BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS102D06

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761335.1|  PREDICTED: auxin efflux carrier component 3-...    334   1e-107   Nicotiana sylvestris
ref|XP_009601533.1|  PREDICTED: auxin efflux carrier component 3-...    334   1e-107   Nicotiana tomentosiformis
ref|XP_009601532.1|  PREDICTED: auxin efflux carrier component 3-...    334   1e-107   Nicotiana tomentosiformis
gb|AGG79243.1|  auxin efflux facilitator PIN3b                          333   1e-107   Nicotiana tabacum [American tobacco]
ref|XP_009761336.1|  PREDICTED: auxin efflux carrier component 3-...    333   1e-107   Nicotiana sylvestris
gb|AGG79240.1|  auxin efflux facilitator PIN3                           330   5e-106   Nicotiana tabacum [American tobacco]
ref|XP_010320545.1|  PREDICTED: auxin efflux facilitator SlPIN4 i...    328   4e-105   Solanum lycopersicum
ref|XP_006360412.1|  PREDICTED: auxin efflux carrier component 3-...    327   4e-105   Solanum tuberosum [potatoes]
ref|XP_006344239.1|  PREDICTED: auxin efflux carrier component 3-...    328   4e-105   Solanum tuberosum [potatoes]
ref|XP_009601548.1|  PREDICTED: auxin efflux carrier component 7-...    328   5e-105   Nicotiana tomentosiformis
ref|NP_001234184.1|  auxin efflux facilitator SlPIN4                    328   5e-105   Solanum lycopersicum
dbj|BAJ09455.1|  auxin efflux carrier                                   328   5e-105   Solanum lycopersicum
ref|XP_010527774.1|  PREDICTED: auxin efflux carrier component 4-...    326   1e-104   Tarenaya hassleriana [spider flower]
ref|NP_001234177.1|  auxin efflux facilitator SlPIN3                    325   1e-104   Solanum lycopersicum
ref|XP_009802789.1|  PREDICTED: auxin efflux carrier component 7-...    326   2e-104   Nicotiana sylvestris
ref|XP_010319114.1|  PREDICTED: auxin efflux facilitator SlPIN3 i...    325   2e-104   
emb|CDP00766.1|  unnamed protein product                                323   6e-103   Coffea canephora [robusta coffee]
ref|XP_010498810.1|  PREDICTED: auxin efflux carrier component 7-...    318   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011075655.1|  PREDICTED: auxin efflux carrier component 7-...    322   1e-102   Sesamum indicum [beniseed]
ref|NP_564189.1|  auxin efflux carrier component 7                      318   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075639.1|  PREDICTED: auxin efflux carrier component 7-...    322   1e-102   Sesamum indicum [beniseed]
gb|EYU30062.1|  hypothetical protein MIMGU_mgv1a002731mg                321   2e-102   Erythranthe guttata [common monkey flower]
gb|AAC00611.1|  unknown protein                                         318   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011070630.1|  PREDICTED: auxin efflux carrier component 7-...    320   4e-102   Sesamum indicum [beniseed]
ref|XP_010427902.1|  PREDICTED: auxin efflux carrier component 3-...    320   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010477592.1|  PREDICTED: auxin efflux carrier component 7 ...    319   5e-102   Camelina sativa [gold-of-pleasure]
gb|AFJ03880.1|  auxin transport protein                                 319   5e-102   Capsella bursa-pastoris
ref|XP_010498809.1|  PREDICTED: auxin efflux carrier component 7-...    319   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010477589.1|  PREDICTED: auxin efflux carrier component 7 ...    319   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010477591.1|  PREDICTED: auxin efflux carrier component 7 ...    318   6e-102   Camelina sativa [gold-of-pleasure]
gb|AEJ76925.1|  auxin transport protein                                 320   7e-102   Capsella bursa-pastoris
ref|XP_010471101.1|  PREDICTED: auxin efflux carrier component 3-...    319   7e-102   
ref|XP_002887338.1|  predicted protein                                  319   7e-102   Arabidopsis lyrata subsp. lyrata
ref|XP_006300840.1|  hypothetical protein CARUB_v10019932mg             320   8e-102   Capsella rubella
ref|XP_006307013.1|  hypothetical protein CARUB_v10008599mg             318   8e-102   Capsella rubella
emb|CDY25767.1|  BnaA07g10150D                                          317   1e-101   Brassica napus [oilseed rape]
ref|NP_001077584.1|  auxin efflux carrier component 7                   318   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68262.1|  BnaC06g43740D                                          317   1e-101   Brassica napus [oilseed rape]
ref|NP_849700.1|  auxin efflux carrier component 7                      318   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96288.1|  BnaA07g28990D                                          317   2e-101   
gb|KDO64681.1|  hypothetical protein CISIN_1g006199mg                   315   2e-101   Citrus sinensis [apfelsine]
ref|XP_010554422.1|  PREDICTED: auxin efflux carrier component 4-...    318   2e-101   Tarenaya hassleriana [spider flower]
emb|CAC67688.1|  efflux carrier, pin3                                   318   3e-101   Brassica juncea [brown mustard]
ref|XP_006398529.1|  hypothetical protein EUTSA_v10000822mg             317   3e-101   Eutrema salsugineum [saltwater cress]
ref|NP_177250.1|  auxin efflux carrier component 3                      318   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552711.1|  PREDICTED: auxin efflux carrier component 3        316   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_002893260.1|  pin-formed 7                                       317   3e-101   
gb|KFK41521.1|  hypothetical protein AALP_AA2G140400                    318   3e-101   Arabis alpina [alpine rockcress]
ref|XP_009103201.1|  PREDICTED: auxin efflux carrier component 7        316   4e-101   Brassica rapa
emb|CAC67457.1|  efflux carrier, pin2                                   317   4e-101   Brassica juncea [brown mustard]
emb|CAC24691.1|  efflux carrier of polar auxin transport                317   5e-101   Brassica juncea [brown mustard]
gb|EYU40829.1|  hypothetical protein MIMGU_mgv1a025638mg                317   5e-101   Erythranthe guttata [common monkey flower]
ref|NP_565261.1|  auxin efflux carrier component 4                      316   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849923.1|  auxin efflux carrier component 4                      316   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415790.1|  PREDICTED: auxin efflux carrier component 3        317   6e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006290757.1|  hypothetical protein CARUB_v10016856mg             316   7e-101   Capsella rubella
ref|XP_010513862.1|  PREDICTED: auxin efflux carrier component 4-...    316   7e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010462853.1|  PREDICTED: auxin efflux carrier component 7-...    319   8e-101   
ref|XP_002876748.1|  pin-formed 4                                       315   1e-100   
ref|XP_006416127.1|  hypothetical protein EUTSA_v10007111mg             315   1e-100   Eutrema salsugineum [saltwater cress]
gb|KDO64677.1|  hypothetical protein CISIN_1g006199mg                   316   2e-100   Citrus sinensis [apfelsine]
gb|KDO64678.1|  hypothetical protein CISIN_1g006199mg                   315   2e-100   Citrus sinensis [apfelsine]
gb|AAM55297.1|  auxin efflux carrier protein                            316   2e-100   Medicago truncatula
gb|KDO64680.1|  hypothetical protein CISIN_1g006199mg                   315   2e-100   Citrus sinensis [apfelsine]
ref|XP_010424909.1|  PREDICTED: auxin efflux carrier component 4        315   2e-100   Camelina sativa [gold-of-pleasure]
emb|CAN66787.1|  hypothetical protein VITISV_013835                     315   2e-100   Vitis vinifera
ref|XP_006390822.1|  hypothetical protein EUTSA_v10018257mg             315   2e-100   Eutrema salsugineum [saltwater cress]
dbj|BAH47611.1|  auxin:hydrogen symporter/transporter                   315   3e-100   Zinnia elegans [garden zinnia]
gb|KDP38049.1|  hypothetical protein JCGZ_04692                         315   3e-100   Jatropha curcas
ref|XP_009105760.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    315   3e-100   Brassica rapa
gb|KDO64676.1|  hypothetical protein CISIN_1g006199mg                   315   3e-100   Citrus sinensis [apfelsine]
gb|KFK44397.1|  hypothetical protein AALP_AA1G252100                    314   4e-100   Arabis alpina [alpine rockcress]
ref|XP_002284302.1|  PREDICTED: auxin efflux carrier component 3        315   4e-100   Vitis vinifera
