-80   Citrus clementina [clementine]
emb|CDO98179.1|  unnamed protein product                                264   7e-80   Coffea canephora [robusta coffee]
ref|XP_010244912.1|  PREDICTED: pyrophosphate-energized vacuolar ...    264   1e-79   Nelumbo nucifera [Indian lotus]
gb|KDO73436.1|  hypothetical protein CISIN_1g004159mg                   264   1e-79   Citrus sinensis [apfelsine]
ref|XP_004173355.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-79   
ref|XP_006341399.1|  PREDICTED: pyrophosphate-energized vacuolar ...    262   5e-79   Solanum tuberosum [potatoes]
gb|KJB64658.1|  hypothetical protein B456_010G059800                    257   5e-79   Gossypium raimondii
ref|XP_009593516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    262   6e-79   Nicotiana tomentosiformis
gb|KJB56582.1|  hypothetical protein B456_009G126900                    261   6e-79   Gossypium raimondii
gb|KJB56580.1|  hypothetical protein B456_009G126900                    261   8e-79   Gossypium raimondii
gb|ADN96173.1|  pyrophosphate-energized vacuolar membrane proton ...    261   1e-78   Gossypium hirsutum [American cotton]
ref|XP_003531725.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   2e-78   Glycine max [soybeans]
ref|XP_010928300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   2e-78   Elaeis guineensis
ref|XP_009358552.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_010913343.1|  PREDICTED: pyrophosphate-energized vacuolar ...    260   3e-78   Elaeis guineensis
ref|XP_007023297.1|  Inorganic H pyrophosphatase family protein i...    260   3e-78   
ref|XP_007023298.1|  Inorganic H pyrophosphatase family protein i...    260   4e-78   
gb|KJB35139.1|  hypothetical protein B456_006G102100                    259   6e-78   Gossypium raimondii
gb|EYU40132.1|  hypothetical protein MIMGU_mgv1a001763mg                259   6e-78   Erythranthe guttata [common monkey flower]
gb|KDP37047.1|  hypothetical protein JCGZ_06103                         259   6e-78   Jatropha curcas
ref|XP_004241690.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   7e-78   Solanum lycopersicum
ref|XP_003528302.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   8e-78   Glycine max [soybeans]
ref|XP_004235902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   1e-77   
gb|KJB64656.1|  hypothetical protein B456_010G059800                    258   1e-77   Gossypium raimondii
gb|KHG25943.1|  Pyrophosphate-energized vacuolar membrane proton ...    259   1e-77   Gossypium arboreum [tree cotton]
ref|XP_006427442.1|  hypothetical protein CICLE_v10024946mg             256   2e-77   
gb|AAS66771.1|  PPase                                                   258   2e-77   Hevea brasiliensis [jebe]
ref|XP_009765177.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-77   Nicotiana sylvestris
emb|CAA54869.1|  inorganic pyrophosphatase                              258   2e-77   Nicotiana tabacum [American tobacco]
ref|XP_004287260.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    258   2e-77   Fragaria vesca subsp. vesca
ref|XP_004150506.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-77   
ref|XP_008343930.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-77   
ref|XP_008352108.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-77   
gb|AAM97920.1|  vacuolar proton-pumping PPase                           258   2e-77   Oxybasis rubra [pigweed]
gb|KJB64657.1|  hypothetical protein B456_010G059800                    257   2e-77   Gossypium raimondii
gb|KJB64655.1|  hypothetical protein B456_010G059800                    258   2e-77   Gossypium raimondii
ref|XP_008443926.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   3e-77   Cucumis melo [Oriental melon]
gb|ABK91685.1|  vacuolar H+-pyrophosphatase                             258   3e-77   Kalidium foliatum
gb|AEI17665.1|  vacuolar H+-pyrophosphatase                             257   5e-77   Salicornia europaea [chicken-claws]
ref|XP_009392139.1|  PREDICTED: pyrophosphate-energized vacuolar ...    257   5e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006427443.1|  hypothetical protein CICLE_v10024946mg             256   5e-77   
gb|ADD51840.1|  pyrophosphatase                                         257   6e-77   Cucumis sativus [cucumbers]
ref|XP_006427441.1|  hypothetical protein CICLE_v10024946mg             256   8e-77   Citrus clementina [clementine]
ref|XP_008788803.1|  PREDICTED: pyrophosphate-energized vacuolar ...    256   9e-77   Phoenix dactylifera
gb|KHN38003.1|  Pyrophosphate-energized vacuolar membrane proton ...    256   1e-76   Glycine soja [wild soybean]
gb|AGQ50316.1|  vaculoar H+ pyrophosphatase                             256   1e-76   Prosopis juliflora [algorrobo]
gb|EYU34952.1|  hypothetical protein MIMGU_mgv1a001747mg                256   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_006492091.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   2e-76   Citrus sinensis [apfelsine]
ref|XP_010050115.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   2e-76   Eucalyptus grandis [rose gum]
ref|XP_008795832.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   2e-76   Phoenix dactylifera
ref|XP_010927355.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   2e-76   Elaeis guineensis
ref|XP_008801902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   3e-76   Phoenix dactylifera
ref|XP_002530755.1|  Pyrophosphate-energized vacuolar membrane pr...    255   3e-76   Ricinus communis
ref|XP_009403196.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   4e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABS01290.1|  tonoplast proton pump                                   254   5e-76   Lotus corniculatus
ref|XP_009418179.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687850.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   7e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS68114.1|  inorganic pyrophosphatase                               254   8e-76   Genlisea aurea
ref|XP_010905999.1|  PREDICTED: pyrophosphate-energized vacuolar ...    253   1e-75   Elaeis guineensis
gb|AAA61610.1|  pyrophosphatase                                         253   2e-75   Beta vulgaris [beet]
ref|XP_009407207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    252   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    252   4e-75   Vitis vinifera
gb|ADQ00196.1|  vacuolar H+-PPase protein                               251   7e-75   Suaeda corniculata
gb|ABO45933.1|  vacuolar H+-pyrophosphatase                             251   7e-75   Halostachys caspica
ref|XP_006852851.1|  hypothetical protein AMTR_s00033p00195690          251   9e-75   Amborella trichopoda
gb|AGJ81362.1|  vacuolar H+ pyrophosphatase 1                           250   1e-74   Brassica napus [oilseed rape]
ref|XP_002453419.1|  hypothetical protein SORBIDRAFT_04g005710          250   2e-74   Sorghum bicolor [broomcorn]
ref|XP_009401376.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   4e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793954.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   4e-74   Phoenix dactylifera
ref|XP_009117814.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   6e-74   Brassica rapa
gb|ABD98735.1|  vacuolar H+-pyrophosphatase                             249   6e-74   Oxybasis glauca [oakleaf goosefoot]
emb|CDY53310.1|  BnaA09g56670D                                          249   8e-74   Brassica napus [oilseed rape]
ref|XP_010691127.1|  PREDICTED: pyrophosphate-energized vacuolar ...    248   8e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010557616.1|  PREDICTED: pyrophosphate-energized vacuolar ...    248   9e-74   Tarenaya hassleriana [spider flower]
ref|XP_009385121.1|  PREDICTED: pyrophosphate-energized vacuolar ...    248   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410369.1|  PREDICTED: pyrophosphate-energized vacuolar ...    247   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87313.1|  BnaA07g35600D                                          247   3e-73   
gb|AFW66266.1|  hypothetical protein ZEAMMB73_353171                    246   5e-73   
gb|EYU24628.1|  hypothetical protein MIMGU_mgv1a001756mg                246   5e-73   Erythranthe guttata [common monkey flower]
gb|AET95912.1|  PHP1                                                    246   7e-73   Lagenaria siceraria [bottle gourd]
gb|ADJ67258.1|  vaculor H+-pyrophosphatase                              246   8e-73   Sorghum bicolor [broomcorn]
emb|CDY33390.1|  BnaC05g11930D                                          246   8e-73   Brassica napus [oilseed rape]
ref|XP_010541940.1|  PREDICTED: pyrophosphate-energized vacuolar ...    245   1e-72   Tarenaya hassleriana [spider flower]
ref|NP_001288927.1|  uncharacterized protein LOC103832483               245   1e-72   Brassica rapa
ref|XP_008679906.1|  PREDICTED: pyrophosphate-energized vacuolar ...    246   1e-72   
emb|CBI25554.3|  unnamed protein product                                245   1e-72   Vitis vinifera
emb|CAN65456.1|  hypothetical protein VITISV_035221                     245   1e-72   Vitis vinifera
ref|NP_001266772.1|  uncharacterized protein LOC101027208               245   2e-72   Zea mays [maize]
ref|XP_002438225.1|  hypothetical protein SORBIDRAFT_10g009880          244   2e-72   Sorghum bicolor [broomcorn]
ref|XP_006300952.1|  hypothetical protein CARUB_v10021340mg             244   2e-72   
gb|AFW70478.1|  vacuolar H+-translocating inorganic pyrophosphatase     244   2e-72   
gb|ACT98610.2|  vacuolar proton-inorganic pyrophosphatase               244   3e-72   Diplachne fusca
gb|EYU21676.1|  hypothetical protein MIMGU_mgv1a001720mg                244   3e-72   Erythranthe guttata [common monkey flower]
emb|CDX81728.1|  BnaC08g38730D                                          248   3e-72   
ref|XP_010417704.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010537929.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   3e-72   Tarenaya hassleriana [spider flower]
emb|CDY39975.1|  BnaC06g40530D                                          244   3e-72   Brassica napus [oilseed rape]
ref|XP_010539519.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_004951662.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   4e-72   Setaria italica
ref|XP_010429951.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   4e-72   Camelina sativa [gold-of-pleasure]
ref|NP_001288904.1|  uncharacterized protein LOC103836019               243   5e-72   Brassica rapa
emb|CDY36581.1|  BnaA06g10340D                                          243   7e-72   Brassica napus [oilseed rape]
ref|XP_004951661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   8e-72   
ref|NP_001077542.1|  Pyrophosphate-energized vacuolar membrane pr...    241   8e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AFW77130.1|  hypothetical protein ZEAMMB73_840165                    244   9e-72   
gb|EAY84762.1|  hypothetical protein OsI_06130                          231   1e-71   Oryza sativa Indica Group [Indian rice]
ref|NP_001268155.1|  vacuolar pyrophosphatase                           243   1e-71   Vitis vinifera
gb|ABR18024.1|  unknown                                                 242   2e-71   Picea sitchensis
gb|KFK43817.1|  hypothetical protein AALP_AA1G177100                    242   2e-71   Arabis alpina [alpine rockcress]
ref|XP_006646987.1|  PREDICTED: pyrophosphate-energized vacuolar ...    242   2e-71   Oryza brachyantha
ref|XP_010472923.1|  PREDICTED: pyrophosphate-energized vacuolar ...    241   5e-71   Camelina sativa [gold-of-pleasure]
gb|AAL57660.1|  At1g15690/F7H2_3                                        240   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42469.1|  hypothetical protein AALP_AA2G261100                    240   1e-70   Arabis alpina [alpine rockcress]
ref|NP_173021.1|  Pyrophosphate-energized vacuolar membrane proto...    240   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890120.1|  vacuolar-type H+-pumping pyrophosphatase 1         240   1e-70   Arabidopsis lyrata subsp. lyrata
gb|AAL84953.1|  At1g15690/F7H2_3                                        240   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217159.1|  hypothetical protein PRUPE_ppa001776mg             240   1e-70   Prunus persica
emb|CDX96835.1|  BnaA08g23780D                                          239   1e-70   
ref|XP_009148959.1|  PREDICTED: pyrophosphate-energized vacuolar ...    239   2e-70   Brassica rapa
ref|XP_009334631.1|  PREDICTED: pyrophosphate-energized vacuolar ...    239   2e-70   Pyrus x bretschneideri [bai li]
dbj|BAE98517.1|  hypothetical protein                                   238   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306837.1|  hypothetical protein CARUB_v10008378mg             238   5e-70   Capsella rubella
ref|XP_003564217.1|  PREDICTED: pyrophosphate-energized vacuolar ...    238   5e-70   Brachypodium distachyon [annual false brome]
ref|XP_006389797.1|  hypothetical protein EUTSA_v10018163mg             238   6e-70   Eutrema salsugineum [saltwater cress]
gb|AIS71988.1|  vacuolar pyrophosphatase 1                              238   6e-70   Haloxylon ammodendron
ref|XP_008228676.1|  PREDICTED: pyrophosphate-energized vacuolar ...    238   7e-70   Prunus mume [ume]
gb|AEI17666.1|  vacuolar H+-pyrophosphatase                             238   8e-70   Salicornia europaea [chicken-claws]
ref|XP_004303283.1|  PREDICTED: pyrophosphate-energized vacuolar ...    238   9e-70   Fragaria vesca subsp. vesca
ref|XP_010476656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004965753.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   1e-69   Setaria italica
emb|CAG29370.1|  vacuolar H+-translocating inorganic pyrophosphatase    237   1e-69   Zea mays [maize]
ref|XP_010459106.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006656294.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   1e-69   Oryza brachyantha
ref|XP_010497310.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   1e-69   Camelina sativa [gold-of-pleasure]
gb|AJR29310.1|  H+-pyrophosphatase                                      236   2e-69   Secale cereale
gb|AAA61609.1|  pyrophosphatase                                         236   4e-69   Beta vulgaris [beet]
dbj|BAA32210.1|  Vacuolar proton pyrophosphatase                        236   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAL11506.1|AF367446_1  vacuolar H+-pyrophosphatase                   236   4e-69   Prunus persica
ref|XP_010033979.1|  PREDICTED: pyrophosphate-energized vacuolar ...    235   6e-69   Eucalyptus grandis [rose gum]
dbj|BAJ91598.1|  predicted protein                                      235   7e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009338516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    234   9e-69   Pyrus x bretschneideri [bai li]
ref|XP_006648065.1|  PREDICTED: pyrophosphate-energized vacuolar ...    234   9e-69   Oryza brachyantha
gb|EMT29715.1|  Pyrophosphate-energized vacuolar membrane proton ...    234   1e-68   
ref|XP_009336318.1|  PREDICTED: pyrophosphate-energized vacuolar ...    234   1e-68   Pyrus x bretschneideri [bai li]
gb|AAP55210.1|  vacuolar proton-inorganic pyrophosphatase               234   1e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008372806.1|  PREDICTED: pyrophosphate-energized vacuolar ...    236   2e-68   
ref|NP_001105380.1|  vacuolar proton pump homolog1                      233   3e-68   
dbj|BAB18681.1|  vacuolar proton-inorganic pyrophosphatase              233   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHZ97880.1|  vacuolar H+-pyrophosphatase                             232   8e-68   Olimarabidopsis pumila
sp|Q06572.2|AVP_HORVU  RecName: Full=Pyrophosphate-energized vacu...    232   9e-68   Hordeum vulgare [barley]
gb|ACA63883.1|  vacuolar proton-inorganic pyrophosphatase               232   9e-68   Hordeum vulgare [barley]
dbj|BAJ88084.1|  predicted protein                                      232   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04633.1|  predicted protein                                      231   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954254.1|  PREDICTED: pyrophosphate-energized vacuolar ...    231   2e-67   Setaria italica
dbj|BAD25066.1|  putative inorganic diphosphatase                       231   3e-67   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD02277.1|  vacuolar proton pyrophosphatase                        231   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058184.1|  Os06g0644200                                       229   8e-67   
dbj|BAA08232.1|  vacuolar H+-pyrophosphatase                            229   8e-67   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA31523.1|  ovp1                                                   229   9e-67   Oryza sativa [red rice]
gb|EAZ01854.1|  hypothetical protein OsI_23875                          229   1e-66   Oryza sativa Indica Group [Indian rice]
emb|CDX83972.1|  BnaC08g16730D                                          226   2e-65   
ref|XP_006416887.1|  hypothetical protein EUTSA_v10006869mg             226   2e-65   Eutrema salsugineum [saltwater cress]
gb|AAR08913.2|  pyrophosphate-energized vacuolar membrane proton ...    226   2e-65   Eutrema salsugineum [saltwater cress]
gb|EEE66103.1|  hypothetical protein OsJ_22136                          225   4e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454723.1|  hypothetical protein SORBIDRAFT_04g036230          224   4e-65   Sorghum bicolor [broomcorn]
gb|EMS65629.1|  Pyrophosphate-energized vacuolar membrane proton ...    223   1e-64   Triticum urartu
gb|AAP06752.1|  vacuolar proton-inorganic pyrophosphatase               223   2e-64   Hordeum brevisubulatum
ref|XP_004964695.1|  PREDICTED: pyrophosphate-energized vacuolar ...    223   2e-64   Setaria italica
gb|ABX10014.1|  vacuolar H+-pyrophosphatase                             221   6e-64   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001048422.1|  Os02g0802500                                       219   6e-63   
gb|EAZ24976.1|  hypothetical protein OsJ_08754                          219   6e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CAF18416.1|  proton translocating pyrophosphatase                   219   7e-63   Oryza sativa [red rice]
gb|AGT16998.1|  diphosphatase                                           218   1e-62   Saccharum hybrid cultivar R570
gb|AGT15917.1|  vacuolar H+-pyrophosphatase                             218   2e-62   Saccharum hybrid cultivar R570
dbj|BAF63470.1|  vacuolar proton-pyrophosphatase                        217   3e-62   Potamogeton distinctus
gb|AGT16227.1|  vacuolar proton pyrophosphatase                         217   3e-62   Saccharum hybrid cultivar R570
ref|XP_006841407.1|  hypothetical protein AMTR_s00003p00014700          217   3e-62   Amborella trichopoda
ref|XP_006656699.1|  PREDICTED: pyrophosphate-energized vacuolar ...    217   4e-62   
ref|NP_001146732.1|  uncharacterized protein LOC100280334               214   3e-61   Zea mays [maize]
ref|XP_003563306.1|  PREDICTED: pyrophosphate-energized vacuolar ...    213   1e-60   
ref|XP_010042849.1|  PREDICTED: pyrophosphate-energized vacuolar ...    203   1e-60   Eucalyptus grandis [rose gum]
gb|AFW85592.1|  vacuolar proton pump-like protein                       212   2e-60   
ref|XP_002437341.1|  hypothetical protein SORBIDRAFT_10g025280          211   3e-60   
ref|NP_001056966.1|  Os06g0178900                                       209   2e-59   
ref|XP_010039554.1|  PREDICTED: pyrophosphate-energized vacuolar ...    207   1e-58   Eucalyptus grandis [rose gum]
gb|KCW45902.1|  hypothetical protein EUGRSUZ_L00271                     206   2e-58   Eucalyptus grandis [rose gum]
gb|ABR16052.1|  unknown                                                 205   6e-58   Picea sitchensis
gb|ACN40474.1|  unknown                                                 205   6e-58   Picea sitchensis
ref|XP_010259323.1|  PREDICTED: pyrophosphate-energized vacuolar ...    201   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_007031139.1|  Inorganic H pyrophosphatase family protein i...    198   2e-56   
ref|XP_011023767.1|  PREDICTED: pyrophosphate-energized vacuolar ...    200   3e-56   Populus euphratica
gb|KJB26321.1|  hypothetical protein B456_004G237000                    199   4e-56   Gossypium raimondii
emb|CBI39586.3|  unnamed protein product                                200   4e-56   Vitis vinifera
gb|KJB26322.1|  hypothetical protein B456_004G237000                    199   5e-56   Gossypium raimondii
ref|XP_002318956.1|  inorganic pyrophosphatase family protein           199   5e-56   Populus trichocarpa [western balsam poplar]
gb|KJB26320.1|  hypothetical protein B456_004G237000                    199   8e-56   Gossypium raimondii
gb|KHG22725.1|  Pyrophosphate-energized vacuolar membrane proton ...    199   8e-56   Gossypium arboreum [tree cotton]
ref|NP_001268072.1|  H+-pyrophosphatase                                 199   1e-55   Vitis vinifera
ref|XP_007031138.1|  Inorganic H pyrophosphatase family protein i...    197   2e-55   
ref|XP_003555808.1|  PREDICTED: pyrophosphate-energized vacuolar ...    197   5e-55   Glycine max [soybeans]
ref|XP_006382405.1|  inorganic pyrophosphatase family protein           195   2e-54   
ref|XP_004302243.1|  PREDICTED: pyrophosphate-energized vacuolar ...    195   2e-54   Fragaria vesca subsp. vesca