emb|CDY63826.1|  BnaC02g47640D                                          312   5e-100   Brassica napus [oilseed rape]
gb|EPS59246.1|  hypothetical protein M569_15563                         311   5e-100   Genlisea aurea
ref|XP_006469168.1|  PREDICTED: auxin efflux carrier component 3-...    315   5e-100   Citrus sinensis [apfelsine]
emb|CDY40380.1|  BnaA02g26940D                                          312   6e-100   Brassica napus [oilseed rape]
emb|CDY12491.1|  BnaC07g13310D                                          312   8e-100   Brassica napus [oilseed rape]
ref|XP_002526018.1|  Auxin efflux carrier component, putative           314   8e-100   Ricinus communis
gb|AIF28339.1|  PIN-like protein                                        310   9e-100   Hakea drupacea
gb|AIF28328.1|  PIN-like protein                                        304   1e-99    Aextoxicon punctatum
ref|XP_010101728.1|  Auxin efflux carrier component 3                   314   1e-99    Morus notabilis
ref|XP_009129244.1|  PREDICTED: auxin efflux carrier component 4        312   1e-99    Brassica rapa
gb|KFK33369.1|  hypothetical protein AALP_AA5G004800                    311   3e-99    Arabis alpina [alpine rockcress]
gb|KFK33370.1|  hypothetical protein AALP_AA5G004800                    311   3e-99    Arabis alpina [alpine rockcress]
ref|XP_004161982.1|  PREDICTED: auxin efflux carrier component 3-...    312   5e-99    
gb|KGN51517.1|  hypothetical protein Csa_5G576590                       311   6e-99    Cucumis sativus [cucumbers]
gb|AGJ95053.1|  PIN1a                                                   310   6e-99    Glycine max [soybeans]
gb|AIF28331.1|  PIN-like protein                                        310   1e-98    Trochodendron aralioides
ref|NP_001267499.1|  uncharacterized protein LOC100791394               311   1e-98    Glycine max [soybeans]
ref|XP_007157734.1|  hypothetical protein PHAVU_002G094000g             311   1e-98    Phaseolus vulgaris [French bean]
ref|XP_008467158.1|  PREDICTED: auxin efflux carrier component 4-...    311   1e-98    Cucumis melo [Oriental melon]
ref|XP_007157735.1|  hypothetical protein PHAVU_002G094000g             311   1e-98    Phaseolus vulgaris [French bean]
ref|XP_010672759.1|  PREDICTED: auxin efflux carrier component 3-...    311   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672758.1|  PREDICTED: auxin efflux carrier component 3-...    311   3e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|AIF28299.1|  PIN-like protein                                        301   3e-98    Papaver somniferum
ref|XP_007153407.1|  hypothetical protein PHAVU_003G032500g             310   3e-98    Phaseolus vulgaris [French bean]
ref|NP_001267715.1|  auxin efflux carrier component 3-like              309   5e-98    Cucumis sativus [cucumbers]
gb|KEH40559.1|  auxin efflux carrier family transporter                 306   5e-98    Medicago truncatula
ref|XP_007045127.1|  Auxin efflux carrier family protein isoform 4      306   6e-98    
gb|KHN43027.1|  Auxin efflux carrier component 3                        308   7e-98    Glycine soja [wild soybean]
ref|XP_007045129.1|  Auxin efflux facilitator isoform 6                 305   8e-98    
ref|XP_004498307.1|  PREDICTED: auxin efflux carrier component 3-...    308   8e-98    Cicer arietinum [garbanzo]
gb|KJB15455.1|  hypothetical protein B456_002G179000                    306   9e-98    Gossypium raimondii
dbj|BAO49658.1|  putative auxin efflux carrier protein                  308   9e-98    Vigna angularis [azuki bean]
ref|XP_006583898.1|  PREDICTED: auxin efflux carrier component 3-...    309   9e-98    Glycine max [soybeans]
ref|XP_003529411.1|  PREDICTED: auxin efflux carrier component 3-...    309   1e-97    Glycine max [soybeans]
dbj|BAH23798.1|  putative auxin transport facilitator protein           308   1e-97    Pisum sativum [garden pea]
dbj|BAO49654.1|  putative auxin efflux carrier protein                  309   1e-97    Vigna angularis [azuki bean]
dbj|BAD05032.1|  putative auxin transport protein                       307   2e-97    Pisum sativum [garden pea]
ref|XP_002314810.2|  PIN1-like family protein                           308   2e-97    
ref|XP_006849750.1|  hypothetical protein AMTR_s00024p00250140          308   2e-97    Amborella trichopoda
gb|AIF28356.1|  PIN-like protein                                        301   2e-97    Posidonia australis
gb|KJB15458.1|  hypothetical protein B456_002G179000                    307   2e-97    Gossypium raimondii
ref|NP_001276316.1|  uncharacterized protein LOC100785146               308   2e-97    Glycine max [soybeans]
gb|KJB15460.1|  hypothetical protein B456_002G179000                    306   3e-97    Gossypium raimondii
ref|XP_007045128.1|  Auxin efflux carrier family protein isoform 5      305   3e-97    
ref|XP_011038656.1|  PREDICTED: auxin efflux carrier component 7        307   4e-97    Populus euphratica
gb|KHG04074.1|  Auxin efflux carrier component 3 -like protein          306   4e-97    Gossypium arboreum [tree cotton]
gb|KJB15456.1|  hypothetical protein B456_002G179000                    306   4e-97    Gossypium raimondii
ref|XP_007045126.1|  Auxin efflux facilitator isoform 3                 306   5e-97    
gb|AAM55299.1|  auxin efflux carrier protein                            306   5e-97    Medicago truncatula
ref|XP_002312436.1|  PIN1-like family protein                           307   5e-97    Populus trichocarpa [western balsam poplar]
emb|CDY41467.1|  BnaA08g20690D                                          305   6e-97    Brassica napus [oilseed rape]
gb|AAM54033.1|AF515434_1  PIN1-like auxin transport protein             306   6e-97    Populus tremula x Populus tremuloides
dbj|BAH47610.1|  auxin:hydrogen symporter/transporter                   305   6e-97    Zinnia elegans [garden zinnia]
gb|AIF28330.1|  PIN-like protein                                        303   7e-97    Trochodendron aralioides
gb|KJB15457.1|  hypothetical protein B456_002G179000                    306   7e-97    Gossypium raimondii
gb|KJB15454.1|  hypothetical protein B456_002G179000                    306   7e-97    Gossypium raimondii
gb|KJB15459.1|  hypothetical protein B456_002G179000                    306   9e-97    Gossypium raimondii
ref|XP_011023284.1|  PREDICTED: auxin efflux carrier component 3-...    306   1e-96    Populus euphratica
ref|XP_007045125.1|  Auxin efflux facilitator isoform 2                 306   1e-96    
emb|CDX91695.1|  BnaC08g06140D                                          303   1e-96    
gb|AIF28374.1|  PIN-like protein                                        293   2e-96    Cunninghamia lanceolata [China fir]
gb|AAP59843.1|  PIN1-like protein                                       304   3e-96    Populus tomentosa [Chinese white poplar]
ref|XP_006605368.1|  PREDICTED: uncharacterized protein LOC100802...    305   5e-96    Glycine max [soybeans]
ref|NP_001267527.1|  uncharacterized protein LOC100802247               305   5e-96    Glycine max [soybeans]
ref|XP_010260501.1|  PREDICTED: auxin efflux carrier component 4-...    304   5e-96    Nelumbo nucifera [Indian lotus]
gb|AIF28335.1|  PIN-like protein                                        304   5e-96    Euptelea pleiosperma
ref|XP_007226967.1|  hypothetical protein PRUPE_ppa002528mg             305   6e-96    Prunus persica
ref|XP_009356144.1|  PREDICTED: auxin efflux carrier component 3-...    304   6e-96    Pyrus x bretschneideri [bai li]
ref|XP_008243361.1|  PREDICTED: auxin efflux carrier component 3-...    305   6e-96    Prunus mume [ume]
ref|XP_007045124.1|  Auxin efflux carrier family protein isoform 1      305   1e-95    
ref|XP_009110124.1|  PREDICTED: auxin efflux carrier component 7-...    301   1e-95    Brassica rapa
ref|XP_006605369.1|  PREDICTED: uncharacterized protein LOC100802...    303   2e-95    Glycine max [soybeans]
ref|XP_008389216.1|  PREDICTED: auxin efflux carrier component 3-...    303   2e-95    
ref|XP_008454788.1|  PREDICTED: auxin efflux carrier component 7-...    301   3e-95    Cucumis melo [Oriental melon]
gb|AIF28368.1|  PIN-like protein                                        290   5e-95    Nageia nagi
gb|AIF28388.1|  PIN-like protein                                        299   5e-95    Chamaecyparis hodginsii
ref|XP_010274646.1|  PREDICTED: auxin efflux carrier component 4-...    301   6e-95    Nelumbo nucifera [Indian lotus]
gb|AIF28371.1|  PIN-like protein                                        293   8e-95    Chamaecyparis lawsoniana [Oregon cedar]
gb|AIF28355.1|  PIN-like protein                                        286   1e-94    Talbotia elegans
ref|XP_004505266.1|  PREDICTED: auxin efflux carrier component 3-...    301   1e-94    Cicer arietinum [garbanzo]
gb|AAQ14258.1|AF247005_1  auxin efflux carrier                          300   2e-94    Momordica charantia [balsam pear]
gb|AIF28430.1|  PIN-like protein                                        291   2e-94    Amentotaxus argotaenia
gb|AIF28379.1|  PIN-like protein                                        285   3e-94    Podocarpus coriaceus
gb|AIF28366.1|  PIN-like protein                                        290   4e-94    Prumnopitys andina
gb|AIF28377.1|  PIN-like protein                                        296   5e-94    Amentotaxus argotaenia
gb|AIF28317.1|  PIN-like protein                                        290   5e-94    Nuphar advena
gb|AIF28378.1|  PIN-like protein                                        291   5e-94    Taxus baccata
gb|KJB30812.1|  hypothetical protein B456_005G161800                    289   8e-94    Gossypium raimondii
ref|XP_004140432.1|  PREDICTED: auxin efflux carrier component 7-...    298   1e-93    
gb|KCW86214.1|  hypothetical protein EUGRSUZ_B02902                     298   1e-93    Eucalyptus grandis [rose gum]
ref|XP_009339666.1|  PREDICTED: auxin efflux carrier component 3-...    298   1e-93    
ref|XP_009357924.1|  PREDICTED: auxin efflux carrier component 3 ...    298   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_009357915.1|  PREDICTED: auxin efflux carrier component 3 ...    298   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_008775285.1|  PREDICTED: auxin efflux carrier component 3-...    294   2e-93    
ref|XP_008339560.1|  PREDICTED: auxin efflux carrier component 3 ...    297   2e-93    Malus domestica [apple tree]
gb|AIF28259.1|  PIN-like protein                                        290   2e-93    Elegia tectorum
gb|AIF28386.1|  PIN-like protein                                        298   3e-93    Chamaecyparis lawsoniana [Oregon cedar]
ref|XP_010044176.1|  PREDICTED: auxin efflux carrier component 4-...    297   3e-93    Eucalyptus grandis [rose gum]
gb|AIF28364.1|  PIN-like protein                                        291   4e-93    Keteleeria evelyniana
ref|XP_006490773.1|  PREDICTED: auxin efflux carrier component 1-...    292   5e-93    Citrus sinensis [apfelsine]
dbj|BAJ10462.1|  auxin efflux facilitator                               296   5e-93    Cucumis sativus [cucumbers]
ref|XP_010924933.1|  PREDICTED: probable auxin efflux carrier com...    296   5e-93    Elaeis guineensis
ref|XP_008339561.1|  PREDICTED: auxin efflux carrier component 3 ...    295   6e-93    Malus domestica [apple tree]
gb|AIF28248.1|  PIN-like protein                                        288   6e-93    Trochodendron aralioides
ref|XP_004297366.1|  PREDICTED: auxin efflux carrier component 3-...    296   7e-93    Fragaria vesca subsp. vesca
gb|AIF28425.1|  PIN-like protein                                        291   7e-93    Manoao colensoi [manoao]
dbj|BAK02872.1|  predicted protein                                      297   7e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009357931.1|  PREDICTED: auxin efflux carrier component 3 ...    294   8e-93    
ref|XP_008345946.1|  PREDICTED: auxin efflux carrier component 1-...    283   1e-92    
ref|XP_011075451.1|  PREDICTED: probable auxin efflux carrier com...    293   1e-92    Sesamum indicum [beniseed]
dbj|BAO49652.1|  putative auxin efflux carrier protein                  294   1e-92    Vigna angularis [azuki bean]
gb|KJB53043.1|  hypothetical protein B456_008G290000                    292   1e-92    Gossypium raimondii
emb|CDP06197.1|  unnamed protein product                                294   1e-92    Coffea canephora [robusta coffee]
gb|AIF28385.1|  PIN-like protein                                        295   2e-92    Sciadopitys verticillata [umbrella-pine]
gb|AIF28304.1|  PIN-like protein                                        294   2e-92    Platanus occidentalis [American sycamore]
ref|XP_011075450.1|  PREDICTED: probable auxin efflux carrier com...    294   2e-92    Sesamum indicum [beniseed]
ref|XP_002282220.1|  PREDICTED: probable auxin efflux carrier com...    294   2e-92    Vitis vinifera
gb|AIF28390.1|  PIN-like protein                                        296   2e-92    Thuja plicata [giant arborvitae]
ref|XP_007036847.1|  Auxin efflux facilitator isoform 2                 290   2e-92    
ref|XP_007028296.1|  Auxin efflux carrier family protein isoform 2      293   3e-92    
gb|KJB46196.1|  hypothetical protein B456_007G352200                    293   3e-92    Gossypium raimondii
ref|XP_007028297.1|  Auxin efflux carrier family protein isoform 3      293   3e-92    
gb|AIF28391.1|  PIN-like protein                                        295   3e-92    Thujopsis dolabrata [hiba arborvitae]
gb|KJB46194.1|  hypothetical protein B456_007G352200                    293   3e-92    Gossypium raimondii
gb|AIF28389.1|  PIN-like protein                                        291   3e-92    Papuacedrus papuana
gb|AIF28395.1|  PIN-like protein                                        293   4e-92    Taxus baccata
ref|XP_010271843.1|  PREDICTED: probable auxin efflux carrier com...    293   5e-92    Nelumbo nucifera [Indian lotus]
gb|AIF28415.1|  PIN-like protein                                        281   5e-92    Juniperus scopulorum
ref|NP_001275530.1|  auxin efflux carrier component 1-like              293   5e-92    Cucumis sativus [cucumbers]
ref|NP_001234204.1|  auxin efflux facilitator SlPIN7                    292   5e-92    Solanum lycopersicum
ref|XP_009803280.1|  PREDICTED: auxin efflux carrier component 1-...    292   5e-92    Nicotiana sylvestris
gb|AGG79241.1|  auxin efflux facilitator PIN9                           292   5e-92    Nicotiana tabacum [American tobacco]
ref|XP_006339260.1|  PREDICTED: auxin efflux carrier component 1-...    292   5e-92    Solanum tuberosum [potatoes]
gb|AIF28280.1|  PIN-like protein                                        286   5e-92    Sabal bermudana
gb|AIF28383.1|  PIN-like protein                                        278   6e-92    Manoao colensoi [manoao]
gb|AIF28381.1|  PIN-like protein                                        294   6e-92    Prumnopitys andina
ref|XP_008464398.1|  PREDICTED: probable auxin efflux carrier com...    293   7e-92    Cucumis melo [Oriental melon]
gb|AIF28305.1|  PIN-like protein                                        292   7e-92    Platanus occidentalis [American sycamore]
ref|XP_009602422.1|  PREDICTED: auxin efflux carrier component 1-...    292   7e-92    Nicotiana tomentosiformis
emb|CDO98348.1|  unnamed protein product                                292   8e-92    Coffea canephora [robusta coffee]
ref|XP_011084207.1|  PREDICTED: probable auxin efflux carrier com...    292   8e-92    Sesamum indicum [beniseed]
gb|KJB53042.1|  hypothetical protein B456_008G290000                    292   8e-92    Gossypium raimondii
ref|XP_008775284.1|  PREDICTED: probable auxin efflux carrier com...    293   8e-92    Phoenix dactylifera
gb|AIF28376.1|  PIN-like protein                                        294   9e-92    Thuja plicata [giant arborvitae]
gb|KJB46195.1|  hypothetical protein B456_007G352200                    291   9e-92    Gossypium raimondii
ref|XP_006341527.1|  PREDICTED: auxin efflux carrier component 1-...    292   1e-91    Solanum tuberosum [potatoes]
gb|AAQ14257.1|AF247004_1  auxin efflux carrier                          292   1e-91    Momordica charantia [balsam pear]
gb|KDP28042.1|  hypothetical protein JCGZ_19719                         291   1e-91    Jatropha curcas
ref|XP_006490772.1|  PREDICTED: probable auxin efflux carrier com...    292   1e-91    Citrus sinensis [apfelsine]
gb|AIF28262.1|  PIN-like protein                                        293   1e-91    Lepidosperma gibsonii
gb|AGV28593.1|  auxin efflux carrier 1a                                 291   1e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001234163.1|  auxin efflux facilitator SlPIN1                    292   1e-91    Solanum lycopersicum
dbj|BAH47609.1|  auxin:hydrogen symporter/transporter                   291   1e-91    Zinnia elegans [garden zinnia]