ref|XP_008797457.1|  PREDICTED: pyrophosphate-energized vacuolar ...    194   4e-54   Phoenix dactylifera
emb|CDP18241.1|  unnamed protein product                                193   1e-53   Coffea canephora [robusta coffee]
ref|XP_009630145.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   2e-53   Nicotiana tomentosiformis
ref|XP_009630144.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   2e-53   Nicotiana tomentosiformis
ref|XP_004230300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    191   4e-53   Solanum lycopersicum
ref|XP_002512502.1|  Pyrophosphate-energized vacuolar membrane pr...    191   5e-53   Ricinus communis
ref|XP_006344755.1|  PREDICTED: pyrophosphate-energized vacuolar ...    191   6e-53   Solanum tuberosum [potatoes]
ref|XP_006605822.1|  PREDICTED: pyrophosphate-energized vacuolar ...    190   2e-52   
gb|KDP23377.1|  hypothetical protein JCGZ_23210                         189   2e-52   Jatropha curcas
gb|KCW60551.1|  hypothetical protein EUGRSUZ_H03285                     187   3e-52   Eucalyptus grandis [rose gum]
ref|XP_009763192.1|  PREDICTED: pyrophosphate-energized vacuolar ...    189   4e-52   Nicotiana sylvestris
ref|XP_008359855.1|  PREDICTED: pyrophosphate-energized vacuolar ...    189   4e-52   Malus domestica [apple tree]
ref|XP_009373278.1|  PREDICTED: pyrophosphate-energized vacuolar ...    187   1e-51   Pyrus x bretschneideri [bai li]
gb|KCW60550.1|  hypothetical protein EUGRSUZ_H03285                     186   2e-51   Eucalyptus grandis [rose gum]
ref|XP_010024124.1|  PREDICTED: pyrophosphate-energized vacuolar ...    186   2e-51   Eucalyptus grandis [rose gum]
ref|XP_004144756.1|  PREDICTED: pyrophosphate-energized vacuolar ...    186   3e-51   Cucumis sativus [cucumbers]
ref|XP_008453661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    186   3e-51   Cucumis melo [Oriental melon]
ref|XP_010093840.1|  Pyrophosphate-energized vacuolar membrane pr...    185   5e-51   Morus notabilis
ref|XP_010931754.1|  PREDICTED: pyrophosphate-energized vacuolar ...    185   6e-51   Elaeis guineensis
ref|XP_008370385.1|  PREDICTED: pyrophosphate-energized vacuolar ...    181   1e-49   
gb|ABK62847.1|  vacuolar H+-PPase                                       181   1e-49   Malus domestica [apple tree]
ref|XP_011036944.1|  PREDICTED: pyrophosphate-energized vacuolar ...    180   5e-49   Populus euphratica
ref|XP_008245918.1|  PREDICTED: pyrophosphate-energized vacuolar ...    179   7e-49   
ref|XP_007208066.1|  hypothetical protein PRUPE_ppa001833mg             179   1e-48   
dbj|BAK06237.1|  predicted protein                                      179   1e-48   
gb|AAL11507.1|AF367447_1  vacuolar H+-pyrophosphatase                   179   1e-48   
gb|ABU92563.1|  vacuolar H+-pyrophosphatase                             177   3e-48   
ref|XP_009412123.1|  PREDICTED: pyrophosphate-energized vacuolar ...    175   4e-47   
ref|XP_002967265.1|  hypothetical protein SELMODRAFT_270614             172   2e-46   
ref|XP_002960455.1|  hypothetical protein SELMODRAFT_270204             172   2e-46   
ref|XP_008363051.1|  PREDICTED: uncharacterized protein LOC103426749    174   2e-46   
emb|CDY61273.1|  BnaA06g38620D                                          171   5e-46   
ref|XP_008655898.1|  PREDICTED: pyrophosphate-energized vacuolar ...    169   5e-45   
ref|XP_008655899.1|  PREDICTED: pyrophosphate-energized vacuolar ...    169   6e-45   
gb|AFW80727.1|  hypothetical protein ZEAMMB73_205029                    169   6e-45   
dbj|BAJ93792.1|  predicted protein                                      166   5e-44   
ref|XP_004968691.1|  PREDICTED: pyrophosphate-energized vacuolar ...    165   1e-43   
ref|XP_006433525.1|  hypothetical protein CICLE_v10003214mg             157   2e-43   
ref|XP_003567657.1|  PREDICTED: pyrophosphate-energized vacuolar ...    164   3e-43   
ref|NP_001152459.1|  pyrophosphate-energized vacuolar membrane pr...    161   2e-42   
gb|AFW77254.1|  pyrophosphate-energized vacuolar membrane proton ...    161   2e-42   
gb|KDO81692.1|  hypothetical protein CISIN_1g040141mg                   157   4e-41   
ref|NP_001042938.1|  Os01g0337500                                       157   5e-41   
ref|XP_001782955.1|  predicted protein                                  154   6e-41   
gb|KCW81670.1|  hypothetical protein EUGRSUZ_C03032                     156   9e-41   
gb|KHN16066.1|  Pyrophosphate-energized vacuolar membrane proton ...    157   1e-40   
ref|XP_010051274.1|  PREDICTED: pyrophosphate-energized vacuolar ...    156   1e-40   
ref|XP_001785133.1|  predicted protein                                  150   3e-40   
gb|AAQ19328.1|  H+-pyrophosphatase                                      154   1e-39   
ref|XP_001785132.1|  predicted protein                                  153   2e-39   
ref|XP_002455587.1|  hypothetical protein SORBIDRAFT_03g013530          153   4e-39   
gb|KCW81665.1|  hypothetical protein EUGRSUZ_C03030                     150   6e-39   
ref|XP_010049183.1|  PREDICTED: pyrophosphate-energized vacuolar ...    151   6e-39   
ref|XP_010049182.1|  PREDICTED: pyrophosphate-energized vacuolar ...    151   1e-38   
gb|KHN23153.1|  Pyrophosphate-energized vacuolar membrane proton ...    150   2e-38   
ref|XP_010051280.1|  PREDICTED: pyrophosphate-energized vacuolar ...    150   3e-38   
gb|KCW44138.1|  hypothetical protein EUGRSUZ_L02451                     149   5e-38   
ref|XP_010029917.1|  PREDICTED: pyrophosphate-energized vacuolar ...    148   1e-37   
ref|XP_010029915.1|  PREDICTED: pyrophosphate-energized vacuolar ...    148   2e-37   
ref|XP_010029916.1|  PREDICTED: pyrophosphate-energized vacuolar ...    148   2e-37   
ref|XP_010051273.1|  PREDICTED: pyrophosphate-energized vacuolar ...    147   4e-37   
dbj|BAA36841.1|  vacuolar H+-pyrophosphatase                            147   5e-37   
ref|XP_010051278.1|  PREDICTED: pyrophosphate-energized vacuolar ...    144   9e-37   
ref|XP_002517682.1|  Pyrophosphate-energized vacuolar membrane pr...    146   2e-36   
gb|KDO47416.1|  hypothetical protein CISIN_1g0042302mg                  142   4e-36   
gb|KDO47419.1|  hypothetical protein CISIN_1g0042302mg                  142   5e-36   
gb|KDO47418.1|  hypothetical protein CISIN_1g0042302mg                  142   5e-36   
gb|KDO47420.1|  hypothetical protein CISIN_1g0042302mg                  141   5e-36   
ref|XP_010051272.1|  PREDICTED: pyrophosphate-energized vacuolar ...    144   6e-36   
ref|XP_008389636.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    142   9e-36   
gb|KDO47417.1|  hypothetical protein CISIN_1g0042302mg                  142   9e-36   
ref|XP_004978280.1|  PREDICTED: pyrophosphate-energized vacuolar ...    141   4e-35   
gb|EPS59584.1|  pyrophosphate-energized vacuolar membrane proton ...    140   4e-35   
gb|KCW81671.1|  hypothetical protein EUGRSUZ_C03033                     140   8e-35   
gb|EAY96623.1|  hypothetical protein OsI_18536                          138   5e-34   
gb|AHL67376.1|  Chalk5                                                  137   2e-33   
ref|XP_002440641.1|  hypothetical protein SORBIDRAFT_09g004450          135   5e-33   
ref|XP_003568884.1|  PREDICTED: pyrophosphate-energized vacuolar ...    135   8e-33   
ref|NP_001054701.1|  Os05g0156900                                       135   1e-32   
ref|XP_004951660.1|  PREDICTED: pyrophosphate-energized vacuolar ...    134   1e-32   
gb|AES91661.2|  vacuolar H+-translocating inorganic pyrophosphatase     130   2e-31   
gb|EMT15308.1|  Pyrophosphate-energized vacuolar membrane proton ...    128   2e-30   
ref|XP_011398805.1|  Pyrophosphate-energized vacuolar membrane pr...    129   2e-30   
tpg|DAA63101.1|  TPA: hypothetical protein ZEAMMB73_533095              129   2e-30   
ref|XP_010068026.1|  PREDICTED: pyrophosphate-energized vacuolar ...    124   3e-30   
gb|EMS53286.1|  Pyrophosphate-energized vacuolar membrane proton ...    125   1e-29   
ref|XP_008676297.1|  PREDICTED: pyrophosphate-energized vacuolar ...    117   3e-29   
ref|XP_005647206.1|  vacuolar-type H-pyrophosphatase                    124   4e-29   
ref|XP_002535533.1|  hypothetical protein RCOM_1930180                  115   6e-29   
gb|EMT22832.1|  Pyrophosphate-energized vacuolar membrane proton ...    123   1e-28   
ref|XP_005845116.1|  hypothetical protein CHLNCDRAFT_32356              122   2e-28   
gb|KDD76475.1|  Inorganic H+ pyrophosphatase                            122   2e-28   
gb|KDO47421.1|  hypothetical protein CISIN_1g0042301mg                  112   3e-28   
ref|XP_010908157.1|  PREDICTED: pyrophosphate-energized vacuolar ...    112   1e-27   
gb|ACF19425.1|  vacuolar proton pyrophosphatase                         115   2e-27   
gb|KHN01313.1|  Pyrophosphate-energized vacuolar membrane proton ...    118   4e-27   
gb|EAY73863.1|  hypothetical protein OsI_01741                          117   8e-27   
gb|KCW81676.1|  hypothetical protein EUGRSUZ_C030381                    115   4e-26   
gb|AFF27508.1|  vacuolar proton-inorganic pyrophosphatase               109   2e-25   
gb|AFF27509.1|  vacuolar proton-inorganic pyrophosphatase               109   2e-25   
gb|AFF27510.1|  vacuolar proton-inorganic pyrophosphatase               109   2e-25   
dbj|BAJ14099.1|  vacuolar proton pyrophosphatase                        105   2e-25   
gb|KHG11819.1|  Pyrophosphate-energized vacuolar membrane proton ...    113   2e-25   
gb|KJB23660.1|  hypothetical protein B456_004G108700                    113   2e-25   
ref|XP_010065283.1|  PREDICTED: pyrophosphate-energized vacuolar ...    111   1e-24   
ref|XP_010065284.1|  PREDICTED: pyrophosphate-energized vacuolar ...    111   1e-24   
tpg|DAA54709.1|  TPA: hypothetical protein ZEAMMB73_571741              110   3e-24   
ref|XP_010051276.1|  PREDICTED: pyrophosphate-energized vacuolar ...    109   7e-24   
dbj|BAD37432.1|  inorganic diphosphatase, H+-translocating, vacuo...    101   1e-23   
ref|XP_010068021.1|  PREDICTED: pyrophosphate-energized vacuolar ...    106   1e-23   
ref|XP_002954858.1|  hypothetical protein VOLCADRAFT_76494              102   2e-21   
gb|KCW81679.1|  hypothetical protein EUGRSUZ_C03042                     100   5e-21   
ref|XP_008658530.1|  PREDICTED: uncharacterized protein LOC100280...  99.8    2e-20   
gb|KIY92128.1|  inorganic pyrophosphatase                             92.4    4e-20   
ref|XP_010096802.1|  Pyrophosphate-energized vacuolar membrane pr...  96.3    2e-19   
gb|KCW81662.1|  hypothetical protein EUGRSUZ_C03027                   95.9    3e-19   
ref|XP_009763189.1|  PREDICTED: pyrophosphate-energized vacuolar ...  94.7    8e-19   
ref|XP_006645853.1|  PREDICTED: pyrophosphate-energized vacuolar ...  94.7    8e-19   
emb|CAC44451.1|  proton-translocating inorganic pyrophosphatase       94.4    1e-18   
ref|XP_001694682.1|  inorganic pyrophosphatase                        94.4    1e-18   
gb|AFN42824.1|  vacuolar-type H pump pyrophosphatase-like protein     84.7    9e-17   
gb|KIY93030.1|  hypothetical protein MNEG_14934                       82.8    1e-16   
gb|AFN42825.1|  vacuolar-type H pump pyrophosphatase-like protein     85.1    6e-16   
gb|ADK36629.1|  vacuolar H+-pyrophosphatase                           85.9    8e-16   
ref|NP_001168714.1|  uncharacterized protein LOC100382506             79.7    1e-15   
ref|XP_813460.1|  vacuolar-type proton translocating pyrophosphat...  85.5    1e-15   
gb|AAF80381.1|AF159881_1  vacuolar-type proton translocating pyro...  85.5    1e-15   
ref|XP_814868.1|  vacuolar-type proton translocating pyrophosphat...  85.5    1e-15   
gb|EKF38149.1|  vacuolar-type proton translocating pyrophosphatase 1  85.1    2e-15   
gb|ESS66489.1|  vacuolar-type proton translocating pyrophosphatase 1  85.1    2e-15   
gb|EKG05980.1|  vacuolar-type proton translocating pyrophosphatase 1  85.1    2e-15   
ref|XP_010041545.1|  PREDICTED: pyrophosphate-energized vacuolar ...  83.6    3e-15   
emb|CCD14799.1|  unnamed protein product                              81.6    1e-14   
gb|AGN32987.1|  vacuolar-type proton translocating pyrophosphatase 1  82.0    2e-14   
ref|XP_010701502.1|  vacuolar-type proton translocating pyrophosp...  82.0    2e-14   
emb|CCD17117.1|  unnamed protein product                              81.6    2e-14   
ref|XP_001567142.1|  putative vacuolar-type proton translocating ...  81.3    3e-14   
emb|CCD15524.1|  unnamed protein product                              80.9    4e-14   
emb|CCW69815.1|  unnamed protein product                              80.1    7e-14   
emb|CCC50119.1|  putative vacuolar-type proton translocating pyro...  80.1    8e-14   
emb|CBH13886.1|  vacuolar-type proton translocating pyrophosphata...  79.0    2e-13   
gb|AAK95376.1|  vacuolar-type proton translocating pyrophosphatase 1  79.0    2e-13   
emb|CBH10748.1|  vacuolar-type proton translocating pyrophosphata...  79.0    2e-13   
ref|XP_847623.1|  vacuolar-type proton translocating pyrophosphat...  79.0    2e-13   
ref|XP_844588.1|  vacuolar-type proton translocating pyrophosphat...  79.0    2e-13   
gb|EPY37495.1|  vacuolar-type proton translocating pyrophosphatase 1  78.2    3e-13   
gb|EPY25094.1|  vacuolar-type proton translocating pyrophosphatase 1  78.2    4e-13   
ref|XP_004030525.1|  inorganic pyrophosphatase, putative              78.2    4e-13   
ref|XP_001685107.1|  putative vacuolar-type proton translocating ...  77.8    5e-13   
gb|EPY20019.1|  inorganic pyrophosphatase                             77.0    9e-13   
gb|EPY24500.1|  vacuolar-type proton translocating pyrophosphatase 1  77.0    1e-12   
ref|XP_003877640.1|  putative vacuolar-type proton translocating ...  75.9    2e-12   
ref|XP_003863215.1|  vacuolar-type proton translocating pyrophosp...  74.7    5e-12   
gb|AFW86962.1|  hypothetical protein ZEAMMB73_079608                  74.7    5e-12   
ref|XP_001467417.1|  putative vacuolar-type proton translocating ...  74.7    5e-12   
ref|XP_002185784.1|  predicted protein                                74.3    7e-12   
gb|EJK49356.1|  hypothetical protein THAOC_31776                      71.2    7e-11   
gb|AIZ95255.1|  putative pyrophosphatase                              67.0    1e-10   
gb|EWM21806.1|  h+-translocating pyrophosphatase family               69.3    3e-10   
ref|XP_009313559.1|  vacuolar-type proton translocating pyrophosp...  68.9    3e-10   
emb|CBI35335.3|  unnamed protein product                              68.2    6e-10   
gb|EPY23623.1|  inorganic pyrophosphatase                             67.0    1e-09   
ref|WP_010508682.1|  potassium transporter                            66.2    3e-09   
emb|CAD90116.1|  vacuolar pyrophosphatase                             60.5    3e-09   
emb|CDW90876.1|  pyrophosphate-energized vacuolar membrane proton...  65.9    3e-09   
ref|WP_018051858.1|  potassium transporter                            65.1    6e-09   
emb|CBK23132.2|  unnamed protein product                              64.7    8e-09   
emb|CBK21196.2|  unnamed protein product                              64.7    8e-09   
gb|EAZ11737.1|  hypothetical protein OsJ_01602                        64.7    8e-09   
ref|XP_001020551.1|  inorganic pyrophosphatase                        63.9    1e-08   
ref|XP_002502540.1|  H+-translocating pyrophosphatase family          63.2    3e-08   
ref|XP_736713.1|  hypothetical protein                                61.6    3e-08   
gb|EJY85113.1|  Inorganic pyrophosphatase                             62.8    4e-08   
ref|XP_002260303.1|  V-type H(+)-translocating pyrophosphatase        62.4    4e-08   
ref|XP_001447467.1|  hypothetical protein                             62.0    5e-08   
gb|AAD17216.1|  proton-pumping vacuolar pyrophosphatase               58.5    6e-08   
ref|XP_001428883.1|  hypothetical protein                             61.6    8e-08   
emb|CDR15480.1|  V-type H(+)-translocating pyrophosphatase, putative  61.2    9e-08   
ref|XP_001011583.1|  Inorganic H+ pyrophosphatase                     61.2    9e-08   
gb|EUD71439.1|  V-type H(+)-translocating pyrophosphatase             60.8    1e-07   
ref|WP_016543771.1|  V-type H(+)-translocating pyrophosphatase        60.8    2e-07   
ref|XP_006369847.1|  hypothetical protein POPTR_0001s33820g           60.1    2e-07   
emb|CDO67032.1|  V-type H(+)-translocating pyrophosphatase, putative  60.1    2e-07   
ref|WP_020770960.1|  V-type H(+)-translocating pyrophosphatase        60.1    3e-07   
ref|XP_001615819.1|  V-type H(+)-translocating pyrophosphatase        59.7    3e-07   
ref|WP_008589377.1|  potassium transporter                            59.7    4e-07   
ref|XP_005789368.1|  H+-translocating pyrophosphatase                 59.3    4e-07   
gb|AAD17215.1|  proton-pumping vacuolar pyrophosphatase               58.9    5e-07   
ref|XP_002777611.1|  H+-translocating inorganic pyrophosphatase T...  58.9    5e-07   
ref|XP_001348715.1|  V-type H(+)-translocating pyrophosphatase, p...  58.9    6e-07   
gb|EAZ42870.1|  hypothetical protein OsJ_27463                        56.2    6e-07   
ref|XP_004031183.1|  inorganic h+ pyrophosphatase, putative           58.9    6e-07   
gb|ETW15152.1|  V-type H(+)-translocating pyrophosphatase             58.9    6e-07   
gb|ETW54232.1|  V-type H(+)-translocating pyrophosphatase             58.9    6e-07   
ref|XP_727598.1|  V-type H(+)-translocating pyrophosphatase           58.5    8e-07   
gb|ETB63162.1|  V-type H( )-translocating pyrophosphatase             58.5    8e-07   
ref|XP_008622117.1|  V-type H(+)-translocating pyrophosphatase        58.5    8e-07   
ref|XP_002782816.1|  conserved hypothetical protein                   57.8    8e-07   
gb|ETO10415.1|  inorganic pyrophosphatase                             58.2    9e-07   
ref|XP_002773348.1|  conserved hypothetical protein                   57.0    1e-06   
gb|EUT79092.1|  V-type H(+)-translocating pyrophosphatase             57.8    1e-06   
ref|WP_001089684.1|  hypothetical protein                             54.7    1e-06   
ref|XP_002782815.1|  H+-translocating inorganic pyrophosphatase T...  57.4    2e-06   
gb|KHO53496.1|  hypothetical protein QT04_C0004G0029                  57.4    2e-06   
ref|XP_002784996.1|  H+-translocating inorganic pyrophosphatase T...  57.0    2e-06   
ref|WP_016549231.1|  V-type H(+)-translocating pyrophosphatase        57.0    2e-06   
ref|WP_010570365.1|  potassium transporter                            57.0    2e-06   
ref|XP_676243.1|  V-type H(+)-translocating pyrophosphatase           57.0    2e-06   
ref|WP_010411520.1|  potassium transporter                            56.6    3e-06   
ref|WP_003006999.1|  V-type H(+)-translocating pyrophosphatase        56.6    3e-06   
ref|XP_007515731.1|  vacuolar proton-inorganic pyrophosphatase        56.6    3e-06   
ref|XP_005824384.1|  hypothetical protein GUITHDRAFT_145095           56.6    4e-06   
gb|EKO34787.1|  V-type H(+)-translocating pyrophosphatase             56.2    5e-06   
ref|WP_004466135.1|  V-type H(+)-translocating pyrophosphatase        55.8    5e-06   
gb|EMP80355.1|  V-type H(+)-translocating pyrophosphatase             55.8    5e-06   
ref|WP_043991582.1|  potassium transporter                            55.8    5e-06   
gb|ADI18265.1|  inorganic pyrophosphatase                             55.8    5e-06   
ref|WP_016756764.1|  potassium transporter                            55.8    5e-06   
ref|WP_032914011.1|  potassium transporter                            55.8    5e-06   
ref|XP_003056902.1|  H+-translocating pyrophosphatase family          55.8    6e-06   
ref|WP_022449202.1|  putative K(+)-stimulated pyrophosphate-energ...  55.5    7e-06   
ref|WP_020983541.1|  V-type H(+)-translocating pyrophosphatase        55.5    7e-06   
ref|WP_001089698.1|  K(+)-stimulated pyrophosphate-energized sodi...  55.5    9e-06   
ref|WP_017809980.1|  potassium transporter                            55.1    9e-06   
ref|WP_001968143.1|  V-type H(+)-translocating pyrophosphatase        55.1    1e-05   
gb|ACC59104.1|  At1G15690-like protein                                52.4    1e-05   
ref|WP_001089688.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
ref|WP_001089695.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
ref|WP_001089694.1|  potassium transporter                            54.7    1e-05   
ref|WP_001089689.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
ref|WP_001089693.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
ref|WP_001089696.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
ref|XP_002768831.1|  H+-translocating inorganic pyrophosphatase T...  54.7    1e-05   
ref|WP_025183110.1|  potassium transporter                            54.7    1e-05   
ref|WP_001089697.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
gb|EMJ47695.1|  V-type H(+)-translocating pyrophosphatase             54.7    1e-05   
ref|WP_025178077.1|  potassium transporter                            54.7    1e-05   
ref|WP_001089690.1|  K(+)-stimulated pyrophosphate-energized sodi...  54.7    1e-05   
gb|EKR54608.1|  V-type H(+)-translocating pyrophosphatase             54.7    1e-05   
gb|EMN79697.1|  V-type H(+)-translocating pyrophosphatase             54.7    1e-05   
ref|WP_002142595.1|  V-type H(+)-translocating pyrophosphatase        54.7    1e-05   
ref|WP_017855597.1|  potassium transporter                            54.7    1e-05   
gb|AER01981.1|  membrane-bound proton-translocating pyrophosphatase   54.7    1e-05   



>gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon pump 1 [Ipomoea 
batatas]
Length=767

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  288
            M A+TILPDLGT++LIP CAIVGIAFALVQW+LVSKVKLSPEKS    +D KNGFAESLI
Sbjct  1    MVAATILPDLGTQVLIPACAIVGIAFALVQWVLVSKVKLSPEKSGPGPADGKNGFAESLI  60

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  61   EEEEGINDHSVVHKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  120

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYD TK CKPALATAVFSTISFLLGA+TSVVSG LGMKIAT
Sbjct  121  KDQPCTYDSTKTCKPALATAVFSTISFLLGAITSVVSGFLGMKIAT  166



>gb|KJB23659.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=707

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     + +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGAPGNNGAAGKNGYA  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGS+E
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSIE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFS  SQPCTYD +++CKPALATA FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAAFSTLSFLLGAVTSVVSGFLGMKIAT  170



>ref|XP_009598387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=766

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  288
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS EKS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSTEKSSGGADDKNGYAAESLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             +QPCTYD  K CKPALATAVFST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  KNQPCTYDSAKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIAT  165



>ref|XP_009779977.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=766

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  288
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             +QPCTYD TK CKPALATAVFST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  KNQPCTYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIAT  165



>emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=766

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  288
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             +QPCTYD TK CKPALATAVFST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  KNQPCTYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIAT  165



>ref|XP_010323159.1| PREDICTED: vacuolar-type H+-pyrophosphatase isoform X1 [Solanum 
lycopersicum]
Length=765

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  303
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEEG  63

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFAILIFVFLGSVEGFST +QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFAILIFVFLGSVEGFSTKNQPC  123

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TYD TK CKPALATAVFST+SFLLGAVTSVVSG LGMKIAT
Sbjct  124  TYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIAT  164



>gb|KJB23657.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
 gb|KJB23658.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=771

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     + +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGAPGNNGAAGKNGYA  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGS+E
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSIE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFS  SQPCTYD +++CKPALATA FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAAFSTLSFLLGAVTSVVSGFLGMKIAT  170



>gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=771

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     S +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGASGNSGAAGKNGYA  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFS  SQPCTYD +++CKPALATA  ST+SFLLGAVTSVVSG LGMKIAT
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAALSTLSFLLGAVTSVVSGFLGMKIAT  170



>ref|XP_007013601.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31220.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=734

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 152/170 (89%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPC YD++K+CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  GFSTKSQPCMYDQSKMCKPALATAAFSTISFLLGAVTSVVSGFLGMKIAT  169



>ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum]
 dbj|BAM65603.1| vacuolar H+-pyrophosphatase [Solanum lycopersicum]
Length=765

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  303
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEEG  63

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFA LIF FLGSVEGFST +QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFATLIFAFLGSVEGFSTKNQPC  123

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TYD TK CKPALATAVFST+SFLLGAVTSVVSG LGMKIAT
Sbjct  124  TYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIAT  164



>ref|XP_011084078.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
 ref|XP_011084079.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=823

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M  +T+LPDLGT+ILIP+CA+VGIAFALVQW+LVSKVKLS +KS+S +D KNGF E+LIE
Sbjct  59   MAETTLLPDLGTQILIPICALVGIAFALVQWLLVSKVKLSTDKSSS-ADGKNGFTEALIE  117

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EE+G++DH+VV+KCA+IQSAISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  118  EEDGVSDHSVVRKCADIQSAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  177

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             Q CTYD TK+CKPALATA FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  178  PQACTYDSTKMCKPALATAAFSTISFLLGAITSVVSGFLGMKIAT  222



>ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=765

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  303
            TIL DLG EILIP+CA++GIAF+L QW LVSKV +  +K  S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPICAVIGIAFSLFQWHLVSKVTVGTDKPHSSGDDKNGYAESLIEEEEG  63

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFAILIFVFLGSVEGFST  QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFAILIFVFLGSVEGFSTKDQPC  123

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TYD TK CKPALATAVFSTISFLLGAVTSVVSG LGMKIAT
Sbjct  124  TYDSTKTCKPALATAVFSTISFLLGAVTSVVSGFLGMKIAT  164



>ref|XP_007013600.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=770

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 152/170 (89%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPC YD++K+CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  GFSTKSQPCMYDQSKMCKPALATAAFSTISFLLGAVTSVVSGFLGMKIAT  169



>gb|KJB53982.1| hypothetical protein B456_009G014500 [Gossypium raimondii]
Length=575

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  276
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPCTYD++K+CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  GFSTKSQPCTYDQSKICKPALATAAFSTISFLLGAVTSVVSGFLGMKIAT  169



>gb|KHN15033.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=732

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  285
            MGA  ILPDLGTEILIPVCAI+GIAFAL QW+LVSKVKLS  + AS +    KNG+ + L
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIAFALFQWVLVSKVKLSAARDASSNAGGGKNGYNDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T  QPCTYD+TK+CKPALATAVFSTISFLLG VTS++SG LGMKIAT
Sbjct  120  TSYQPCTYDQTKMCKPALATAVFSTISFLLGGVTSLISGFLGMKIAT  166



>ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
 gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
Length=766

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS + A KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAGKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFA+LIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVAKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAVLIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYD+TKLCKPALATA+FSTISFLLG VTS++SG LGMKIAT
Sbjct  120  SHQPCTYDKTKLCKPALATAIFSTISFLLGGVTSLISGFLGMKIAT  165



>ref|XP_003542656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Glycine max]
 gb|KHN47114.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=765

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MGA  ILPDLGTEILIPVCAI+GI FAL QW+LVSKVKLS  + AS + A KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIGFALFQWVLVSKVKLSAARDASPNAAGKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYD+TK+CKPALATAVFSTISFLLG VTS++SG LGMKIAT
Sbjct  120  SYQPCTYDQTKMCKPALATAVFSTISFLLGGVTSLISGFLGMKIAT  165



>ref|XP_004251737.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=769

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 151/167 (90%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  285
             +TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +  +S     +D KNG+AESL
Sbjct  2    GTTILPDLGTEILIPVCAVIGIGFALVQWVIVSKVTVSTDGKSSSPGAGADGKNGYAESL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDH+VV+KCAEIQ+AI+EGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHSVVRKCAEIQNAIAEGATSFLFTEYQYVGVFMVAFALLIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQ CTYD +K+CKPALATAVFSTISFLLGA+TSV+SG LGMKIAT
Sbjct  122  TKSQECTYDSSKMCKPALATAVFSTISFLLGAITSVISGFLGMKIAT  168



>ref|XP_009595111.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana tomentosiformis]
Length=767

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  285
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S+S  D KNG +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVIVSTDKLSSSSGDGKNGSYAEAL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGINDHSVVNKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQ CTYD +K+CKPALATAVFSTISFLLG VTSVVSG LGMKIAT
Sbjct  120  TKSQACTYDSSKMCKPALATAVFSTISFLLGGVTSVVSGFLGMKIAT  166



>ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=764

 Score =   270 bits (690),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             S ILPDLGTEILIP CA+VGI F+LVQW LVS+VKLSP   A + + KNG+ + LIEEE
Sbjct  2    GSAILPDLGTEILIPACAVVGIVFSLVQWFLVSQVKLSPAGEAQN-NGKNGYTDYLIEEE  60

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDHNVV KCAEIQ AIS+GATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQ
Sbjct  61   EGLNDHNVVLKCAEIQRAISDGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQ  120

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD TKLCKPALA A+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  121  PCTYDATKLCKPALANAIFSTVSFLLGAVTSVVSGFLGMKIAT  163



>ref|XP_011017877.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Populus euphratica]
Length=768

 Score =   270 bits (690),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 146/166 (88%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLI  288
             S +LPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPVLPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSRGSGKNGHGDYLI  61

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  62   EEEEGLNDHNIVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  121

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD  KLCKPALATA FSTISF+LGAVTSVVSG LGMKIAT
Sbjct  122  KSQPCTYDPLKLCKPALATAGFSTISFMLGAVTSVVSGFLGMKIAT  167



>gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica]
Length=765

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             S +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIEEE
Sbjct  2    GSALLPDLGAEIVIPVCAVIGIVFSLVQWYLVSTVKLTPESSSPSNNGKNGYGDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  62   EGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTY++ KLCKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  122  PCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  164



>ref|XP_006350116.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=769

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESL  285
             +TIL DLGTEILIPVCA++GI FALVQW++VSKV +S +  +S S    D KNG+AESL
Sbjct  2    GTTILSDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDGKSSSSGAGTDGKNGYAESL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDH+VV KCAEIQ+AI+EGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHSVVHKCAEIQNAIAEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQ CTYD +K+CKPALATAVFSTISFLLGAVTSV+SG LGMKIAT
Sbjct  122  TKSQACTYDSSKMCKPALATAVFSTISFLLGAVTSVISGFLGMKIAT  168



>ref|XP_003609464.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
Length=715

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  288
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEG+TSFLFT Y+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGSTSFLFTMYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYDETK+CKPALATA+FSTI+F+LG +TSV+SG LGMKIAT
Sbjct  120  SHQPCTYDETKMCKPALATALFSTIAFILGGITSVISGFLGMKIAT  165



>ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=765

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW +VS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYIVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  164



>gb|KDP30223.1| hypothetical protein JCGZ_17005 [Jatropha curcas]
Length=770

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 5/166 (3%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-----KNGFAESLI  288
            TILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P   +   DA     KNG+++ LI
Sbjct  4    TILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPGGGSGGRDAAAGNKKNGYSDYLI  63

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHN V KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST
Sbjct  64   EEEEGLNDHNTVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFST  123

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTY+  KLCKPALATA FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  124  KSQPCTYNPLKLCKPALATAAFSTVSFLLGAVTSVVSGFLGMKIAT  169



>ref|XP_006381091.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ERP58888.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIE  291
            S ILPDLGTEILIPVCAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPVCAIIGIGFSLLQWLLVSKVKLVPSPAASNNSGAAGKNGYGDYLIE  62