gb|KHN00146.1|  Auxin efflux carrier component 1                        291   1e-91    Glycine soja [wild soybean]
gb|AIF28295.1|  PIN-like protein                                        292   1e-91    Nuphar advena
ref|NP_001267515.1|  uncharacterized protein LOC100786572               291   1e-91    Glycine max [soybeans]
gb|AIF28369.1|  PIN-like protein                                        293   1e-91    Manoao colensoi [manoao]
emb|CAJ84441.1|  auxin efflux carrier                                   291   1e-91    Lupinus albus
ref|XP_006376716.1|  hypothetical protein POPTR_0012s04470g             290   2e-91    
dbj|BAJ97950.1|  predicted protein                                      291   2e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGJ95058.1|  PIN4b                                                   291   2e-91    Glycine max [soybeans]
ref|NP_001057227.1|  Os06g0232300                                       291   2e-91    
ref|XP_009783366.1|  PREDICTED: probable auxin efflux carrier com...    291   2e-91    Nicotiana sylvestris
gb|EYU24143.1|  hypothetical protein MIMGU_mgv1a003175mg                291   2e-91    Erythranthe guttata [common monkey flower]
gb|AIF28257.1|  PIN-like protein                                        289   2e-91    Hakea drupacea
gb|AGG79244.1|  auxin efflux facilitator PIN1b                          291   2e-91    Nicotiana tabacum [American tobacco]
gb|AIF28382.1|  PIN-like protein                                        290   2e-91    Dacrycarpus compactus
gb|AIF28417.1|  PIN-like protein                                        282   2e-91    Torreya taxifolia [Florida torreya]
ref|XP_009391391.1|  PREDICTED: probable auxin efflux carrier com...    292   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU18610.1|  hypothetical protein MIMGU_mgv1a003446mg                290   3e-91    Erythranthe guttata [common monkey flower]
gb|AIF28418.1|  PIN-like protein                                        284   3e-91    Amentotaxus argotaenia
dbj|BAH47608.1|  auxin:hydrogen symporter/transporter                   290   3e-91    Zinnia elegans [garden zinnia]
ref|XP_009609779.1|  PREDICTED: probable auxin efflux carrier com...    290   3e-91    Nicotiana tomentosiformis
gb|AIF28308.1|  PIN-like protein                                        281   3e-91    Maranta leuconeura
gb|AIF28411.1|  PIN-like protein                                        280   3e-91    Torreya taxifolia [Florida torreya]
ref|XP_007036846.1|  Auxin efflux facilitator isoform 1                 291   3e-91    
ref|XP_008646250.1|  PREDICTED: auxin efflux carrier component 1        290   4e-91    Zea mays [maize]
gb|AGJ95052.1|  PIN4a                                                   291   4e-91    Glycine max [soybeans]
ref|XP_006376717.1|  hypothetical protein POPTR_0012s04470g             290   4e-91    
ref|XP_006362273.1|  PREDICTED: auxin efflux carrier component 1-...    290   4e-91    Solanum tuberosum [potatoes]
ref|XP_003570666.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    290   4e-91    
gb|AGV28594.1|  auxin efflux carrier 1b                                 290   5e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_009614860.1|  PREDICTED: probable auxin efflux carrier com...    290   5e-91    Nicotiana tomentosiformis
ref|NP_001234220.1|  auxin efflux facilitator SlPIN9                    290   5e-91    Solanum lycopersicum
gb|ACH91613.2|  PIN-like auxin efflux carrier                           293   5e-91    Picea abies
ref|NP_001048095.1|  Os02g0743400                                       290   5e-91    
ref|XP_004512743.1|  PREDICTED: auxin efflux carrier component 1-...    290   6e-91    Cicer arietinum [garbanzo]
gb|AAQ14256.1|AF246995_1  AEC1                                          290   6e-91    Momordica charantia [balsam pear]
ref|XP_002317874.1|  auxin efflux carrier component 1 family protein    290   6e-91    Populus trichocarpa [western balsam poplar]
gb|AIF28349.1|  PIN-like protein                                        290   8e-91    Sabal bermudana
gb|AIU94749.1|  auxin efflux carrier                                    290   8e-91    Morus alba var. multicaulis
ref|XP_009414067.1|  PREDICTED: probable auxin efflux carrier com...    290   9e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953879.1|  PREDICTED: auxin efflux carrier component 1-...    291   9e-91    
gb|EPS70360.1|  auxin efflux carrier                                    289   9e-91    Genlisea aurea
ref|XP_003564038.1|  PREDICTED: probable auxin efflux carrier com...    289   9e-91    Brachypodium distachyon [annual false brome]
ref|XP_007028295.1|  Auxin efflux carrier family protein isoform 1      291   1e-90    
gb|AIF28414.1|  PIN-like protein                                        281   1e-90    Chamaecyparis lawsoniana [Oregon cedar]
gb|AIF28278.1|  PIN-like protein                                        289   1e-90    Heliconia sp. SFB-2014
ref|XP_004953880.1|  PREDICTED: auxin efflux carrier component 1-...    289   1e-90    Setaria italica
dbj|BAJ10464.1|  auxin efflux facilitator                               289   1e-90    Cucumis sativus [cucumbers]
gb|AIF28288.1|  PIN-like protein                                        290   1e-90    Talbotia elegans
ref|XP_004144328.1|  PREDICTED: probable auxin efflux carrier com...    289   1e-90    Cucumis sativus [cucumbers]
ref|XP_011039131.1|  PREDICTED: probable auxin efflux carrier com...    289   2e-90    Populus euphratica
gb|KHN32243.1|  Putative auxin efflux carrier component 1b              285   2e-90    Glycine soja [wild soybean]
ref|XP_007152685.1|  hypothetical protein PHAVU_004G150600g             289   2e-90    Phaseolus vulgaris [French bean]
gb|AIF28352.1|  PIN-like protein                                        290   2e-90    Ludovia sp. SFB-2014
gb|AIF28362.1|  PIN-like protein                                        291   2e-90    
ref|XP_006836268.1|  hypothetical protein AMTR_s00101p00149240          289   2e-90    
emb|CBI32787.3|  unnamed protein product                                287   2e-90    
ref|XP_002322614.1|  putative auxin efflux carrier protein 10           288   2e-90    
ref|XP_008362771.1|  PREDICTED: probable auxin efflux carrier com...    288   2e-90    
ref|XP_009785135.1|  PREDICTED: probable auxin efflux carrier com...    288   2e-90    
ref|XP_006482066.1|  PREDICTED: probable auxin efflux carrier com...    288   2e-90    
ref|XP_004503270.1|  PREDICTED: probable auxin efflux carrier com...    286   2e-90    
ref|XP_011009711.1|  PREDICTED: probable auxin efflux carrier com...    289   2e-90    
gb|AIF28261.1|  PIN-like protein                                        289   2e-90    
ref|XP_011000408.1|  PREDICTED: probable auxin efflux carrier com...    288   2e-90    
ref|XP_010036951.1|  PREDICTED: auxin efflux carrier component 1-...    288   3e-90    
gb|KDO53622.1|  hypothetical protein CISIN_1g007826mg                   288   3e-90    
gb|AIF28334.1|  PIN-like protein                                        280   3e-90    
ref|XP_011009713.1|  PREDICTED: probable auxin efflux carrier com...    288   3e-90    
ref|XP_007204212.1|  hypothetical protein PRUPE_ppa003159mg             288   3e-90    
ref|XP_008240670.1|  PREDICTED: probable auxin efflux carrier com...    288   3e-90    
ref|XP_011009714.1|  PREDICTED: probable auxin efflux carrier com...    288   3e-90    
gb|AAG17172.1|AF190881_1  PIN1-like auxin transport protein             288   3e-90    
ref|XP_008387342.1|  PREDICTED: probable auxin efflux carrier com...    288   4e-90    
ref|XP_008455726.1|  PREDICTED: probable auxin efflux carrier com...    288   4e-90    
gb|AIF28380.1|  PIN-like protein                                        289   4e-90    
ref|XP_002282693.1|  PREDICTED: probable auxin efflux carrier com...    288   5e-90    
ref|XP_006655945.1|  PREDICTED: probable auxin efflux carrier com...    287   5e-90    
emb|CBI32786.3|  unnamed protein product                                286   5e-90    
ref|XP_002322104.1|  auxin efflux carrier component 1 family protein    288   5e-90    
ref|XP_010246171.1|  PREDICTED: probable auxin efflux carrier com...    287   6e-90    
ref|XP_004965061.1|  PREDICTED: probable auxin efflux carrier com...    288   6e-90    
ref|XP_010246173.1|  PREDICTED: probable auxin efflux carrier com...    287   7e-90    
ref|XP_010097558.1|  Auxin efflux carrier component 1                   288   7e-90    
ref|XP_009371249.1|  PREDICTED: probable auxin efflux carrier com...    287   7e-90    
ref|XP_010932635.1|  PREDICTED: probable auxin efflux carrier com...    289   8e-90    
ref|XP_009360078.1|  PREDICTED: probable auxin efflux carrier com...    288   8e-90    
ref|XP_010932634.1|  PREDICTED: probable auxin efflux carrier com...    289   8e-90    
ref|XP_011072996.1|  PREDICTED: auxin efflux carrier component 1-...    286   8e-90    
ref|XP_002307966.1|  putative auxin efflux carrier protein 10           286   8e-90    
gb|AIF28260.1|  PIN-like protein                                        288   9e-90    
gb|AAD04377.1|  putative auxin efflux carrier protein                   281   9e-90    
ref|XP_002436761.1|  hypothetical protein SORBIDRAFT_10g008290          287   1e-89    
ref|XP_009411771.1|  PREDICTED: probable auxin efflux carrier com...    286   1e-89    
ref|XP_004965062.1|  PREDICTED: probable auxin efflux carrier com...    286   1e-89    
ref|XP_007210282.1|  hypothetical protein PRUPE_ppa002944mg             287   1e-89    
gb|ACH91863.1|  PIN-FORMED1                                             287   1e-89    
ref|XP_010673043.1|  PREDICTED: probable auxin efflux carrier com...    286   1e-89    
ref|XP_002282650.1|  PREDICTED: probable auxin efflux carrier com...    286   1e-89    
ref|XP_010678065.1|  PREDICTED: probable auxin efflux carrier com...    287   2e-89    
ref|XP_003619829.1|  Auxin efflux carrier protein                       286   2e-89    
gb|AIF28252.1|  PIN-like protein                                        286   2e-89    
gb|AIF28423.1|  PIN-like protein                                        288   2e-89    
gb|AIF28354.1|  PIN-like protein                                        286   2e-89    
ref|XP_010246119.1|  PREDICTED: auxin efflux carrier component 2-...    287   2e-89    
gb|AIF28258.1|  PIN-like protein                                        286   2e-89    
ref|XP_009356039.1|  PREDICTED: probable auxin efflux carrier com...    286   2e-89    
ref|XP_002517316.1|  Auxin efflux carrier component, putative           286   2e-89    
gb|AIN44211.1|  PIN1                                                    286   2e-89    
gb|AGY29597.1|  auxin efflux carrier                                    286   2e-89    
ref|XP_009341965.1|  PREDICTED: probable auxin efflux carrier com...    286   3e-89    
ref|XP_009411770.1|  PREDICTED: probable auxin efflux carrier com...    285   3e-89    
ref|XP_010274725.1|  PREDICTED: probable auxin efflux carrier com...    286   3e-89    
ref|XP_010909245.1|  PREDICTED: probable auxin efflux carrier com...    286   3e-89    
ref|XP_006826885.1|  hypothetical protein AMTR_s00010p00137670          286   3e-89    
gb|AIF28292.1|  PIN-like protein                                        284   3e-89    
ref|XP_011040757.1|  PREDICTED: probable auxin efflux carrier com...    285   3e-89    
gb|AAM54034.1|AF515435_1  PIN1-like auxin transport protein             285   4e-89    
gb|AIF28290.1|  PIN-like protein                                        276   5e-89    
ref|XP_006845765.1|  hypothetical protein AMTR_s00019p00250330          285   5e-89    
ref|XP_008659083.1|  PREDICTED: probable auxin efflux carrier com...    285   5e-89    
ref|XP_007160541.1|  hypothetical protein PHAVU_002G330300g             285   5e-89    
dbj|BAH23796.1|  putative auxin transport facilitator protein           285   6e-89    
ref|XP_010909244.1|  PREDICTED: probable auxin efflux carrier com...    286   6e-89    
gb|AAO38045.1|  auxin efflux carrier protein PIN1                       285   6e-89    
gb|AIF28375.1|  PIN-like protein                                        283   6e-89    
gb|AIF28351.1|  PIN-like protein                                        281   6e-89    
gb|AIF28310.1|  PIN-like protein                                        281   6e-89    
ref|XP_002527704.1|  Auxin efflux carrier component, putative           286   6e-89    
gb|AGA83304.1|  UML                                                     284   7e-89    
gb|AIF28247.1|  PIN-like protein                                        281   7e-89    
ref|XP_010263760.1|  PREDICTED: probable auxin efflux carrier com...    285   8e-89    
ref|XP_008800898.1|  PREDICTED: auxin efflux carrier component 4        286   8e-89    
gb|KHN08891.1|  Putative auxin efflux carrier component 1c              284   9e-89    
ref|XP_008374845.1|  PREDICTED: probable auxin efflux carrier com...    285   9e-89    
dbj|BAO49655.1|  putative auxin efflux carrier protein                  284   1e-88    
gb|AIF28283.1|  PIN-like protein                                        284   1e-88    
ref|XP_007162070.1|  hypothetical protein PHAVU_001G121100g             283   1e-88    
ref|XP_002887490.1|  pin-formed 1                                       285   1e-88    
gb|KDP23925.1|  hypothetical protein JCGZ_27085                         284   2e-88    
ref|XP_010246122.1|  PREDICTED: auxin efflux carrier component 2-...    285   2e-88    
ref|XP_008393426.1|  PREDICTED: probable auxin efflux carrier com...    284   2e-88    
ref|XP_010471420.1|  PREDICTED: auxin efflux carrier component 1-...    284   2e-88    
ref|XP_010416169.1|  PREDICTED: auxin efflux carrier component 1        284   2e-88    
gb|AIF28282.1|  PIN-like protein                                        284   2e-88    
emb|CDX96484.1|  BnaA07g30950D                                          281   2e-88    
ref|XP_006390539.1|  hypothetical protein EUTSA_v10018278mg             283   3e-88    
gb|KHN30345.1|  Auxin efflux carrier component 1                        283   3e-88    
ref|XP_004299530.1|  PREDICTED: probable auxin efflux carrier com...    283   3e-88    
gb|KJB37163.1|  hypothetical protein B456_006G191800                    282   3e-88    
ref|NP_001267492.1|  uncharacterized protein LOC100820506               283   3e-88    
ref|XP_006300880.1|  hypothetical protein CARUB_v10019970mg             283   3e-88    
ref|NP_177500.1|  auxin efflux carrier component 1                      283   4e-88    
gb|KJB39253.1|  hypothetical protein B456_007G003800                    283   4e-88    
gb|AIF28256.1|  PIN-like protein                                        282   4e-88    
gb|ABN08535.1|  Auxin Efflux Carrier                                    282   4e-88    
ref|XP_010922067.1|  PREDICTED: probable auxin efflux carrier com...    282   5e-88    
ref|XP_008788445.1|  PREDICTED: probable auxin efflux carrier com...    283   6e-88    
gb|KEH23588.1|  auxin efflux carrier family transporter                 282   6e-88    
ref|XP_009763717.1|  PREDICTED: auxin efflux carrier component 2-...    275   6e-88    
ref|XP_010924198.1|  PREDICTED: auxin efflux carrier component 3 ...    282   6e-88    
dbj|BAJ10463.1|  auxin efflux facilitator                               282   6e-88    
ref|XP_004493383.1|  PREDICTED: probable auxin efflux carrier com...    282   7e-88    
gb|AHN96183.1|  PIN-formed protein 1                                    282   7e-88    
gb|AEK01107.1|  auxin transport protein                                 283   7e-88    
gb|AIF28289.1|  PIN-like protein                                        283   7e-88    
gb|AHN96184.1|  PIN-formed protein 1                                    282   8e-88    
gb|KDP46642.1|  hypothetical protein JCGZ_13598                         282   9e-88    
ref|XP_003624952.1|  Auxin efflux carrier component                     281   9e-88    
gb|AIW04421.1|  PIN1-like auxin transport protein PIN1                  282   9e-88    
ref|XP_009106015.1|  PREDICTED: auxin efflux carrier component 1-...    282   1e-87    
ref|XP_004137343.1|  PREDICTED: auxin efflux carrier component 1-...    282   1e-87    
ref|XP_010055808.1|  PREDICTED: probable auxin efflux carrier com...    281   1e-87    
gb|EPS72784.1|  hypothetical protein M569_01970                         280   1e-87    
ref|XP_008453480.1|  PREDICTED: probable auxin efflux carrier com...    281   1e-87    
ref|XP_008788503.1|  PREDICTED: probable auxin efflux carrier com...    281   1e-87    
ref|XP_007014497.1|  Auxin efflux carrier family protein                282   1e-87    
gb|AIF28347.1|  PIN-like protein                                        272   1e-87    
ref|NP_001238349.1|  auxin efflux carrier protein 1                     278   1e-87    