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  63   EEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  122

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  K+CKPALATA FST++F+LGAVTSVVSG LGMKIAT
Sbjct  123  SQPCTYDLLKMCKPALATAGFSTVAFVLGAVTSVVSGFLGMKIAT  167



>ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=765

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIN+ NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINEQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFIFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  164



>ref|XP_007204643.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
 gb|EMJ05842.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
Length=765

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  288
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFA+LIFVFLGSVEGFST
Sbjct  60   EEEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGGFMVAFAVLIFVFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             S+PCTYD+TK+CKPALATA+FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  SSRPCTYDQTKICKPALATAIFSTISFLLGAITSVVSGFLGMKIAT  165



>gb|KJB53981.1| hypothetical protein B456_009G014500 [Gossypium raimondii]
Length=770

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPCTYD++K+CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  GFSTKSQPCTYDQSKICKPALATAAFSTISFLLGAVTSVVSGFLGMKIAT  169



>gb|KJB83229.1| hypothetical protein B456_013G236400 [Gossypium raimondii]
Length=767

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF+
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFT  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIAT  166



>ref|XP_004508424.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cicer arietinum]
Length=765

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  288
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  +  + D+  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGREVTADASGKNGYNDSLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFT Y YVGIFMVAFA+LIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGATSFLFTMYYYVGIFMVAFAVLIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYDETKLCKPALATA+FSTISF+LG +TSV+SG LGMKIAT
Sbjct  120  KEQPCTYDETKLCKPALATALFSTISFVLGGITSVISGFLGMKIAT  165



>ref|XP_008242846.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=765

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  288
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFA+LIFVFLGSVEGFST
Sbjct  60   EEEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGGFMVAFAVLIFVFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             S+PCTYD+TK+CKPALATA+FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  SSRPCTYDQTKICKPALATAIFSTISFLLGAITSVVSGFLGMKIAT  165



>ref|XP_011078537.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MG +T+LPD GTEILIPVCA++GIAFALVQW+LV+KV+LS  K  +    ++G+ E+LIE
Sbjct  1    MGDATLLPDRGTEILIPVCAVIGIAFALVQWLLVAKVRLSNGKDYAG--GRSGYTEALIE  58

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG++DH+VV+KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  59   EEEGVSDHSVVRKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  118

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD T++CKPALATA FST+SFLLGA TSVVSG LGMKIAT
Sbjct  119  SQPCTYDSTRMCKPALATAAFSTLSFLLGAFTSVVSGFLGMKIAT  163



>ref|XP_006389422.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ABK95131.1| unknown [Populus trichocarpa]
 gb|ERP48336.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 146/166 (88%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLI  288
             S ILPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPILPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSGGAGKNGHGDYLI  61

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  62   EEEEGLNDHNIVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  121

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD  KLCKPALATA FSTI+F+LGAVTSVVSG LGMKIAT
Sbjct  122  KSQPCTYDPLKLCKPALATAGFSTIAFVLGAVTSVVSGFLGMKIAT  167



>emb|CDP10479.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ ILPDL TEILIPVCA++GI FALVQW+LVSKVKLS +K  + +D KNGF E+LIE
Sbjct  1    MGAA-ILPDLATEILIPVCAVIGIIFALVQWLLVSKVKLSHDKFDAGADGKNGFTEALIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIN  ++VQKCA+IQ+AISEGATSFLFTEYQYVG+FMVAFAILIFVFLGSVEGFST 
Sbjct  60   EEEGINGDSIVQKCADIQNAISEGATSFLFTEYQYVGVFMVAFAILIFVFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTYD +KLCKPAL TAVFST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  SQACTYDSSKLCKPALGTAVFSTVSFLLGAITSVLSGFLGMKIAT  164



>emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=765

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIN+ NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINEQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  164



>gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=770

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  276
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPCTYD++++CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  GFSTKSQPCTYDQSRICKPALATAAFSTISFLLGAVTSVVSGFLGMKIAT  169



>ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
 gb|ACI22377.1| vacuolar-type H-pyrophosphatase [Medicago truncatula]
 gb|AES91660.1| vacuolar H+-translocating inorganic pyrophosphatase [Medicago 
truncatula]
Length=765

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  288
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEG+TSFLFT Y+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGSTSFLFTMYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              QPCTYDETK+CKPALATA+FSTI+F+LG +TSV+SG LGMKIAT
Sbjct  120  SHQPCTYDETKMCKPALATALFSTIAFILGGITSVISGFLGMKIAT  165



>ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nelumbo nucifera]
Length=765

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL DL TEILIPVCA+VGIAFALVQW LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVVGIAFALVQWSLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNV  KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVATKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY   K CKPALA A+FST+SF+LGAVTSV+SG LGMKIAT
Sbjct  120  SQPCTYSPDKTCKPALANAIFSTVSFILGAVTSVISGFLGMKIAT  164



>gb|KJB83230.1| hypothetical protein B456_013G236400 [Gossypium raimondii]
Length=795

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF+
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFT  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIAT  166



>gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacastrum]
Length=765

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+T+LPDL TEILIP CA+VGIAF+L+QW LVS+VKLS + S+ +++   G A+SLIE
Sbjct  1    MGAATLLPDLATEILIPACAVVGIAFSLIQWFLVSQVKLSHD-SSRNNNKNGGMADSLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSV+GFST 
Sbjct  60   EEEGINDHSVVTKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVKGFSTS  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTYD+TK CKPALATA+FST+SFLLGAVTS+VSG LGMKIAT
Sbjct  120  SQECTYDKTKRCKPALATAIFSTVSFLLGAVTSIVSGFLGMKIAT  164



>dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata]
Length=766

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  288
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSG LGMKIAT
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIAT  165



>ref|XP_006474386.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Citrus sinensis]
Length=705

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  276
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFIFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSG LGMKIAT
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIAT  169



>sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase 
[Vigna radiata var. radiata]
 pdb|4A01|A Chain A, Crystal Structure Of The H-Translocating Pyrophosphatase
 pdb|4A01|B Chain B, Crystal Structure Of The H-Translocating Pyrophosphatase
Length=766

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  288
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSG LGMKIAT
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIAT  165



>gb|AAC49175.1| pyrophosphatase [Vigna radiata]
Length=765

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  288
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSG LGMKIAT
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIAT  165



>ref|XP_009791988.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana sylvestris]
Length=767

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  285
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S++  D K+G +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDKLSSASGDGKHGSYAEAL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGI+DH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGISDHSVVNKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQ CTYD +K+CKPALATAVFSTISFLLG VTSVVSG LGMKIAT
Sbjct  120  TKSQACTYDSSKMCKPALATAVFSTISFLLGGVTSVVSGFLGMKIAT  166



>ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=764

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA TILPDLG EILIP+CA+VGIAF+LVQW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLGAEILIPLCAVVGIAFSLVQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYRYVGAFMVAFAILIFLFLGSVEGFSTS  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            S+ CTYD+TK+CKPALATA+FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  SRACTYDQTKMCKPALATAIFSTISFLLGAVTSVVSGFLGMKIAT  164



>gb|KDO73437.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=705

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  276
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSG LGMKIAT
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIAT  169



>ref|XP_011020230.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Populus euphratica]
Length=768

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIE  291
            S ILPDLGTEILIP CAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPACAIIGIGFSLLQWLLVSKVKLVPSSAASNNSGAAGKNGYGDYLIE  62

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHN V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  63   EEEGLNDHNTVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  122

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY+  K+CKPALATA FST+SF+LGAVTSVVSG LGMKIAT
Sbjct  123  SQPCTYEPLKMCKPALATAGFSTVSFVLGAVTSVVSGFLGMKIAT  167



>ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Sesamum indicum]
Length=765

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 147/162 (91%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  300
            +LPDLGTEI+IP+CA++GI F+LVQW LVSKVKLSPE+  +   ++ KNG++E LIEEE+
Sbjct  3    LLPDLGTEIVIPLCAVIGIVFSLVQWFLVSKVKLSPERGGASAANNGKNGYSEYLIEEED  62

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+ND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST SQ 
Sbjct  63   GLNDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKSQS  122

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTYD+ KLCKPALATA+FST+SFLLGAVTSV+SG LGMKIAT
Sbjct  123  CTYDKEKLCKPALATAIFSTVSFLLGAVTSVISGFLGMKIAT  164



>ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=765

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             S +L DL TEI+IPVCA+VGI F+LVQW LVS+VKL+PE++   +  KNG+++ LIEEE
Sbjct  2    GSPLLSDLATEIVIPVCAVVGIVFSLVQWFLVSRVKLTPERNPPSTGNKNGYSDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDHNVV KCAEIQSAISEGATSFL TEYQYVGIFM+AFAILIF+FLGSVEGFST S+
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLLTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSR  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYDE K CKPALATAVFST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  PCTYDELKTCKPALATAVFSTLSFLLGAITSVLSGYLGMKIAT  164



>ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESLIEEEE  300
            +LPDLGTEI+IPVCA++GI F+LVQW LVS+VKLSPE+    +  + KNG+++ LIEEE+
Sbjct  3    LLPDLGTEIVIPVCAVIGIVFSLVQWFLVSRVKLSPERGGESAAKNGKNGYSDYLIEEED  62

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            GINDH VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST SQP
Sbjct  63   GINDHGVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKSQP  122

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CT+++ KLCKPALATA+FST+SFLLGA TSVVSG LGMKIAT
Sbjct  123  CTFNKEKLCKPALATAIFSTVSFLLGAFTSVVSGFLGMKIAT  164



>dbj|BAA33149.1| proton-translocating inorganic pyrophosphatase [Cucurbita moschata]
Length=768

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 3/164 (2%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIEE  294
            TILPDLGTEI IPVCA++GI F+LVQW  VS+VKLSP + A+ +++   KNG+++ LIEE
Sbjct  4    TILPDLGTEIFIPVCAVIGIVFSLVQWYYVSQVKLSPGRDAAHNNSAGSKNGYSDYLIEE  63

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVGIFMV FA+LIFVFLGSVE FST  
Sbjct  64   EEGVNDHNVVIKCAEIQSAISEGATSFLFTEYKYVGIFMVLFAVLIFVFLGSVESFSTKP  123

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTYD+T+ CKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  124  QPCTYDKTRTCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  167



>gb|KHF98453.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=767

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQY GIFMVAFAILIF+FLGSVE FS
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYAGIFMVAFAILIFLFLGSVERFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIAT  166



>ref|XP_006453118.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
 ref|XP_006474385.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X1 [Citrus sinensis]
 gb|ESR66358.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
Length=771

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  276
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFIFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSG LGMKIAT
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIAT  169



>emb|CDO98179.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   264 bits (675),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEI+IPVCA++GI F+L+QW+LVS+VKLSPE+  +++++KNGF + LIEEEEGI
Sbjct  3    LLPDLGTEIVIPVCAVIGIIFSLIQWVLVSRVKLSPERKEANNNSKNGFNDCLIEEEEGI  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            N+ NVV +CA IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQPCT
Sbjct  63   NEQNVVLECANIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y++ K CKPALATA FST+SFLLGA TSV+SG LGMKIAT
Sbjct  123  YNKEKFCKPALATAAFSTVSFLLGAFTSVISGFLGMKIAT  162



>ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=765

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL DL TEILIPVCA++GI F+LVQW+LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVIGIVFSLVQWLLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHN+V KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNIVTKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY+    CKPALA A+FST+SF+LGA TSVVSG LGMKIAT
Sbjct  120  SQPCTYNPDITCKPALANAIFSTVSFILGAFTSVVSGFLGMKIAT  164



>gb|KDO73436.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=771

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 6/170 (4%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  276
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVE  119

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSG LGMKIAT
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIAT  169



>ref|XP_004173355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like, 
partial [Cucumis sativus]
Length=543

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  282
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIAT  167



>ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Solanum tuberosum]
Length=767

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIE  291
             S +LPDLGTEI+IPVCA+VGI F+L QW LVS+VK+S E+ A+   ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLFQWYLVSRVKVSSERGATSPSNNNKNGYGDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  62   EEEGINDQNVVAKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             QPCTY++ K+CKPALATA+FSTISFLLGAVTSV+SG LGMKIAT
Sbjct  122  GQPCTYNKEKMCKPALATAIFSTISFLLGAVTSVISGFLGMKIAT  166



>gb|KJB64658.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=542

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  294
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  165



>ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=769

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  285
             S +LPDLGT+I+IPVCA++GI F+LVQW LVS+VK+S E+ A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSLVQWYLVSRVKVSSERGATSPSSNKNNKNGYGDCL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+ FAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIVFAILIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTLSFLLGAITSVISGFLGMKIAT  168



>gb|KJB56582.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
 gb|KJB56583.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
Length=716

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA  +L +  TEI++PVCA++GIAF+LVQW+LVS+VKL+PE+ AS +  KNG+++ LIE
Sbjct  2    MGA-VLLSEFATEIVVPVCAVIGIAFSLVQWLLVSRVKLNPERHASGNSNKNGYSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFS+ 
Sbjct  61   EEEGLNDPSVVTKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSSK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD+ K CKPALATA+FSTISFLLGA+TSV+SG LGMKIAT
Sbjct  121  SQPCTYDKEKTCKPALATAIFSTISFLLGAITSVLSGFLGMKIAT  165



>gb|KJB56580.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
 gb|KJB56581.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
Length=766

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA  +L +  TEI++PVCA++GIAF+LVQW+LVS+VKL+PE+ AS +  KNG+++ LIE
Sbjct  2    MGA-VLLSEFATEIVVPVCAVIGIAFSLVQWLLVSRVKLNPERHASGNSNKNGYSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFS+ 
Sbjct  61   EEEGLNDPSVVTKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSSK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD+ K CKPALATA+FSTISFLLGA+TSV+SG LGMKIAT
Sbjct  121  SQPCTYDKEKTCKPALATAIFSTISFLLGAITSVLSGFLGMKIAT  165



>gb|ADN96173.1| pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
hirsutum]
Length=766

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MGA+ +L +L TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSELATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIAT  165



>ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 152/168 (90%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  282
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  STKSQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIAT  167



>ref|XP_010928300.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=765

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL DL TEILIPV A+VGI F+LVQW+LVSKVK+SPE+    S  KNG+ + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLVQWMLVSKVKVSPERQPPASGNKNGYTDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQSAISEGATSFLFTEYQYVGLFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY + K CKPALA A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIAT  164



>ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Pyrus x bretschneideri]
Length=767

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  282
            MGA TILPDLG EILIP+CA++GIAF+LVQW+ VS+VKLSP     S S   AKNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLVQWMYVSQVKLSPGGGRDSNSGGAAKNGYNDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG NDHNVV +CAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGGNDHNVVLRCAEIQTAISEGATSFLFTEYKYVGAFMVAFAILIFLFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  + CTYD+TK+CKPALATA+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  STSGRACTYDQTKICKPALATAIFSTVSFLLGAITSVVSGFLGMKIAT  167



>ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=765

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             + IL DL TEILIPV A+VGI FAL+QW+LVSKVKLSPE+    S  KNG+ + LIEEE
Sbjct  2    GTAILSDLLTEILIPVAAVVGIVFALIQWMLVSKVKLSPEQHPPASGNKNGYTDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDHN+V KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNIVVKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQ  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTY + K CKPALA A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  PCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIAT  164



>ref|XP_007023297.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25919.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=768

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 149/163 (91%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLIEEE  297
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ AS    S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  65   EGINDHSVVTKCADIQTAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  124

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD+ K CKPALATA+FST+SFLLGAVTSV+SG LGMKIAT
Sbjct  125  PCTYDKEKACKPALATAIFSTVSFLLGAVTSVLSGFLGMKIAT  167



>ref|XP_007023298.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25920.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=769

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 149/163 (91%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLIEEE  297
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ AS    S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  65   EGINDHSVVTKCADIQTAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  124

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD+ K CKPALATA+FST+SFLLGAVTSV+SG LGMKIAT
Sbjct  125  PCTYDKEKACKPALATAIFSTVSFLLGAVTSVLSGFLGMKIAT  167



>gb|KJB35139.1| hypothetical protein B456_006G102100 [Gossypium raimondii]
Length=766

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MGA+ +L +L TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSELATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS 
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSM  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIAT  165



>gb|EYU40132.1| hypothetical protein MIMGU_mgv1a001763mg [Erythranthe guttata]
Length=762

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M  ST+L DLGT+I+IPVCA+VGIAFAL+QW  V+KVK+S EKS    DAKNGF+E LIE
Sbjct  1    MAESTLLTDLGTQIIIPVCALVGIAFALLQWYFVAKVKVSSEKS----DAKNGFSEPLIE  56

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EE+G++DH VV+KCAEIQ+AISEG+TSFL+TEY+YVGIFMVAFA++IFVFLGSVEGFST 
Sbjct  57   EEDGVSDHAVVRKCAEIQAAISEGSTSFLYTEYKYVGIFMVAFAVVIFVFLGSVEGFSTK  116

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             Q CTYD TKLCKPALATA FSTISF+LGAVTSV+SG LGMKIAT
Sbjct  117  PQTCTYDATKLCKPALATAAFSTISFILGAVTSVISGFLGMKIAT  161



>gb|KDP37047.1| hypothetical protein JCGZ_06103 [Jatropha curcas]
Length=765

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             S +L +LGTEIL+PVCA+VGI F+L+QW LVS+V L+ E+ A     KNG+ + LIEEE
Sbjct  2    GSALLSELGTEILVPVCAVVGIVFSLIQWYLVSRVTLTSERHAPGGANKNGYNDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIFVFLGSVEGFST S+
Sbjct  62   EGLNDHSVVTKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFVFLGSVEGFSTKSR  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD  K CKPALATAVFST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  PCTYDSQKTCKPALATAVFSTVSFLLGAITSVLSGFLGMKIAT  164



>ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   259 bits (662),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESLIE  291
             S +L + GTEI+IP+CA++GI F+LVQW LVS VKLSPE+   +  ++  NGF ESL+E
Sbjct  2    GSALLSEFGTEIVIPICAVIGIVFSLVQWYLVSLVKLSPEQGGCSPRNNKNNGFNESLVE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIFVFLGSVEGFST 
Sbjct  62   EEEGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFVFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY++ K+CKPALATA+FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  122  SQPCTYNKEKMCKPALATAIFSTISFLLGAVTSVVSGFLGMKIAT  166



>ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  282
            MGA+ +L +L TEI++P CA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPACAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  STKSQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIAT  167



>ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIE  291
             S +LPDLGTEI+IPVCA+VGI F+L QW +VS+VK+S E+  ++  ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLYQWYVVSRVKVSSERGDTSPSNNNKNGYGDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND NVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  62   EEEGVNDQNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY++ K+CKPALATA+FSTISFLLGA+TSV+SG LGMKIAT
Sbjct  122  SQPCTYNKEKMCKPALATAIFSTISFLLGAITSVISGFLGMKIAT  166



>gb|KJB64656.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=702

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  294
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  165



>gb|KHG25943.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=766

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MGA+ +L ++ TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSEMATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS 
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSM  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIAT  165



>ref|XP_006427442.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40682.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=683

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  294
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIAT  165



>gb|AAS66771.1| PPase [Hevea brasiliensis]
Length=769

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA----KNGFAESL  285
             + +L +LGTEIL+PVCA+VGI F+L+QW LVS+VKL+PE+ A  S      KNG+ + L
Sbjct  2    GTAVLSELGTEILVPVCAVVGIVFSLIQWYLVSRVKLTPERQAPGSSPAGANKNGYNDCL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDH+VV KCAEI++AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGLNDHSVVAKCAEIRTAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+ K CKPALATA+FST+SFLLGA TSVVSG LGMKIAT
Sbjct  122  TKSQPCTYDKQKTCKPALATAIFSTVSFLLGAFTSVVSGFLGMKIAT  168



>ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=769

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  285
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTVSFLLGAITSVISGFLGMKIAT  168



>emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=764

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  285
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFS  121

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTVSFLLGAITSVISGFLGMKIAT  168



>ref|XP_004287260.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump-like [Fragaria vesca subsp. vesca]
Length=765

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  288
            MGAS ILPDLG EILIP CA+VGI F+L+QW+ VS+V+LSP + S S+S  KNG+ + LI
Sbjct  1    MGAS-ILPDLGAEILIPFCAVVGIVFSLLQWVYVSRVQLSPARDSNSNSTGKNGYNDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+ND+NVVQKCAEIQ+AISEGATSFL+TEY+YVG FMVAFAILIFVFLGSVEGFST
Sbjct  60   EEEEGVNDNNVVQKCAEIQNAISEGATSFLYTEYKYVGAFMVAFAILIFVFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
                C  DETK+CKPALATA+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  SGHKCANDETKMCKPALATALFSTVSFLLGAITSVVSGFLGMKIAT  165



>ref|XP_004150506.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cucumis sativus]
 gb|KGN65098.1| hypothetical protein Csa_1G212840 [Cucumis sativus]
Length=768

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  282
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIAT  167



>ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=764

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA TILPDL  EILIP+CA++GIAF+L QW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLWAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYRYVGAFMVAFAILIFLFLGSVEGFSTS  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            S+ CTYD+TK CKPALATA+FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  SRACTYDQTKTCKPALATAIFSTISFLLGAVTSVVSGFLGMKIAT  164



>ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Malus domestica]
Length=767

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  282
            MGA TILPDLG EILIP+CA++GIAF+L QW+ VS+VKLSP     S S    KNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGGADKNGYNDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG NDHNVV +CAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGGNDHNVVLRCAEIQTAISEGATSFLFTEYKYVGAFMVAFAILIFLFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST S+ CTYD+TK+CKPALATA+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  STSSRACTYDQTKICKPALATAIFSTVSFLLGAITSVVSGFLGMKIAT  167



>gb|AAM97920.1| vacuolar proton-pumping PPase [Oxybasis rubra]
 gb|AAM97921.1| vacuolar proton-pumping PPase [Oxybasis rubra]
Length=764

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEILIPVCA++GI F+L+QW +VS+VKLSP+   S+++ KNGF+E+LIEEEEGI
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLIQWYVVSQVKLSPDSGRSNNN-KNGFSENLIEEEEGI  63

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            ND +VV KCAEIQ+AISEG+TSFL+T YQYVGIFM+AFA+LIFVFLGSVEGFST SQ CT
Sbjct  64   NDQSVVAKCAEIQNAISEGSTSFLYTMYQYVGIFMIAFAVLIFVFLGSVEGFSTKSQECT  123

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD++K CKPALATA+FST+SFLLGAVTS+ SG LGMKIAT
Sbjct  124  YDKSKTCKPALATAIFSTVSFLLGAVTSLASGFLGMKIAT  163



>gb|KJB64657.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=733

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  294
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  165



>gb|KJB64655.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=766

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  294
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSG LGMKIAT
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIAT  165



>ref|XP_008443926.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Cucumis melo]
Length=768

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  282
            MGA TILPDLG +I IP+CAI+GI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIIGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIAT  167



>gb|ABK91685.1| vacuolar H+-pyrophosphatase [Kalidium foliatum]
Length=764

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+ S   +++KNG AESLIEE+EG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPD-SGLGNNSKNGIAESLIEEKEGL  63

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA+LIF+FLGSVEGFST SQ CT
Sbjct  64   NDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAVLIFLFLGSVEGFSTSSQECT  123

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD+T+ CKPALATA+FST+SFLLGAVTS+ SG LGMKIAT
Sbjct  124  YDKTRRCKPALATAIFSTVSFLLGAVTSLASGFLGMKIAT  163



>gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=764

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   ++ ++KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGILFSLIQWYIVSQVKLSPDSGLAN-NSKNGIAESLIEEEEGL  63

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA+LIF+FLGSVEGFST +Q CT
Sbjct  64   NDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAVLIFLFLGSVEGFSTSTQECT  123

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD+T+ CKPALATA+FST+SFLLGAVTS+ SG LGMKIAT
Sbjct  124  YDKTRRCKPALATAIFSTVSFLLGAVTSLASGFLGMKIAT  163



>ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLI  288
            MGA TILPDL T+ILIP  A+VGIAFALVQW+LVSKVKLSPE+ +S + + KNG+++ LI
Sbjct  1    MGA-TILPDLLTQILIPATAVVGIAFALVQWLLVSKVKLSPERESSGAGNNKNGYSDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+N+HNVV KCAEIQSAISEGATSFL TEYQYVG+FM  FAILIF+FLGSVEGFST
Sbjct  60   EEEEGLNNHNVVVKCAEIQSAISEGATSFLVTEYQYVGVFMAVFAILIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTY + K+CKP LA A+FST+SFLLGA TSVVSG LGMKIAT
Sbjct  120  KSQPCTYSKDKICKPVLANAIFSTLSFLLGAFTSVVSGFLGMKIAT  165



>ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40683.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=746

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  294
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIAT  165



>gb|ADD51840.1| pyrophosphatase [Cucumis sativus]
Length=768

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  282
            MGA+ ILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGAA-ILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSG LGMKIAT
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIAT  167



>ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=766

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  294
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIAT  165



>ref|XP_008788803.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Phoenix dactylifera]
Length=765

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL DL TEILIPV A+VGI F+L QW+LVSKVKLSPE+       KN + + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLFQWMLVSKVKLSPERQTPARGNKNDYTDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY + K CKPALA A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIAT  164



>gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=764

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S  +N     LIE
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNN-KNGLIE  58

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST 
Sbjct  59   EEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTK  118

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  119  SQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIAT  163



>gb|AGQ50316.1| vaculoar H+ pyrophosphatase [Prosopis juliflora]
Length=764

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  297
             S +LPDLGTEILIPVCA++GI FAL QWILVS+VKLS   S S  ++KNG+ + LIEEE
Sbjct  2    GSALLPDLGTEILIPVCAVIGIGFALFQWILVSRVKLS-ASSDSSPNSKNGYNDYLIEEE  60

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EGINDH+VV KCAEIQ AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST  Q
Sbjct  61   EGINDHSVVIKCAEIQGAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFSTSQQ  120

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD+TK+CKPALATA+FST SF+LGA+TSV+SG LGMKIAT
Sbjct  121  PCTYDKTKMCKPALATAIFSTASFVLGAITSVISGFLGMKIAT  163



>gb|EYU34952.1| hypothetical protein MIMGU_mgv1a001747mg [Erythranthe guttata]
Length=765

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M  +T+L DLGT+I+IP+CA+VGI FALVQW+LV+KVK+S  KS S +D  NGF E+LIE
Sbjct  1    MAEATLLSDLGTQIIIPICALVGIVFALVQWMLVAKVKISTGKSNS-ADGNNGFTEALIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGI++H+V++KCA+IQ+AISEG+TSFLFT YQYVGIFMVAFA+LIF+FLGSV+GFST 
Sbjct  60   EEEGISEHSVIRKCADIQAAISEGSTSFLFTMYQYVGIFMVAFALLIFLFLGSVKGFSTS  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             QPC YD TK+CKPALATAVFST++FLLGAVTSV+SG LGMKIAT
Sbjct  120  HQPCAYDSTKMCKPALATAVFSTVAFLLGAVTSVISGFLGMKIAT  164



>ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Citrus sinensis]
Length=766

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-ASDSDAKNGFAESLIEE  294
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+  +S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPPSSNSDKKNGFNDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SG LGMKIAT
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIAT  165



>ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Eucalyptus grandis]
 gb|KCW82997.1| hypothetical protein EUGRSUZ_C04383 [Eucalyptus grandis]
Length=768

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLI  288
            A+TIL DLG EILIPVCA+VGI F+LVQW+LVSKVKL+P  +A+    ++ KNG+ + LI
Sbjct  2    ATTILSDLGAEILIPVCAVVGIVFSLVQWLLVSKVKLTPADAAAAPAANNGKNGYTDYLI  61

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            +EEE INDH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVEGFS 
Sbjct  62   DEEENINDHSVVLKCAEIQTAISEGATSFLFTEYQYVGVFMVAFAVLIFLFLGSVEGFSM  121

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD TKLCKPALATAVFST++FLLG +TSVVSG LGMKIAT
Sbjct  122  KSQPCTYDATKLCKPALATAVFSTVAFLLGGITSVVSGFLGMKIAT  167



>ref|XP_008795832.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=765

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL DL T ILIPV A+VGI FALVQW  VSKVKLSPE+    S  KNG+++ LIE
Sbjct  1    MGAA-ILSDLLTVILIPVAAVVGIVFALVQWTFVSKVKLSPEQQPPASGNKNGYSDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCA+IQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQTAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSLVSGFLGMKIAT  164



>ref|XP_010927355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=767

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESLIEEEE  300
            IL DL TEILIPV A+VGI FAL+QW++VS+VKLSPE+    + S  KN +++ LIEEEE
Sbjct  5    ILADLLTEILIPVAAVVGIGFALMQWLMVSRVKLSPERQGPLAGSKNKNDYSDYLIEEEE  64

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFST SQP
Sbjct  65   GLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFSTKSQP  124

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTY + K CKPALA AVFST+SFLLGA+TS+VSG LGMKIAT
Sbjct  125  CTYSKDKYCKPALANAVFSTVSFLLGAITSLVSGFLGMKIAT  166



>ref|XP_008801902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGA+ IL DL TEILIPV A+VGI F+L+QW LVS+VKLSPE+    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFSLIQWGLVSRVKLSPERQGLPAGSNDKNDYSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  120  TKSQPCTYSKDKYCKPALANAIFSTVSFLLGAITSLVSGFLGMKIAT  166



>ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
 gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
Length=767

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG--FAESLIEEEE  300
            ILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P   A +++  N   +++ LIEEEE
Sbjct  5    ILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPSGGAGNNNNNNKNGYSDYLIEEEE  64

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+NDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST SQP
Sbjct  65   GVNDHNVVLKCADIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQP  124

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTYD+ K+CKPALATA FST+SFLLGA TSVVSG LGMKIAT
Sbjct  125  CTYDQFKMCKPALATAAFSTVSFLLGAFTSVVSGFLGMKIAT  166



>ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=763

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 143/165 (87%), Gaps = 3/165 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ IL  L TEILIP  A+VGIAFALVQW+LVSKVKLSPE SAS   +K+G ++ LIE
Sbjct  1    MAAAAILSGLLTEILIPAAAVVGIAFALVQWLLVSKVKLSPEDSAS---SKDGVSDYLIE  57

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  58   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  117

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            +QPCTY + K CKPALA A FSTISFLLGA TS+VSG LGMKIAT
Sbjct  118  AQPCTYSKDKYCKPALANAGFSTISFLLGATTSLVSGFLGMKIAT  162



>gb|ABS01290.1| tonoplast proton pump [Lotus corniculatus]
Length=767

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  282
            MGA  +LPDLGTEILIPVCA++GI FAL QW LVSKVK++    + ++ D+  KNG+ + 
Sbjct  1    MGA-VLLPDLGTEILIPVCAVIGIVFALFQWFLVSKVKITAATRDAASPDAAGKNGYNDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEGIND NVV KCAEIQ AISEGATSFLFTEY+YVGIFMV FAI+IF+FLGSVEGF
Sbjct  60   LIEEEEGINDQNVVLKCAEIQQAISEGATSFLFTEYKYVGIFMVFFAIVIFLFLGSVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST  QPC YDETK+CKPALATA+FSTISF+LG +TSVVSG LGMKIAT
Sbjct  120  STSHQPCKYDETKICKPALATALFSTISFVLGGITSVVSGFLGMKIAT  167



>ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-KSASDSDAKNGFAESLIEE  294
            A   L DL TE+LIPV A+VGI FALVQW+LVSKVKLSPE +S+   + KNG+++ LIEE
Sbjct  2    AVAFLSDLLTEVLIPVAAVVGIVFALVQWLLVSKVKLSPEGESSGTGNGKNGYSDYLIEE  61

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFM  FA+LIF+FLGSVEGFST +
Sbjct  62   EEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMAVFAVLIFLFLGSVEGFSTKN  121

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTY++ K CKPALA A+FST+SFLLGA TSVVSG LGMKIAT
Sbjct  122  QPCTYNKDKTCKPALANAIFSTLSFLLGAFTSVVSGFLGMKIAT  165



>ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +LPDL TEI+IPVCA++GIAF+L QW +VS+VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLFQWYIVSQVKLSPD-STRNNNNKNGFSDSLIE  58

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  59   EEEGLNDQSVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTS  118

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTYD+T+ CKPALATA+FST++FLLGA+TS+ SG  GMKIAT
Sbjct  119  SQECTYDKTRRCKPALATAIFSTVAFLLGAITSLGSGFFGMKIAT  163



>gb|EPS68114.1| inorganic pyrophosphatase, partial [Genlisea aurea]
Length=765

 Score =   254 bits (648),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  300
            +LPDLG EILIP+CA++GI F+L QW LVSKVKL+P +  S   ++ +NG+ + LIEEEE
Sbjct  5    LLPDLGAEILIPLCAVIGIVFSLAQWFLVSKVKLTPGRGGSSAANNGRNGYRDHLIEEEE  64

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMV FA LIF+FLGSV+GFST SQP
Sbjct  65   GLNDQSVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVIFAALIFLFLGSVQGFSTKSQP  124

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTYD+ K CKPALATAVFST SFLLGA+TSVVSG LGMKIAT
Sbjct  125  CTYDQEKFCKPALATAVFSTASFLLGAITSVVSGFLGMKIAT  166



>ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=767

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGA+ IL DL TEILIPV A+VGI FAL+QW LVS+VKLSPEK    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFALIQWGLVSRVKLSPEKQGPPAGSNNKNDYSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDHN+V KCA+IQ AISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNIVVKCADIQRAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  120  TKSQPCTYSKDKYCKPALANAIFSTVSFLLGAITSLVSGFLGMKIAT  166



>gb|AAA61610.1| pyrophosphatase [Beta vulgaris]
Length=765

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ +LPDL TEI+IPVCA++GIAF+L+QW +V +VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLLQWYIVLRVKLSPD-STRNNNNKNGFSDSLIE  58

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  59   EEEGLNDQSVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTS  118

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTYD+T+ CKPALATA+FST++FLLGA+TS+ SG  GMKIAT
Sbjct  119  SQECTYDKTRRCKPALATAIFSTVAFLLGAITSLGSGFFGMKIAT  163



>ref|XP_009407207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-ASDSDAKNGFAESLI  288
            MGA+ +L D  TE+LIPV A+VGIAFALVQW+LVS VKLSPE+     S+ KNG+++ LI
Sbjct  1    MGAA-MLTDQVTEVLIPVAAVVGIAFALVQWLLVSTVKLSPERQPGGGSNDKNGYSDYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FM  FA+LIF+FLGSVEGFST
Sbjct  60   EEEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMAVFAVLIFLFLGSVEGFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTY + K CKPALA A+FST SFLLGAVTSVVSG LGMKIAT
Sbjct  120  KSQPCTYSKDKYCKPALANALFSTASFLLGAVTSVVSGFLGMKIAT  165



>ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Vitis vinifera]
 emb|CBI36393.3| unnamed protein product [Vitis vinifera]
Length=767

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG--FAESLIE  291
             STIL DL TEI++PVCA++GI F+L+QW LVS++K+SP++ +S S+   G  + + LIE
Sbjct  2    GSTILSDLATEIVVPVCAVIGIVFSLIQWFLVSRIKVSPDRHSSSSNNGKGAGYGDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSV GFST 
Sbjct  62   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVNGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTY+  ++CKPALATA+FST+SF+LGAVTSV+SG LGMKIAT
Sbjct  122  SQVCTYNPQEMCKPALATAIFSTVSFMLGAVTSVISGFLGMKIAT  166



>gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata]
Length=764

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEEGL  63

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            +DH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA LI +FLGSVEGFST SQ CT
Sbjct  64   SDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAALILLFLGSVEGFSTSSQECT  123

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD+ + CKPALATA+FST+SFLLGA+TS+ SG LGMKIAT
Sbjct  124  YDKARRCKPALATAIFSTVSFLLGAITSLASGFLGMKIAT  163



>gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica]
Length=764

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEEGL  63

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            +DH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA LI +FLGSVEGFST SQ CT
Sbjct  64   SDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAALILLFLGSVEGFSTSSQECT  123

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD+ + CKPALATA+FST+SFLLGA+TS+ SG LGMKIAT
Sbjct  124  YDKARRCKPALATAIFSTVSFLLGAITSLASGFLGMKIAT  163



>ref|XP_006852851.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
 gb|ERN14318.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
Length=765

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL +   EILIPV A++GI F+LVQW++V++VKLSP+  A  S +KNG+ + LIE
Sbjct  1    MGAA-ILSETLAEILIPVAAVIGIVFSLVQWLIVARVKLSPQAPAPSSKSKNGYTDYLIE  59

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQ CTY + K CKPALA A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  SQACTYSKDKTCKPALANAIFSTLSFLLGAITSVVSGYLGMKIAT  164



>gb|AGJ81362.1| vacuolar H+ pyrophosphatase 1 [Brassica napus]
Length=768

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  285
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  167



>ref|XP_002453419.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
 gb|EES06395.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
Length=766

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+L+PE+ A    AK+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRLTPERRADGGAAKSGPSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  SQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  165



>ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 142/165 (86%), Gaps = 4/165 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            MGA+ IL  L TEILIPV A+VGIAFALVQW+LVSKV LSPEK A   D   G ++ LIE
Sbjct  1    MGAA-ILSGLLTEILIPVAAVVGIAFALVQWLLVSKVSLSPEKPAGSRD---GVSDYLIE  56

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  57   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  116

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            +QPCTY + K CKPALA A FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  117  AQPCTYSKDKYCKPALANAGFSTLSFLLGAITSLVSGFLGMKIAT  161



>ref|XP_008793954.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 143/167 (86%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  285
            MGA+ IL DL TEI+IPV A+VGI FAL+QW+LVS+VKLSPE+    + S  KNG ++ L
Sbjct  1    MGAA-ILTDLLTEIVIPVAAVVGIGFALMQWLLVSRVKLSPERQGPLAGSKNKNGCSDYL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ DHNVV KCAEIQSAI EGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLTDHNVVVKCAEIQSAIYEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPC Y + K CKPALA AVFST+SFLLGA+TS+VSG LGMKIAT
Sbjct  120  TKSQPCAYSKDKYCKPALANAVFSTVSFLLGAITSLVSGFLGMKIAT  166



>ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Brassica rapa]
Length=768

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  285
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  167



>gb|ABD98735.1| vacuolar H+-pyrophosphatase [Oxybasis glauca]
Length=763

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            +LPDLGTEILIPVCA++GI F+LVQW +V++VKLSP+   S+S+ KNG++ESLIEEE G+
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLVQWYIVAQVKLSPDSGRSNSN-KNGYSESLIEEE-GL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            ND  VV KCAEIQ+AISEG+TSFL+T YQYVG+FMVAFA+LIFVFLGSVEGFST SQ CT
Sbjct  63   NDPAVVAKCAEIQNAISEGSTSFLYTMYQYVGVFMVAFAVLIFVFLGSVEGFSTKSQECT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD++K CKPALATAVFST+SFLLGA+TS+ SG LGMKIAT
Sbjct  123  YDKSKTCKPALATAVFSTVSFLLGAITSLASGFLGMKIAT  162



>emb|CDY53310.1| BnaA09g56670D [Brassica napus]
Length=802

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  285
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  167



>ref|XP_010691127.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  303
            ++ DL TEI IPVCA++GI F+LVQW LVSKVK+S ++  ++   AKNGF + LIEEEEG
Sbjct  1    MISDLATEIFIPVCAVIGIIFSLVQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEEG  60

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            +ND NVV KCAEIQ+AISEGATSFLFTEYQYVG+FM AFA+LIFVFLGSVEGFST SQPC
Sbjct  61   VNDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMCAFAVLIFVFLGSVEGFSTESQPC  120

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY   K CKPALATA+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  121  TYSPLKKCKPALATALFSTVSFLLGAITSVVSGFLGMKIAT  161



>ref|XP_010557616.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Tarenaya hassleriana]
Length=768

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  282
            MG + ILPDLGTEILIPVCA++GI FA  QW LVS+VKL P  +A+ +++   KNG+ + 
Sbjct  1    MGGA-ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVPGAAAASTNSGGRKNGYDDY  59

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDHNVV KCAEIQ+AISEGA+SFLFTEY+YVGIFMV FA +IF  L SVEGF
Sbjct  60   LIEEEEGLNDHNVVVKCAEIQNAISEGASSFLFTEYKYVGIFMVIFAAVIFGALASVEGF  119

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST +QPCTYD+TK CKPALATA+FSTISFLLGA+TSVVSG LGMKIAT
Sbjct  120  STSTQPCTYDKTKRCKPALATALFSTISFLLGAITSVVSGFLGMKIAT  167



>ref|XP_009385121.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=771

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIEEEE  300
            ++ DL TE+LIPV ++VGI F+L+QW  VSKVKLSPE+    +    KNG+++ LIEEEE
Sbjct  5    MMSDLLTEVLIPVASVVGIFFSLLQWYFVSKVKLSPERQTRGAHDHGKNGYSDRLIEEEE  64

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            GINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMV FAILIF+FLGSVEGFST SQP
Sbjct  65   GINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVVFAILIFLFLGSVEGFSTKSQP  124

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTY + + CKPALA A+FST+SFLLGAVTS+VSG LGMKIAT
Sbjct  125  CTYSKDRTCKPALANAIFSTLSFLLGAVTSIVSGFLGMKIAT  166



>ref|XP_009410369.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=767

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFA-ESL  285
            MGA+ +L  + TEILIPV A++GIAFAL+QW+LVS VKLSPE+ + +  + KNGFA + L
Sbjct  1    MGAA-MLTGVITEILIPVAAVIGIAFALLQWMLVSAVKLSPERQTPAGGNKKNGFAADFL  59

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVG+FM  FA+LIF+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGVFMAVFAVLIFLFLGSVEGFS  119

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY + K CKPALA AVFST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  TKSQPCTYSKDKFCKPALANAVFSTVSFLLGAITSVVSGFLGMKIAT  166



>emb|CDX87313.1| BnaA07g35600D [Brassica napus]
Length=769

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  285
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    DAKNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDAKNGNEDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDESVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>gb|AFW66266.1| hypothetical protein ZEAMMB73_353171 [Zea mays]
Length=767

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  1    MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  60

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST
Sbjct  61   EEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFST  120

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  KSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  166



>gb|EYU24628.1| hypothetical protein MIMGU_mgv1a001756mg [Erythranthe guttata]
Length=764

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESLIEEEE  300
            +L DLGTEI+IPVCA++GIAF+L QW LVS+VK+ P+     +  + KNG+ + LI+EEE
Sbjct  3    LLSDLGTEIVIPVCAVIGIAFSLFQWYLVSRVKVKPDHGGEPAAKNGKNGYGDYLIDEEE  62

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
             IND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST SQ 
Sbjct  63   SINDQNVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTKSQA  122

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTY++ KLCKPALATA+FSTISF+LGA+TSV+SG  GMKIAT
Sbjct  123  CTYNKDKLCKPALATALFSTISFVLGAITSVLSGFFGMKIAT  164



>gb|AET95912.1| PHP1 [Lagenaria siceraria]
Length=768

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN---GFAESLIEE  294
            TILPDLG EI IPVCAIVGI F+LVQW  VS+VKLSP + ++++++     G+++ LIEE
Sbjct  4    TILPDLGAEIFIPVCAIVGILFSLVQWYYVSQVKLSPGRDSANNNSAAAKNGYSDYLIEE  63

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA+LIFVFLGSVEGFST  
Sbjct  64   EEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAVLIFVFLGSVEGFSTKP  123

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Q C YD+TK CKPALATA FSTISF+LGAVTSVVSG LGMKIAT
Sbjct  124  QACLYDKTKTCKPALATAAFSTISFVLGAVTSVVSGFLGMKIAT  167



>gb|ADJ67258.1| vaculor H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  L TE+ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEEG+
Sbjct  3    ILSPLATEVFIPVAAVIGIVFAVVQWVLVSRVKLSPTAAAASGGGKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+A+SEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  63   NDHNVVVKCAEIQNAVSEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  162



>emb|CDY33390.1| BnaC05g11930D [Brassica napus]
Length=771

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  276
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  170



>ref|XP_010541940.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Tarenaya hassleriana]
Length=765

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            ILPDLGTEILIPVCA++GI FA  QW LVS+VKL    +AS    KNG+ + LIEEEEG+
Sbjct  5    ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVSGATASSGSRKNGYDDYLIEEEEGL  64

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH VV KCAEIQ+AISEGA+SFLFTEY+YVGIFM  FA++I V LGSVEGFST +QPC 
Sbjct  65   NDHAVVVKCAEIQNAISEGASSFLFTEYKYVGIFMAIFAVVICVALGSVEGFSTSNQPCN  124

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            YD+TK CKPALATAVFST+SFLLGA+TSVVSG LGMKIAT
Sbjct  125  YDKTKECKPALATAVFSTVSFLLGAITSVVSGFLGMKIAT  164



>ref|NP_001288927.1| uncharacterized protein LOC103832483 [Brassica rapa]
 gb|AET95911.1| AVP1-2 [Brassica rapa]
Length=769

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  285
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDESVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>ref|XP_008679906.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
Length=859

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  93   MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  152

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST
Sbjct  153  EEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFST  212

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  213  KSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  258



>emb|CBI25554.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSVEGFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQPCL  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y++ ++CKPALA A+FSTISFLLG +TS++SG LGMKIAT
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIAT  162



>emb|CAN65456.1| hypothetical protein VITISV_035221 [Vitis vinifera]
Length=764

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSVEGFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQPCL  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y++ ++CKPALA A+FSTISFLLG +TS++SG LGMKIAT
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIAT  162



>ref|NP_001266772.1| uncharacterized protein LOC101027208 [Zea mays]
 gb|ACN33286.1| unknown [Zea mays]
 gb|ACR36585.1| unknown [Zea mays]
Length=762

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  161



>ref|XP_002438225.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|EER89592.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|ACV74424.1| vacuolar H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  124  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  303
            TIL  L T++ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEEG
Sbjct  2    TILSPLATKVFIPVAAVIGIVFAVVQWVLVSRVKLSPAAAAASGGGKNGYGDYLIEEEEG  61

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            +NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPC
Sbjct  62   LNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPC  121

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY++ K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  122  TYNKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  162



>ref|XP_006300952.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
 gb|EOA33850.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
Length=780

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  AMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAES  282
            AM A  +LP++ TE L+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + 
Sbjct  11   AMLAKALLPEVWTETLVPVCAVVGIVFSLFQWYVVSCVKLTADRSDLSSTEDGKNGHGDY  70

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+NDH+VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGF
Sbjct  71   LIEEEEGVNDHSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGF  130

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            S  SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  131  SIKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  178



>gb|AFW70478.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPC Y + + CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  SQPCHYIKDQTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  165



>gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplachne fusca]
Length=763

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +L TE+ IPV  I+GIAFA+VQW+LVSKVKLSP  +AS  +   G+ + LIEEEEG+
Sbjct  3    ILSELATEVFIPVAGIIGIAFAIVQWVLVSKVKLSPAAAASGGNKNGGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFTEYQ+VGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  63   NDHNVVAKCAEIQTAISEGATSFLFTEYQHVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKDKNCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  162



>gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Erythranthe guttata]
Length=769

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 143/166 (86%), Gaps = 6/166 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS------ASDSDAKNGFAESLI  288
            +L + GTEI+IPVCA++GI F+LVQW +VSKVK+SPE+S      A+++    G+ + LI
Sbjct  3    LLSEQGTEIVIPVCAVIGIIFSLVQWYIVSKVKVSPERSGAAASPAANNGKNGGYNDYLI  62

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEE+GI+D NVV KCAEIQ+AISEGATSFL+TEYQYVGIFM+AFAILIF+FLGSVEGFST
Sbjct  63   EEEDGIDDQNVVAKCAEIQNAISEGATSFLYTEYQYVGIFMIAFAILIFLFLGSVEGFST  122

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             +QPCTY++  LCKPALATAVFST SFLLGAVTSV+SG LGMKIAT
Sbjct  123  KNQPCTYNKETLCKPALATAVFSTASFLLGAVTSVISGFLGMKIAT  168



>emb|CDX81728.1| BnaC08g38730D [Brassica napus]
Length=1174

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  285
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYDDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  167



>ref|XP_010417704.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  285
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MSAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>ref|XP_010537929.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Tarenaya hassleriana]
Length=769

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 3/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  282
            M A  +L ++GTEI++P+CA+VGI F+LVQW LVS+VKL+ ++ AS    ++ KNG+ + 
Sbjct  1    MVAVALLSEMGTEIVVPLCAVVGIVFSLVQWFLVSRVKLTDDRGASSGGANNGKNGYGDY  60

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG FMV FA LIF+FLGSVE F
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGAFMVLFAFLIFIFLGSVESF  120

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPCTYD+T+ CKPALATA FST+SFLLGAVTS++SG LGMKIAT
Sbjct  121  STKSQPCTYDKTRTCKPALATAAFSTVSFLLGAVTSLLSGFLGMKIAT  168



>emb|CDY39975.1| BnaC06g40530D [Brassica napus]
Length=769

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  285
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+T  CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYDKTTTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>ref|XP_010539519.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Tarenaya hassleriana]
Length=769

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIEEE  297
            +LP++GTE+++P+CA++GI F+LVQW LVS+VKL+ +  +S   A   KNG+ + LIEEE
Sbjct  6    LLPEIGTEVVVPLCAVIGIVFSLVQWFLVSRVKLTTDGGSSSGGANKGKNGYDDYLIEEE  65

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG ND +VV KCAEIQ+AISEGATSFLFTEY+YVG FMV FAILIF+FLGSVEGFS+ SQ
Sbjct  66   EGGNDQSVVAKCAEIQNAISEGATSFLFTEYKYVGAFMVGFAILIFLFLGSVEGFSSKSQ  125

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD+T++CKPALATA FSTISFLLGAVTS++SG LGMKIAT
Sbjct  126  PCTYDKTRMCKPALATAAFSTISFLLGAVTSLLSGFLGMKIAT  168



>ref|XP_004951662.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X3 [Setaria italica]
Length=765

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLIEEE  297
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D  A K G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQ  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PC Y + K+CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  122  PCHYSKDKICKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  164



>ref|XP_010429951.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Camelina sativa]
 ref|XP_010429952.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Camelina sativa]
Length=769

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESLIEEEE  300
            +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + LIEEEE
Sbjct  6    LLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGKNGHGDYLIEEEE  65

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFST SQP
Sbjct  66   GVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFSTKSQP  125

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  126  CTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>ref|NP_001288904.1| uncharacterized protein LOC103836019 [Brassica rapa]
 gb|AET95910.1| AVP1-1 [Brassica rapa]
Length=769

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  282
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ AS S +   KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  168



>emb|CDY36581.1| BnaA06g10340D [Brassica napus]
Length=771

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  276
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  170



>ref|XP_004951661.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Setaria italica]
Length=795

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLIEEE  297
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D  A K G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQ  121

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PC Y + K+CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  122  PCHYSKDKICKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  164



>ref|NP_001077542.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 gb|AEE29350.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=642

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>gb|AFW77130.1| hypothetical protein ZEAMMB73_840165 [Zea mays]
Length=819

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  161



>gb|EAY84762.1| hypothetical protein OsI_06130 [Oryza sativa Indica Group]
Length=285

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  279
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  169



>ref|NP_001268155.1| vacuolar pyrophosphatase [Vitis vinifera]
 emb|CAD89675.2| vacuolar pyrophosphatase [Vitis vinifera]
Length=764

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSV GFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVAGFSTKSQPCL  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y++ ++CKPALA A+FSTISFLLG +TS++SG LGMKIAT
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIAT  162



>gb|ABR18024.1| unknown [Picea sitchensis]
Length=765

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  288
            MG + +L +  TE+LIPV A+VGIAFAL+QW LVS+VK++P+ S + S+  KNG+ E LI
Sbjct  1    MGGA-LLSETLTEVLIPVAAVVGIAFALIQWFLVSRVKVAPDHSHTPSNNNKNGYTEYLI  59

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG+NDHNVV KCAEIQ+AISEGA SFLFTEYQY+GIFMV FAILIF+FLGSVE FST
Sbjct  60   EEEEGVNDHNVVNKCAEIQNAISEGANSFLFTEYQYMGIFMVCFAILIFLFLGSVEKFST  119

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTY++  +CKPALA A+FSTISFLLG++TS+ SG LGMKIAT
Sbjct  120  QSQPCTYNKEVMCKPALANAIFSTISFLLGSLTSIFSGYLGMKIAT  165



>gb|KFK43817.1| hypothetical protein AALP_AA1G177100 [Arabis alpina]
Length=771

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M  +T+LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVVATLLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA++IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAVVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST  +PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTKDKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=764

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  300
            + ILP+L  ++LIPV A VGIAFA++QW+LVSKV+L+PE+       K+G ++ LIEEEE
Sbjct  2    AAILPELAAQVLIPVAAAVGIAFAVLQWVLVSKVRLTPERRGEGGAGKSGPSDYLIEEEE  61

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQP
Sbjct  62   GLNDHNVVSKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQP  121

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            C Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  122  CHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  163



>ref|XP_010472923.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  285
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MLAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTY++T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYEKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>gb|AAL57660.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina]
Length=769

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  285
            M    +LP+L TEILIPVCA++GI F+L QW +VS VKL+ +   S S  D KNG  + L
Sbjct  1    MMTKAMLPELLTEILIPVCAVIGIIFSLFQWYIVSCVKLNSDGDVSSSLDDDKNGHEDYL  60

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+ND NVV KCAEIQ+AISEGATSFL+TEY+YV +FMV FA++IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDENVVAKCAEIQTAISEGATSFLYTEYKYVSVFMVFFAVIIFLFLGSVEGFS  120