ref|XP_008788502.1|  PREDICTED: probable auxin efflux carrier com...    282   1e-87    
ref|XP_009416747.1|  PREDICTED: probable auxin efflux carrier com...    282   1e-87    
ref|XP_009416741.1|  PREDICTED: probable auxin efflux carrier com...    282   1e-87    
ref|XP_010112842.1|  putative auxin efflux carrier component 1c         281   2e-87    
ref|NP_001237546.1|  auxin efflux carrier protein 2                     277   2e-87    
gb|EYU33972.1|  hypothetical protein MIMGU_mgv1a003655mg                280   2e-87    
ref|XP_010924195.1|  PREDICTED: auxin efflux carrier component 4 ...    282   2e-87    
ref|XP_010924197.1|  PREDICTED: auxin efflux carrier component 4 ...    282   2e-87    
emb|CDX82059.1|  BnaC02g22310D                                          279   2e-87    
dbj|BAH23795.1|  putative auxin transport facilitator protein           280   3e-87    
ref|XP_004160415.1|  PREDICTED: auxin efflux carrier component 1-...    281   3e-87    
gb|AIF28413.1|  PIN-like protein                                        281   3e-87    
ref|XP_006663186.1|  PREDICTED: probable auxin efflux carrier com...    275   3e-87    
gb|AAD04376.1|  putative auxin efflux carrier protein                   281   3e-87    
ref|XP_008812806.1|  PREDICTED: probable auxin efflux carrier com...    280   4e-87    
ref|XP_006663800.1|  PREDICTED: probable auxin efflux carrier com...    279   4e-87    
ref|XP_003631123.1|  Auxin efflux carrier component                     278   4e-87    
gb|AIF28344.1|  PIN-like protein                                        267   6e-87    
ref|XP_009400551.1|  PREDICTED: probable auxin efflux carrier com...    280   8e-87    
ref|XP_002324677.2|  auxin efflux carrier component 2 family protein    280   9e-87    
gb|AIF28285.1|  PIN-like protein                                        280   1e-86    
emb|CDY47745.1|  BnaA02g16500D                                          278   1e-86    
ref|XP_010055815.1|  PREDICTED: probable auxin efflux carrier com...    280   1e-86    
ref|XP_010913714.1|  PREDICTED: probable auxin efflux carrier com...    279   1e-86    
gb|AAS19858.1|  auxin transporter PIN1                                  278   1e-86    
ref|XP_009128000.1|  PREDICTED: auxin efflux carrier component 1        279   1e-86    
gb|AIF28346.1|  PIN-like protein                                        274   2e-86    
dbj|BAO49653.1|  putative auxin efflux carrier protein                  279   2e-86    
gb|AIF28416.1|  PIN-like protein                                        279   2e-86    
ref|XP_008453545.1|  PREDICTED: auxin efflux carrier component 2        279   2e-86    
ref|XP_010931527.1|  PREDICTED: probable auxin efflux carrier com...    277   2e-86    
gb|AIF28291.1|  PIN-like protein                                        280   2e-86    
ref|XP_008679312.1|  PREDICTED: auxin efflux carrier component 1-...    278   2e-86    
gb|AHN96182.1|  PIN-formed protein 1                                    278   2e-86    
dbj|BAO49656.1|  putative auxin efflux carrier protein                  278   2e-86    
gb|AGM20675.1|  PIN                                                     278   2e-86    
ref|XP_009380324.1|  PREDICTED: probable auxin efflux carrier com...    275   3e-86    
ref|XP_011017712.1|  PREDICTED: auxin efflux carrier component 2        279   3e-86    
ref|XP_004167314.1|  PREDICTED: auxin efflux carrier component 2-...    279   3e-86    
emb|CBX25245.1|  hypothetical_protein                                   276   4e-86    
gb|AIF28394.1|  PIN-like protein                                        276   4e-86    
ref|NP_001238365.1|  auxin efflux carrier protein 4                     278   5e-86    
ref|XP_007154690.1|  hypothetical protein PHAVU_003G139600g             278   5e-86    
ref|XP_010537499.1|  PREDICTED: auxin efflux carrier component 1        278   6e-86    
ref|NP_001267673.1|  auxin efflux carrier component 2-like              278   6e-86    
ref|XP_006593364.1|  PREDICTED: auxin efflux carrier protein 3 is...    278   7e-86    
gb|KHN22650.1|  Auxin efflux carrier component 2                        278   7e-86    
ref|XP_010087961.1|  Auxin efflux carrier component 2                   281   8e-86    
gb|KHN17646.1|  Auxin efflux carrier component 2                        277   8e-86    
ref|XP_006600116.1|  PREDICTED: auxin efflux carrier protein 4 is...    277   9e-86    
ref|NP_001043692.1|  Os01g0643300                                       276   9e-86    
dbj|BAH47607.1|  auxin:hydrogen symporter/transporter                   276   1e-85    
ref|NP_001237559.1|  auxin efflux carrier protein 3                     278   1e-85    
gb|KJB53695.1|  hypothetical protein B456_009G001600                    277   1e-85    
ref|XP_009359964.1|  PREDICTED: auxin efflux carrier component 2-...    277   1e-85    
emb|CDM83524.1|  unnamed protein product                                276   1e-85    
ref|XP_008363929.1|  PREDICTED: auxin efflux carrier component 2        278   1e-85    
sp|Q5VP70.1|PIN3A_ORYSJ  RecName: Full=Probable auxin efflux carr...    276   2e-85    
gb|AAN71616.1|  PIN-like protein                                        275   2e-85    
ref|XP_009350116.1|  PREDICTED: auxin efflux carrier component 2-...    277   2e-85    
gb|AGY29598.1|  auxin efflux carrier                                    277   2e-85    
ref|XP_010695799.1|  PREDICTED: auxin efflux carrier component 2        277   2e-85    
ref|XP_009409896.1|  PREDICTED: probable auxin efflux carrier com...    276   2e-85    
ref|XP_009409895.1|  PREDICTED: probable auxin efflux carrier com...    276   2e-85    
gb|EAZ36376.1|  hypothetical protein OsJ_20704                          276   2e-85    
ref|XP_009380316.1|  PREDICTED: probable auxin efflux carrier com...    275   2e-85    
gb|AIF28271.1|  PIN-like protein                                        276   3e-85    
ref|XP_008223846.1|  PREDICTED: auxin efflux carrier component 2-...    276   3e-85    
ref|XP_010673044.1|  PREDICTED: probable auxin efflux carrier com...    274   5e-85    
ref|XP_010536878.1|  PREDICTED: auxin efflux carrier component 2        275   5e-85    
ref|XP_009120227.1|  PREDICTED: auxin efflux carrier component 2-...    275   6e-85    
ref|XP_009610818.1|  PREDICTED: auxin efflux carrier component 2        276   6e-85    
ref|XP_004299793.1|  PREDICTED: auxin efflux carrier component 2-...    275   7e-85    
gb|AIF28519.1|  PIN-like protein                                        263   8e-85    
ref|XP_009407784.1|  PREDICTED: probable auxin efflux carrier com...    275   8e-85    
ref|XP_006474301.1|  PREDICTED: auxin efflux carrier component 2-...    275   8e-85    
dbj|BAK00230.1|  predicted protein                                      273   9e-85    
gb|KDO61974.1|  hypothetical protein CISIN_1g036474mg                   275   9e-85    
ref|XP_007227619.1|  hypothetical protein PRUPE_ppa024134mg             275   1e-84    
gb|KFK27268.1|  hypothetical protein AALP_AA8G359900                    275   2e-84    
ref|XP_008781803.1|  PREDICTED: probable auxin efflux carrier com...    274   2e-84    
gb|EMT33514.1|  Putative auxin efflux carrier component 1c              275   2e-84    
gb|AIF28412.1|  PIN-like protein                                        270   2e-84    
gb|AAD16060.1|  root gravitropism control protein                       274   3e-84    
ref|NP_568848.1|  auxin efflux carrier component 2                      274   3e-84    
ref|XP_002864498.1|  hypothetical protein ARALYDRAFT_918870             274   3e-84    
gb|AIF28322.1|  PIN-like protein                                        259   3e-84    
ref|XP_006644425.1|  PREDICTED: LOW QUALITY PROTEIN: probable aux...    273   3e-84    
dbj|BAA97359.1|  auxin transport protein EIR1                           274   3e-84    
gb|AIF28534.1|  PIN-like protein                                        269   3e-84    
gb|KCW84066.1|  hypothetical protein EUGRSUZ_B00948                     271   3e-84    
ref|XP_010483204.1|  PREDICTED: auxin efflux carrier component 2-...    274   4e-84    
ref|XP_006401246.1|  hypothetical protein EUTSA_v10012929mg             273   4e-84    
ref|XP_010451791.1|  PREDICTED: auxin efflux carrier component 2-...    273   4e-84    
ref|XP_010443377.1|  PREDICTED: auxin efflux carrier component 2 ...    273   4e-84    
gb|EMT32196.1|  Putative auxin efflux carrier component 1b              275   4e-84    