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  167



>ref|NP_173021.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 sp|P31414.1|AVP1_ARATH RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump 1; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase 
1; Short=H(+)-PPase 1; AltName: Full=Vacuolar 
proton pyrophosphatase 1; AltName: Full=Vacuolar proton pyrophosphatase 
3 [Arabidopsis thaliana]
 gb|AAF82139.1|AC034256_3 Identical to Vacuolar proton pyrophosphatase (AVP3) from Arabidopsis 
thaliana gb|AB015138 and gb|M81892. ESTs gb|AA006922, 
gb|AA586042, gb|AA651053, gb|AA712863, gb|AA394384, gb|AA605347, 
gb|AA006474, gb|AA006772, gb|AA650817, gb|AA042538, gb|AA006217, 
gb|AW004149, gb|H36252, gb|H36659, gb|R30444, gb|W43600, 
gb|W43886, gb|W43517, gb|W43127, gb|N96656, gb|T14167, 
gb|T76140, gb|T21188, gb|Z17694, gb|Z17695 come from this 
gene [Arabidopsis thaliana]
 gb|AAA32754.1| vacuolar H+-phosphatase [Arabidopsis thaliana]
 gb|AAO00841.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29349.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=770

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>ref|XP_002890120.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66379.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=770

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST S+PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDSKPCTYDTTRTCKPALATAGFSTIAFVLGAVTSVLSGFLGMKIAT  169



>gb|AAL84953.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
Length=767

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  291
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++PE+ A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPERHAPPPGPNSNKNGFNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  + CKPALATA+FST++F+LG VTS++SG LGMKIAT
Sbjct  122  SQPCTYDAQRTCKPALATAIFSTVAFVLGGVTSILSGFLGMKIAT  166



>emb|CDX96835.1| BnaA08g23780D [Brassica napus]
Length=769

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  282
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ AS S +   KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTE +YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTESRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  168



>ref|XP_009148959.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Brassica rapa]
Length=771

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  276
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+ ++S ++ AS       + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRFRVSADQGASSHCGGAINGKNGYG  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIAT  170



>ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIEEE  297
            +L  L TEI+IPV A+VGI F+LVQW LVS+VK++PE+ A  S     KNG+ + LIEEE
Sbjct  4    LLSTLATEIVIPVAAVVGIVFSLVQWYLVSRVKVTPERQAPPSGPNSNKNGYNDILIEEE  63

Query  298  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  477
            EG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST SQ
Sbjct  64   EGLNDQNVVTKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTKSQ  123

Query  478  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            PCTYD  K CKPALATA+FST++F+LG +TSV+SG LGMKIAT
Sbjct  124  PCTYDAKKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIAT  166



>dbj|BAE98517.1| hypothetical protein [Arabidopsis thaliana]
Length=767

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESLIEE  294
            +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ + LIEE
Sbjct  3    LLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGDYLIEE  62

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST +
Sbjct  63   EEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEGFSTDN  122

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            +PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  123  KPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  166



>ref|XP_006306837.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
 gb|EOA39735.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
Length=766

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVAAALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGKNGHGDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEGIND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGINDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ++ CTYD T+ CKPALATA FST++F+LGAVTSV+SG LGMKIAT
Sbjct  121  NKACTYDTTRTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIAT  165



>ref|XP_003564217.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Brachypodium distachyon]
Length=762

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  LGTE+ IPV A++GI FA+VQW+LV++VK++P  +A  + AKNG+ + LIEEEEG+
Sbjct  3    ILSALGTEVFIPVAAVIGIVFAVVQWVLVARVKVTP-GAAGATGAKNGYGDYLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVGIFM+ FA+LIF+FLGS+EGFST  +PCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGIFMIIFAVLIFLFLGSIEGFSTKGKPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K+CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  122  YSKDKICKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>ref|XP_006389797.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
 gb|ESQ27083.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
Length=768

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  288
            M A  +LP+  TEIL+PVCA+VGI F+L QW +VS VKL+ ++    + D KNG  + LI
Sbjct  1    MMAKALLPEFWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRGGEHEGDGKNGHDDYLI  60

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEEEG++D +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFST
Sbjct  61   EEEEGVHDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAVIFLFLGSVQGFST  120

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SG LGMKIAT
Sbjct  121  KSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIAT  166



>gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron]
Length=767

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE--KSASDSDAKNGFAESLIEEEE  300
            +LPDLGTEILIP+CA+VGI F+L QW +VS+VKLSP+  ++ ++++   G  E+LIEEEE
Sbjct  5    LLPDLGTEILIPLCAVVGILFSLFQWYIVSQVKLSPDSGRTNNNNNKNGGVVENLIEEEE  64

Query  301  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  480
            G+NDH+VV KCAEIQ+AISEGATSFL+TEYQYV IFM+ FA++IF+FLGSVEGFST SQ 
Sbjct  65   GLNDHSVVTKCAEIQTAISEGATSFLYTEYQYVAIFMIPFAVIIFLFLGSVEGFSTSSQE  124

Query  481  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            CTYD T+ CKPAL TA+FST++F+LGAVTS+ SG LGMKIAT
Sbjct  125  CTYDNTRRCKPALFTAIFSTVAFVLGAVTSLASGFLGMKIAT  166



>ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=767

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  291
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++P + A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPGRHAPPAGPNSNKNGFNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  + CKPALATAVFST++F+LG VTS++SG LGMKIAT
Sbjct  122  SQPCTYDAQRTCKPALATAVFSTVAFVLGGVTSILSGFLGMKIAT  166



>gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=763

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  303
            ++ DL TEILIP CA+VGI F+LVQW +V+KVK+S EK  ++   AKNG+ + LIEEE+G
Sbjct  1    MISDLATEILIPACAVVGILFSLVQWFIVAKVKVSSEKHVNNGGSAKNGYNDYLIEEEDG  60

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
             ND  V+ KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST  Q C
Sbjct  61   ANDQEVIAKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKGQAC  120

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY   K CKPALATA+FSTISF+LGAVTSVVSG LGMKIAT
Sbjct  121  TYSPLKECKPALATALFSTISFVLGAVTSVVSGFLGMKIAT  161



>ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Fragaria vesca subsp. vesca]
Length=767

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  291
            + +L  L TEI+IPVCA+VGI F+L+QW LVS+V+++P+++A     +  KNGF + LIE
Sbjct  2    AVLLSYLATEIVIPVCAVVGILFSLLQWYLVSRVRVTPDRNAPAPGTNAKKNGFNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA+LIF+FLGSV+GFST 
Sbjct  62   EEEGVTDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAVLIFLFLGSVKGFSTE  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD T  CKPALATA+FST++FLLG +TS++SG LGMKIAT
Sbjct  122  SQPCTYDVTSTCKPALATALFSTVAFLLGGITSLLSGFLGMKIAT  166



>ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Camelina sativa]
Length=766

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ++ CTYD  ++CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  NKACTYDAKRVCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  165



>ref|XP_004965753.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=769

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN---GFAES  282
            M +   LP+L T++++PV A+VGIAFA++QW+LVSKVKLSPE    D  +     G +E 
Sbjct  1    MASPAFLPELATQVIVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSSGKSGAGASEY  60

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEGF
Sbjct  61   LIEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEGF  120

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  STKSQPCHYSKGKMCKPALANALFSTIAFVLGAVTSLVSGFLGMKIAT  168



>emb|CAG29370.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ I   L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAIPSKLATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPC Y + + CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  SQPCHYIKDQTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  165



>ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSAGKNGHEDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ++ CTYD  ++CKPALATA FST++F+LGAVTSV+SG LGMKIAT
Sbjct  121  NKACTYDAKRICKPALATAAFSTVAFVLGAVTSVLSGFLGMKIAT  165



>ref|XP_006656294.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=772

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 140/168 (83%), Gaps = 5/168 (3%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-----EKSASDSDAKNGFAES  282
            ++ ILPDL T++L+P  A+VGIAFA+ QW+LVSKVK+ P     E SAS      G +E 
Sbjct  4    SAAILPDLATQVLVPAAAVVGIAFAVAQWVLVSKVKMMPVERRGEGSASGPGKNGGASEY  63

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+N+HNVV+KC+EIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGF
Sbjct  64   LIEEEEGLNEHNVVEKCSEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGF  123

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  124  STKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  171



>ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ++ CTYD  ++CKPALATA FST++F+LGAVTSV+SG LGMKIAT
Sbjct  121  NKACTYDAKRVCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIAT  165



>gb|AJR29310.1| H+-pyrophosphatase [Secale cereale]
Length=762

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGT+I+IPVC +VGI FA+ QW +VSKVK++P  +++ + +KNG+ + LIEEEEG+
Sbjct  3    ILGELGTQIIIPVCGVVGIVFAVAQWFIVSKVKVTPGAASATAGSKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FM+ FA++IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMIVFAVVIFVFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y  T  CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>gb|AAA61609.1| pyrophosphatase [Beta vulgaris]
Length=761

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  303
            ++ DL TEI IPVCA++G   +  QW LVSKVK+S ++  ++   AKNGF + LIEEEEG
Sbjct  1    MISDLATEIFIPVCAVIGY-ISCYQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEEG  59

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            +ND NVV KCAEIQ+AISEGATSFLFTEYQYVG+FM AFA+LIFVFLGSVEGFST SQPC
Sbjct  60   VNDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMCAFAVLIFVFLGSVEGFSTESQPC  119

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY   K CKPALATA+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  120  TYSPLKKCKPALATALFSTVSFLLGAITSVVSGFLGMKIAT  160



>dbj|BAA32210.1| Vacuolar proton pyrophosphatase [Arabidopsis thaliana]
Length=770

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 142/169 (84%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A  +L +L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLLELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>gb|AAL11506.1|AF367446_1 vacuolar H+-pyrophosphatase [Prunus persica]
Length=767

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  291
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++ E+ A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTLERHAPPAGPNSNKNGFNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  + CKPALATA+FST++F+LG VTS++SG LGMKIAT
Sbjct  122  SQPCTYDAQRTCKPALATAIFSTVAFVLGGVTSILSGFLGMKIAT  166



>ref|XP_010033979.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Eucalyptus grandis]
 gb|KCW53849.1| hypothetical protein EUGRSUZ_J03081 [Eucalyptus grandis]
Length=769

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 138/166 (83%), Gaps = 6/166 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN------GFAESLI  288
            +L  L TEI IP CA+VGI F+LVQW+LVS+VKL+PE  A  S +        G+ E LI
Sbjct  3    LLSPLATEIAIPACALVGIVFSLVQWLLVSRVKLTPEPRAPSSSSPGSNNNKNGYGEYLI  62

Query  289  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
            EEE+G+NDH+VV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVE FST
Sbjct  63   EEEDGVNDHSVVAKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAVLIFLFLGSVESFST  122

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             SQPCTYD +KLCKPALATAVFST+SFLLG  TSVVSG LGMKIAT
Sbjct  123  QSQPCTYDPSKLCKPALATAVFSTVSFLLGGFTSVVSGFLGMKIAT  168



>dbj|BAJ91598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  276
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS +  K+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAAGGKDGAT  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            E LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFLGS+E
Sbjct  61   EYLIEEEEGLNDHNVVLKCAEIQTAISEGATSFLFTEYKYAGGFMTIFAVLIFVFLGSIE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  GFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIAT  170



>ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  291
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SG LGMKIAT
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIAT  166



>ref|XP_006648065.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=762

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL D+ TE+LIP+ A+VGIAF++ QW+LV++VKL+P    + S  K+ + +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAVVGIAFSIAQWVLVARVKLAPTPPGA-SRGKDSYGDSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST S PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKSHPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL  A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIAT  161



>gb|EMT29715.1| Pyrophosphate-energized vacuolar membrane proton pump [Aegilops 
tauschii]
Length=761

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +A+   +KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAIAQWFIVSKVKVTPGAAAAGG-SKNGYGDYLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y  T  CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  122  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  160



>ref|XP_009336318.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis]
Length=767

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  291
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SG LGMKIAT
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIAT  166



>gb|AAP55210.1| vacuolar proton-inorganic pyrophosphatase [Triticum aestivum]
Length=762

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAAGGGKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y  T  CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=1179

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  291
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG+ + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGYNDYLIE  61

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SG LGMKIAT
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIAT  166



>ref|NP_001105380.1| vacuolar proton pump homolog1 [Zea mays]
 emb|CAG29369.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M A+ ILP+L T++LIPV A VGIAFA+VQ +LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQLVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  292  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  471
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  472  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            SQPC Y + + CKP LA A+FSTI+F+L AVTS+VSG LGMKIAT
Sbjct  121  SQPCHYIKDQTCKPXLANAIFSTIAFVLCAVTSLVSGFLGMKIAT  165



>dbj|BAB18681.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare subsp. 
vulgare]
Length=771

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  276
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS   AK+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAVGAKDGAT  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            E LIEEEEG+NDHNVV KCAEIQ+AISEG TSFLFTEY+Y G FM  FA+LIFVFLGS+E
Sbjct  61   EYLIEEEEGLNDHNVVLKCAEIQTAISEGQTSFLFTEYKYAGGFMTIFAVLIFVFLGSIE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  GFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIAT  170



>gb|AHZ97880.1| vacuolar H+-pyrophosphatase [Olimarabidopsis pumila]
Length=770

 Score =   232 bits (592),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  279
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVATALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEE +ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEECVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST ++ CTYD T+ CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  FSTENKACTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  169



>sp|Q06572.2|AVP_HORVU RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase [Hordeum vulgare]
 dbj|BAA02717.2| inorganic pyrophosphatase [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y +   CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>gb|ACA63883.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare]
Length=762

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y +   CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>dbj|BAJ88084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y +   CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>dbj|BAK04633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=718

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y +   CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>ref|XP_004954254.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL D  TE+L+P+ A+VGIAFA+ QW+LVS+VKLSP       D K+   +SLIEEEEG+
Sbjct  3    ILSDAATEVLVPLAAVVGIAFAVAQWVLVSRVKLSPSARGGARD-KDVLGDSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV +CAEIQ+AI++GATSFLFTEY+YVGIFM  FA++IFVFLGSVEGFST + PCT
Sbjct  62   NDHNVVVRCAEIQNAIAQGATSFLFTEYRYVGIFMSIFAVVIFVFLGSVEGFSTRTHPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + + CKPAL  A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  YSKGRECKPALFNALFSTVSFLLGAITSVVSGFLGMKIAT  161



>dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa Japonica Group]
 gb|EEE56454.1| hypothetical protein OsJ_05651 [Oryza sativa Japonica Group]
Length=770

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  279
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  169



>dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
Length=770

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  279
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  169



>ref|NP_001058184.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAD37431.1| inorganic diphosphatase, H+-translocating, vacuolar membrane 
[Oryza sativa Japonica Group]
 dbj|BAF20098.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAG94303.1| unnamed protein product [Oryza sativa Japonica Group]
Length=782

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +1

Query  97   AEATAMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD------  258
            A  + +  + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +        
Sbjct  5    ARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAG  64

Query  259  -AKNGFAESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF  435
                  +E LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF
Sbjct  65   KDGGAASEYLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIF  124

Query  436  VFLGSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            +FLGSVEGFST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  125  LFLGSVEGFSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  181



>dbj|BAA08232.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
Length=771

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 7/169 (4%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  279
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  170



>dbj|BAA31523.1| ovp1 [Oryza sativa]
Length=771

 Score =   229 bits (585),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 7/169 (4%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  279
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  170



>gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indica Group]
Length=784

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 7/169 (4%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  279
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  170



>emb|CDX83972.1| BnaC08g16730D [Brassica napus]
Length=769

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 141/168 (84%), Gaps = 3/168 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA---ES  282
            M AS  LP+L TEIL+PVCA+VGIAF+L QW +VS+V++S ++ AS S +        + 
Sbjct  1    MVASAFLPELWTEILVPVCAVVGIAFSLFQWFIVSRVRVSSDQGASSSSSGGSKNGYGDY  60

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SG LGMKIAT
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIAT  168



>ref|XP_006416887.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
 gb|ESQ35240.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
Length=771

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 142/170 (84%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG-----FA  276
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++ AS S   +      + 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+N+ +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGLNEQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFVFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST ++PCTYD+TK CKPALATA FST++F+LGAVTSV+SG LGMKIAT
Sbjct  121  GFSTKNKPCTYDDTKTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIAT  170



>gb|AAR08913.2| pyrophosphate-energized vacuolar membrane proton pump [Eutrema 
salsugineum]
Length=771

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 142/170 (84%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG-----FA  276
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++ AS S   +      + 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            + LIEEEEG+N+ +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGLNEQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFVFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GFST ++PCTYD+TK CKPALATA FST++F+LGAVTSV+SG LGMKIAT
Sbjct  121  GFSTKNKPCTYDDTKTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIAT  170



>gb|EEE66103.1| hypothetical protein OsJ_22136 [Oryza sativa Japonica Group]
Length=771

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 135/169 (80%), Gaps = 7/169 (4%)
 Frame = +1

Query  121  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  279
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+N  NVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNGQNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSG LGMKIAT
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIAT  170



>ref|XP_002454723.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
 gb|EES07699.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
Length=759

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 130/160 (81%), Gaps = 4/160 (3%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL ++ TE+LIP+ A VGIAFA+ QW+LVS+VKL+P  S  D D     AESLIEEEEG+
Sbjct  3    ILSEVATEVLIPLAAAVGIAFAVAQWVLVSRVKLAPS-SGRDKDV---LAESLIEEEEGL  58

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV +CAEIQ AI+EGATSFLFTEY+YVG FM  FA +IFVFLGSV+GFST S+PC 
Sbjct  59   NDHNVVVRCAEIQCAIAEGATSFLFTEYRYVGAFMCVFAAVIFVFLGSVDGFSTQSRPCA  118

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y E K CKPAL  AVFST++FLLGA TSVVSG LGMK+AT
Sbjct  119  YSEGKQCKPALFNAVFSTVAFLLGAATSVVSGFLGMKVAT  158



>gb|EMS65629.1| Pyrophosphate-energized vacuolar membrane proton pump [Triticum 
urartu]
Length=762