>ref|XP_009761335.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Nicotiana 
sylvestris]
Length=619

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009601533.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=617

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009601532.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AGG79243.1| auxin efflux facilitator PIN3b [Nicotiana tabacum]
Length=619

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009761336.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Nicotiana 
sylvestris]
Length=615

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AGG79240.1| auxin efflux facilitator PIN3 [Nicotiana tabacum]
Length=620

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINLFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIMLVVLC WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010320545.1| PREDICTED: auxin efflux facilitator SlPIN4 isoform X1 [Solanum 
lycopersicum]
Length=648

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006360412.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum]
Length=622

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQK+IML+VLC W+N++KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_006344239.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum]
Length=654

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009601548.1| PREDICTED: auxin efflux carrier component 7-like [Nicotiana tomentosiformis]
 gb|AGG79242.1| auxin efflux facilitator PIN4 [Nicotiana tabacum]
Length=650

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|NP_001234184.1| auxin efflux facilitator SlPIN4 [Solanum lycopersicum]
 gb|ADR30410.1| auxin efflux facilitator SlPIN4 [Solanum lycopersicum]
Length=653

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>dbj|BAJ09455.1| auxin efflux carrier [Solanum lycopersicum]
Length=653

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010527774.1| PREDICTED: auxin efflux carrier component 4-like [Tarenaya hassleriana]
Length=619

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIMLVVLC WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVVLCLWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|NP_001234177.1| auxin efflux facilitator SlPIN3 [Solanum lycopersicum]
 gb|ADR30411.1| auxin efflux facilitator SlPIN3 [Solanum lycopersicum]
Length=604

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQK+IML+VLC W+N++KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_009802789.1| PREDICTED: auxin efflux carrier component 7-like [Nicotiana sylvestris]
Length=654

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVL+AVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010319114.1| PREDICTED: auxin efflux facilitator SlPIN3 isoform X1 [Solanum 
lycopersicum]
 dbj|BAJ09456.1| auxin efflux carrier [Solanum lycopersicum]
Length=613

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQK+IML+VLC W+N++KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>emb|CDP00766.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   323 bits (827),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLYVVL+AV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITWHDLYVVLSAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMNL+FIAADTLQK+IMLVVL  WAN +KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNLKFIAADTLQKVIMLVVLALWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY  Y+GSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYNPYAGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010498810.1| PREDICTED: auxin efflux carrier component 7-like isoform X2 [Camelina 
sativa]
Length=530

 Score =   318 bits (816),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_011075655.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=644

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADSLQKVIMLVVLGLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|NP_564189.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 gb|AAK96547.1| At1g23080/T26J12_14 [Arabidopsis thaliana]
 gb|AEE30333.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=527

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_011075639.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
 ref|XP_011075647.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=650

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MN RFIAAD+LQK+IMLVVL  WANL+KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADSLQKVIMLVVLGLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|EYU30062.1| hypothetical protein MIMGU_mgv1a002731mg [Erythranthe guttata]
Length=643

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAVVPLYVAM LAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVVPLYVAMFLAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MN RFIAADTLQKIIMLVVL FWAN +KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADTLQKIIMLVVLGFWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AAC00611.1| unknown protein [Arabidopsis thaliana]
Length=574

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_011070630.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=651

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MN RFIAADTLQKIIMLVVL  WAN +KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYTMNFRFIAADTLQKIIMLVVLGLWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010427902.1| PREDICTED: auxin efflux carrier component 3-like [Camelina sativa]
Length=645

 Score =   320 bits (820),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_010477592.1| PREDICTED: auxin efflux carrier component 7 isoform X3 [Camelina 
sativa]
Length=604

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AFJ03880.1| auxin transport protein [Capsella bursa-pastoris]
Length=618

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_010498809.1| PREDICTED: auxin efflux carrier component 7-like isoform X1 [Camelina 
sativa]
Length=612

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_010477589.1| PREDICTED: auxin efflux carrier component 7 isoform X1 [Camelina 
sativa]
Length=615

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_010477591.1| PREDICTED: auxin efflux carrier component 7 isoform X2 [Camelina 
sativa]
Length=611

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AEJ76925.1| auxin transport protein [Capsella bursa-pastoris]
Length=649

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVIWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_010471101.1| PREDICTED: auxin efflux carrier component 3-like [Camelina sativa]
Length=645

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_002887338.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63597.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=642

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_006300840.1| hypothetical protein CARUB_v10019932mg [Capsella rubella]
 gb|EOA33738.1| hypothetical protein CARUB_v10019932mg [Capsella rubella]
Length=648

 Score =   320 bits (819),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVIWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_006307013.1| hypothetical protein CARUB_v10008599mg [Capsella rubella]
 gb|EOA39911.1| hypothetical protein CARUB_v10008599mg [Capsella rubella]
Length=618

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CDY25767.1| BnaA07g10150D [Brassica napus]
Length=573

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+IML +L  WAN ++ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|NP_001077584.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 dbj|BAH19520.1| AT1G23080 [Arabidopsis thaliana]
 gb|AEE30334.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=615

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CDY68262.1| BnaC06g43740D [Brassica napus]
Length=584

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|NP_849700.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 sp|Q940Y5.2|PIN7_ARATH RecName: Full=Auxin efflux carrier component 7; Short=AtPIN7 
[Arabidopsis thaliana]
 gb|AAD52697.1|AF087820_1 auxin transport protein [Arabidopsis thaliana]
 gb|AEE30332.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=619