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAGGGGKNGYGDYLIEEEEGL  62

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  122

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y  T  CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIAT  161



>gb|AAP06752.1| vacuolar proton-inorganic pyrophosphatase [Hordeum brevisubulatum]
Length=773

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 133/169 (79%), Gaps = 6/169 (4%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA------E  279
            A+ ILP+L T++++PV A VGIAFA++QW LVSKVK++PE+    S +           E
Sbjct  4    AAAILPELATQLVVPVAAAVGIAFAVLQWFLVSKVKVAPERRGEGSGSAGAGGGKDGASE  63

Query  280  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  459
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFLGS+EG
Sbjct  64   YLIEEEEGLNDHNVVLKCAEIQTAISEGATSFLFTEYKYAGGFMTVFAVLIFVFLGSIEG  123

Query  460  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            FST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  124  FSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIAT  172



>ref|XP_004964695.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  L TE+ IP+  I+GIAFA+VQW++VS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSPLATEVFIPIAGIIGIAFAVVQWVIVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  122  YSKGKYCKPALFTALFSTASFLLGAITSLVSGFLGMKIAT  161



>gb|ABX10014.1| vacuolar H+-pyrophosphatase [Triticum aestivum]
Length=775

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 135/174 (78%), Gaps = 9/174 (5%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGF------  273
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE       A  G       
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRGEGGSAAGGGAGAGAK  60

Query  274  ---AESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFL  444
               +E LIEEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFL
Sbjct  61   DGASEYLIEEEEGLNDHNIVLKCAEIQTAISEGATSFLFTEYKYAGGFMTVFAVLIFVFL  120

Query  445  GSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            GS+EGFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  GSIEGFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIAT  174



>ref|NP_001048422.1| Os02g0802500 [Oryza sativa Japonica Group]
 dbj|BAD02276.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAD36028.1| proton translocating pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAD36736.1| proton translocating pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF10336.1| Os02g0802500 [Oryza sativa Japonica Group]
 gb|EAY87900.1| hypothetical protein OsI_09320 [Oryza sativa Indica Group]
Length=762

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL  A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIAT  161



>gb|EAZ24976.1| hypothetical protein OsJ_08754 [Oryza sativa Japonica Group]
Length=751

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL  A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIAT  161



>emb|CAF18416.1| proton translocating pyrophosphatase [Oryza sativa]
Length=762

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL  A+FST+SFLLGA+TSVVSG LGMKIAT
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIAT  161



>gb|AGT16998.1| diphosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 140/167 (84%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  285
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A    A    E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGAGGASEYL  63

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVESFS  123

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  170



>gb|AGT15917.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
 gb|AGT16391.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 139/167 (83%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  285
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A         E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESFS  123

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  170



>dbj|BAF63470.1| vacuolar proton-pyrophosphatase [Potamogeton distinctus]
Length=767

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 130/157 (83%), Gaps = 4/157 (3%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKL---SPEKSASDSDAKNGFAESLIEEEEGINDH  315
            +E+LIP+ A++GIAF+L QW LVS+VK+    P + A  S+ KNG  + L+EEEE I+D 
Sbjct  11   SEVLIPLAAVIGIAFSLAQWYLVSRVKVIGADPVQRAR-SERKNGLGDYLVEEEEAIDDQ  69

Query  316  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  495
            +V+ KCA+IQ AISEGATSFLFTEY+YVG+FM AFA+LIF+FLGSVEGFST SQPCTY +
Sbjct  70   SVIDKCADIQKAISEGATSFLFTEYKYVGMFMTAFAVLIFLFLGSVEGFSTKSQPCTYTK  129

Query  496  TKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
              +CKPALA A+FST+SFLLGA+TSVV+G  GMKIAT
Sbjct  130  DTMCKPALANALFSTVSFLLGAITSVVAGFFGMKIAT  166



>gb|AGT16227.1| vacuolar proton pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 139/167 (83%), Gaps = 4/167 (2%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  285
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A         E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  286  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  465
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESFS  123

Query  466  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            T SQPC Y + K+CKPALA A+FSTI+F+LGA+TS+VSG LGMKIAT
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAITSLVSGFLGMKIAT  170



>ref|XP_006841407.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
 gb|ERN03082.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
Length=764

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  291
            M +S +L +   ++LIPV AI+GI FAL+QW LVS+V++SPE     S A NG+ + LIE
Sbjct  1    MASSALLGETLAQVLIPVAAIIGIVFALLQWYLVSQVRVSPEHR---SGANNGYDDRLIE  57

Query  292  -EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  468
             EEEG +   V+ KCAEIQ AISEGATSFL+TEY+Y+GIFM AFAI+IF+FLGSV+GFST
Sbjct  58   DEEEGADSVGVITKCAEIQQAISEGATSFLYTEYKYLGIFMGAFAIIIFLFLGSVKGFST  117

Query  469  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             S+PC+Y++ KLCKPALA AVF+T++FLLGAVTSV+SG LGMKIAT
Sbjct  118  QSEPCSYNKEKLCKPALANAVFTTVAFLLGAVTSVLSGFLGMKIAT  163



>ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=801

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 135/198 (68%), Gaps = 38/198 (19%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---------------------EKS  243
            IL +LGTE+ +PV A VGIAFA+VQW+LV++VKLS                      E+ 
Sbjct  3    ILSELGTEVFVPVAAAVGIAFAVVQWVLVARVKLSEDAAGASGGGKNGGYGDYLIEEEEG  62

Query  244  ASDSDA-----------------KNGFAESLIEEEEGINDHNVVQKCAEIQSAISEGATS  372
             +D +                    G+ + LIEEEEG+NDHNVV KC EIQSAISEGATS
Sbjct  63   LNDHNVVVKCREIQSAISEGERRTGGYGDYLIEEEEGLNDHNVVVKCREIQSAISEGATS  122

Query  373  FLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFL  552
            FLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCTY + K CKPAL  A+FST SFL
Sbjct  123  FLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCTYSKDKYCKPALFNALFSTASFL  182

Query  553  LGAVTSVVSGXLGMKIAT  606
            LGA+TS+VSG LGMKIAT
Sbjct  183  LGAITSLVSGFLGMKIAT  200



>ref|NP_001146732.1| uncharacterized protein LOC100280334 [Zea mays]
 gb|ACL54639.1| unknown [Zea mays]
 gb|AFW87296.1| hypothetical protein ZEAMMB73_037805 [Zea mays]
Length=771

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-----  276
            M +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKLSPE    D  A    A     
Sbjct  1    MASSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSAGKSGAGAGAS  60

Query  277  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  456
            E LIEEEEG+N+HNVV K AEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE
Sbjct  61   EYLIEEEEGLNEHNVVVKYAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVE  120

Query  457  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
             FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  121  SFSTKSQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  170



>ref|XP_003563306.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Brachypodium distachyon]
Length=773

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-----------ASDSDAKNGF  273
            +L +L T++++PV A+VGIAFA++QW+LVSKVK++PE+             +  +     
Sbjct  2    VLSELATQLVVPVAAVVGIAFAVLQWVLVSKVKVTPERRDGEGASSGAAAGAGKNGAAAG  61

Query  274  AESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSV  453
            +E LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIF+FLGS+
Sbjct  62   SEYLIEEEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYAGGFMAIFAVLIFLFLGSI  121

Query  454  EGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            EGFST  Q C Y + K CKPALA A+FSTI+F+LGA+TS+VSG LGMKIAT
Sbjct  122  EGFSTKDQACHYSKGKTCKPALANALFSTIAFVLGAITSLVSGFLGMKIAT  172



>ref|XP_010042849.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Eucalyptus grandis]
Length=320

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 130/161 (81%), Gaps = 6/161 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  303
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S      D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPTSALIGIGFALLQWLLVSKVKVS-----VDYGKKDGYKDKLIEDEEEG  57

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA +IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAAVIFLFLGSVKGFSTQSEPC  117

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIAT  158



>gb|AFW85592.1| vacuolar proton pump-like protein [Zea mays]
Length=762

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  306
            IL  L TE+LIPV A++GIAFA+VQW++VS+VKLSP  S         +A+SLIEEEEG+
Sbjct  3    ILSALATEVLIPVAAVIGIAFAVVQWVVVSRVKLSPAASGGSGGKAG-YADSLIEEEEGL  61

Query  307  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  486
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMAIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  487  YDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            Y + K CKPAL TA+FST+SFLLGA+TS+VSG LGMKIAT
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIAT  161



>ref|XP_002437341.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
 gb|EER88708.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
Length=772

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 136/168 (81%), Gaps = 5/168 (3%)
 Frame = +1

Query  118  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-----ES  282
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE       +          E 
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPPRRGDGSAGKSGGAGASEF  63

Query  283  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  462
            LIEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE F
Sbjct  64   LIEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESF  123

Query  463  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            ST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSG LGMKIAT
Sbjct  124  STKSQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIAT  171



>ref|NP_001056966.1| Os06g0178900 [Oryza sativa Japonica Group]
 dbj|BAA08233.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
 dbj|BAA31524.1| ovp2 [Oryza sativa]
 dbj|BAC22237.1| putative inorganic pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF18880.1| Os06g0178900 [Oryza sativa Japonica Group]
 gb|EAY99896.1| hypothetical protein OsI_21891 [Oryza sativa Indica Group]
 gb|EAZ36023.1| hypothetical protein OsJ_20329 [Oryza sativa Japonica Group]
 dbj|BAG90185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 4/164 (2%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESLIEE  294
            IL  LGTE+ IPV A VG+AFA+ QW+LV++VK++P  +A    S      G+ + LIEE
Sbjct  3    ILSALGTEVFIPVAAAVGVAFAVAQWLLVARVKVNPAHAAAAAASGGSKNGGYGDYLIEE  62

Query  295  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  474
            EEG+NDHNVV KC EIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST S
Sbjct  63   EEGLNDHNVVVKCHEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKS  122

Query  475  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            QPCTY + K CKPAL  A+FST SFLLGA+TS+VSG LGMKIAT
Sbjct  123  QPCTYSKDKYCKPALFNALFSTASFLLGAITSLVSGYLGMKIAT  166



>ref|XP_010039554.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Eucalyptus grandis]
 gb|KCW45903.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
 gb|KCW45904.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=759

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 132/161 (82%), Gaps = 6/161 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  303
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEEEG  57

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA++IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAVVIFLFLGSVKGFSTQSEPC  117

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIAT  158



>gb|KCW45902.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=776

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 132/161 (82%), Gaps = 6/161 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  303
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEEEG  57

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA++IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAVVIFLFLGSVKGFSTQSEPC  117

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIAT  158



>gb|ABR16052.1| unknown [Picea sitchensis]
Length=764

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 127/156 (81%), Gaps = 4/156 (3%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEE--EEGINDHN  318
            +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++E  EEG +  N
Sbjct  11   SEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLDEADEEGTDVRN  68

Query  319  VVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDET  498
             V KCAEIQ+AIS GATSFLFT+Y+Y+GIF V F +LIF+FLGSVEGFST  QPC YD  
Sbjct  69   AVPKCAEIQNAISLGATSFLFTQYKYLGIFTVCFGLLIFLFLGSVEGFSTNQQPCNYDTA  128

Query  499  KLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            K+CKPALA A+FSTI+F+LGA TSV+SG LGMKIAT
Sbjct  129  KMCKPALANALFSTIAFVLGAFTSVLSGYLGMKIAT  164



>gb|ACN40474.1| unknown [Picea sitchensis]
Length=764

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 127/156 (81%), Gaps = 4/156 (3%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEE--EEGINDHN  318
            +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++E  EEG +  N
Sbjct  11   SEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLDEADEEGTDVRN  68

Query  319  VVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDET  498
             V KCAEIQ+AIS GATSFLFT+Y+Y+GIF V F +LIF+FLGSVEGFST  QPC YD  
Sbjct  69   AVPKCAEIQNAISLGATSFLFTQYKYLGIFTVCFGLLIFLFLGSVEGFSTNQQPCNYDTA  128

Query  499  KLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            K+CKPALA A+FSTI+F+LGA TSV+SG LGMKIAT
Sbjct  129  KMCKPALANALFSTIAFVLGAFTSVLSGYLGMKIAT  164



>ref|XP_010259323.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=761

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 125/155 (81%), Gaps = 4/155 (3%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  321
            T+ILIPV AIVGI FAL+QW+LVS+V++S +    DS   NG ++ LIEEEE  ++ H V
Sbjct  9    TQILIPVAAIVGIGFALLQWLLVSRVRVSADP---DSGLDNGCSDRLIEEEEESVDIHGV  65

Query  322  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  501
              KCAEIQ+AIS GATSFLFTEY+Y+ IFM  F  +IF+FLGSV+GFS  S+PCTY++  
Sbjct  66   AAKCAEIQNAISVGATSFLFTEYKYLSIFMTVFGAIIFLFLGSVKGFSIKSEPCTYNKEN  125

Query  502  LCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            LCKPALA A+FST++FLLGA+TSV+SG LGMKIAT
Sbjct  126  LCKPALANAIFSTVAFLLGALTSVLSGFLGMKIAT  160



>ref|XP_007031139.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11641.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
Length=543

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 9/157 (6%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE---EEEGINDH  315
            T+ILIPV A+VGI FAL QW LVS+VK+S       +D+ N + E LIE   EEEGI++ 
Sbjct  9    TQILIPVAALVGIGFALFQWFLVSRVKVSS------NDSSNEYKEKLIEADEEEEGIDNL  62

Query  316  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  495
             V  KCAEIQ AIS GATSFLFTEY+Y+GIFM  F  +IF+FLGSV GFST S+PCTY++
Sbjct  63   EVSIKCAEIQHAISVGATSFLFTEYKYLGIFMGVFGAIIFLFLGSVRGFSTKSEPCTYNQ  122

Query  496  TKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
               CKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  123  GNTCKPALANALFSTIAFLLGALTSVLSGFLGMKIAT  159



>ref|XP_011023767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Populus euphratica]
Length=757

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 8/155 (5%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  321
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE GI+   V
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSSKLIEEEEDGIDSLEV  61

Query  322  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  501
              KCAEIQ+AIS GATSFLFT+Y+Y+G+FM  FA +IF FLGSV+GFST S+PCTY + K
Sbjct  62   SIKCAEIQNAISVGATSFLFTQYKYLGVFMGVFAAIIFFFLGSVKGFSTKSEPCTYSQGK  121

Query  502  LCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            LCKPALA A FST++FLLGA+TSV+SG LGMKIAT
Sbjct  122  LCKPALANAAFSTLAFLLGALTSVLSGFLGMKIAT  156



>gb|KJB26321.1| hypothetical protein B456_004G237000 [Gossypium raimondii]
Length=699

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 9/157 (6%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE---EEEGINDH  315
            T+I+IP+ ++VGI FAL+QW LVS+VKLS +      D+ NG+ + LIE   EEEGIN+ 
Sbjct  9    TQIVIPLASLVGIGFALLQWFLVSRVKLSSQ------DSSNGYKQKLIESDEEEEGINNL  62

Query  316  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  495
             +  KC EIQ AIS GATSFLFTEY+Y+GIFM  F  +IF+FLGSV+GFST S+PCTY +
Sbjct  63   EISIKCTEIQHAISVGATSFLFTEYKYLGIFMCVFGAIIFLFLGSVKGFSTKSEPCTYSQ  122

Query  496  TKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
               CKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  123  GNTCKPALANAIFSTIAFLLGALTSVLSGYLGMKIAT  159



>emb|CBI39586.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 131/161 (81%), Gaps = 6/161 (4%)
 Frame = +1

Query  127  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-G  303
            ++ D  T++LIPV A+VGI FAL+QW+LVSKVK+S     +DSD  NG+++ LIEEEE G
Sbjct  3    VMGDTFTQLLIPVAALVGIGFALLQWLLVSKVKVS-----ADSDLNNGYSDRLIEEEEEG  57

Query  304  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  483
            I+  +V  KCAEIQ+AIS GATSFLFTEY+Y+ IFM  F  +IF+FLGSV+GFST S+PC
Sbjct  58   IDHEDVAAKCAEIQNAISVGATSFLFTEYRYLSIFMGVFGAIIFLFLGSVKGFSTKSEPC  117

Query  484  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  118  TYNTGSLCKPALANALFSTIAFLLGAMTSVLSGFLGMKIAT  158



>gb|KJB26322.1| hypothetical protein B456_004G237000 [Gossypium raimondii]
Length=690

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 9/157 (6%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE---EEEGINDH  315
            T+I+IP+ ++VGI FAL+QW LVS+VKLS +      D+ NG+ + LIE   EEEGIN+ 
Sbjct  9    TQIVIPLASLVGIGFALLQWFLVSRVKLSSQ------DSSNGYKQKLIESDEEEEGINNL  62

Query  316  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  495
             +  KC EIQ AIS GATSFLFTEY+Y+GIFM  F  +IF+FLGSV+GFST S+PCTY +
Sbjct  63   EISIKCTEIQHAISVGATSFLFTEYKYLGIFMCVFGAIIFLFLGSVKGFSTKSEPCTYSQ  122

Query  496  TKLCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
               CKPALA A+FSTI+FLLGA+TSV+SG LGMKIAT
Sbjct  123  GNTCKPALANAIFSTIAFLLGALTSVLSGYLGMKIAT  159



>ref|XP_002318956.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 gb|EEE94879.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=757

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 8/155 (5%)
 Frame = +1

Query  145  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  321
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE GI+   V
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSGKLIEEEEDGIDSLEV  61

Query  322  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  501
              KCAEIQ+AIS GATSFLFT+Y+Y+ +FMV FA +IF FLGSV+GFST S+PCTY + K
Sbjct  62   SIKCAEIQNAISVGATSFLFTQYKYLSVFMVVFAAIIFFFLGSVKGFSTKSEPCTYSQGK  121

Query  502  LCKPALATAVFSTISFLLGAVTSVVSGXLGMKIAT  606
            LCKPALA A FST++FLLGA+TSV+SG LGMKIAT
Sbjct  122  LCKPALANAAFSTLAFLLGALTSVLSGFLGMKIAT  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800