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CDX96288.1| BnaA07g28990D [Brassica napus]
Length=583

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>gb|KDO64681.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=529

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010554422.1| PREDICTED: auxin efflux carrier component 4-like [Tarenaya hassleriana]
Length=626

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTA+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIMLVVL  WA+L+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVVLGLWASLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CAC67688.1| efflux carrier, pin3 [Brassica juncea]
Length=635

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_006398529.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum]
 gb|ESQ39982.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum]
Length=609

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIMLV+L  WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLALWANLTKNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|NP_177250.1| auxin efflux carrier component 3 [Arabidopsis thaliana]
 sp|Q9S7Z8.1|PIN3_ARATH RecName: Full=Auxin efflux carrier component 3; Short=AtPIN3 
[Arabidopsis thaliana]
 gb|AAD52695.1|AF087818_1 auxin transport protein [Arabidopsis thaliana]
 gb|AAD55507.1|AC008148_17 auxin transport protein [Arabidopsis thaliana]
 gb|AAM96993.1| putative auxin transport protein REH1 [Arabidopsis thaliana]
 gb|AAN72096.1| putative auxin transport protein REH1 [Arabidopsis thaliana]
 dbj|BAE98967.1| auxin transport like protein [Arabidopsis thaliana]
 gb|AEE35140.1| auxin efflux carrier component 3 [Arabidopsis thaliana]
Length=640

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_010552711.1| PREDICTED: auxin efflux carrier component 3 [Tarenaya hassleriana]
Length=580

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKVIMLFLLALWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_002893260.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69519.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata]
Length=614

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KFK41521.1| hypothetical protein AALP_AA2G140400 [Arabis alpina]
Length=650

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLCLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_009103201.1| PREDICTED: auxin efflux carrier component 7 [Brassica rapa]
Length=603

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+IML +L  WAN ++ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CAC67457.1| efflux carrier, pin2 [Brassica juncea]
Length=640

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>emb|CAC24691.1| efflux carrier of polar auxin transport [Brassica juncea]
Length=639

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>gb|EYU40829.1| hypothetical protein MIMGU_mgv1a025638mg [Erythranthe guttata]
Length=632

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLYVVLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MN RF+AADTLQKIIML VL  WAN+SKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFVAADTLQKIIMLAVLAMWANISKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|NP_565261.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
 gb|AAF36769.1| auxin transporter splice variant b [Arabidopsis thaliana]
 gb|AAC67319.2| putative auxin transport protein [Arabidopsis thaliana]
 gb|AAM15143.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AEC05448.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
Length=612

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIMLV+L  WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|NP_849923.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
 sp|Q8RWZ6.1|PIN4_ARATH RecName: Full=Auxin efflux carrier component 4; Short=AtPIN4 
[Arabidopsis thaliana]
 gb|AAM14031.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AAP40497.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AEC05449.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
Length=616

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIMLV+L  WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_010415790.1| PREDICTED: auxin efflux carrier component 3 [Camelina sativa]
Length=646

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>ref|XP_006290757.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
 gb|EOA23655.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
Length=612

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAADTLQKIIML +L  WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGSYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_010513862.1| PREDICTED: auxin efflux carrier component 4-like [Camelina sativa]
Length=605

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAADTLQKIIML VL  W+NL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFVLALWSNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_010462853.1| PREDICTED: auxin efflux carrier component 7-like [Camelina sativa]
Length=726

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_002876748.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53007.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIMLV+L  WANL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLGLWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_006416127.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum]
 gb|ESQ34480.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum]
Length=610

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+IML +L  WAN +++G+LEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYSMNLRFIAADTLQKLIMLSLLTIWANFTRSGTLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KDO64677.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=636

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|KDO64678.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
 gb|KDO64679.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=621

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AAM55297.1| auxin efflux carrier protein [Medicago truncatula]
 gb|KEH30872.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=659

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML+ L  W N + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIMLLALTIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|KDO64680.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=604

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010424909.1| PREDICTED: auxin efflux carrier component 4 [Camelina sativa]
Length=608

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAADTLQKIIML +L  W+NL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFLLALWSNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>emb|CAN66787.1| hypothetical protein VITISV_013835 [Vitis vinifera]
Length=627

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIMLVVL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   QNNPYAMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006390822.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum]
 gb|ESQ28108.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum]
Length=642

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLGLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+Y+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGDYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>dbj|BAH47611.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=625

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT HD Y V++A+VPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHF S
Sbjct  1    MITGHDFYTVMSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFTS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIMLVVL  WAN +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYAMNFRFIAADTLQKIIMLVVLALWANFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|KDP38049.1| hypothetical protein JCGZ_04692 [Jatropha curcas]
Length=648

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIMLV L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009105760.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux carrier component 
3 [Brassica rapa]
Length=635

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            + NPY MNLRFIAADTLQKI+ML +L  WAN +++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TXNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFP
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFP  166



>gb|KDO64676.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=657

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|KFK44397.1| hypothetical protein AALP_AA1G252100 [Arabis alpina]
Length=598

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNL FIAADTLQKI+ML +L  WAN +++G+LEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYSMNLHFIAADTLQKIMMLSLLTLWANFTRSGNLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_002284302.1| PREDICTED: auxin efflux carrier component 3 [Vitis vinifera]
Length=649

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIMLVVL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   QNNPYAMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>emb|CDY63826.1| BnaC02g47640D [Brassica napus]
Length=563

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIMLV+L  WA+L+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|EPS59246.1| hypothetical protein M569_15563, partial [Genlisea aurea]
Length=536

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT HDLYVVLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITLHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NN Y MN RF+AADT+QK+IML +L  W NLS++GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   QNNIYAMNFRFVAADTVQKLIMLSILALWGNLSRSGSLEWSITVFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006469168.1| PREDICTED: auxin efflux carrier component 3-like [Citrus sinensis]
Length=657

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>emb|CDY40380.1| BnaA02g26940D [Brassica napus]
Length=562

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+IMLV+L  WA+L+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKVIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>emb|CDY12491.1| BnaC07g13310D [Brassica napus]
Length=574

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGI RFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGIKRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNL FIAADTLQK+IML +L  WAN ++ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLHFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_002526018.1| Auxin efflux carrier component, putative [Ricinus communis]
 gb|EEF36358.1| Auxin efflux carrier component, putative [Ricinus communis]
Length=646

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITGKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMNLRFIAADTLQKIIMLV L  W NL+KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNLRFIAADTLQKIIMLVALGLWTNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY +Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYDKYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AIF28339.1| PIN-like protein, partial [Hakea drupacea]
Length=507

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKII+LVVL  W N ++ GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIILLVVLGIWTNFTRTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LSAMYGQYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AIF28328.1| PIN-like protein, partial [Aextoxicon punctatum]
Length=338

 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTA++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAMIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+PY+MN RFIAADTLQKIIMLVVL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   INDPYKMNFRFIAADTLQKIIMLVVLIIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG YS SLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LRAMYGNYSASLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_010101728.1| Auxin efflux carrier component 3 [Morus notabilis]
 gb|EXB89392.1| Auxin efflux carrier component 3 [Morus notabilis]
Length=652

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NN Y MN RFIAADTLQKIIML VL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNFRFIAADTLQKIIMLSVLAIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_009129244.1| PREDICTED: auxin efflux carrier component 4 [Brassica rapa]
Length=599

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIMLV+L  WA+L+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|KFK33369.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=605

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+K+G+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|KFK33370.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=604

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML +L  WANL+K+G+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_004161982.1| PREDICTED: auxin efflux carrier component 3-like [Cucumis sativus]
Length=637

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAMNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KGN51517.1| hypothetical protein Csa_5G576590 [Cucumis sativus]
Length=636

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAMNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AGJ95053.1| PIN1a [Glycine max]
Length=561

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W NL+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFP  166



>gb|AIF28331.1| PIN-like protein, partial [Trochodendron aralioides]
Length=590

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWQDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIMLVVL  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LIAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>ref|NP_001267499.1| uncharacterized protein LOC100791394 [Glycine max]
 gb|AGJ95057.1| PIN1b [Glycine max]
 gb|KHN15990.1| Auxin efflux carrier component 3 [Glycine soja]
Length=634

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY+VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYMVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W NL+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFP  166



>ref|XP_007157734.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
 gb|ESW29728.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
Length=660

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWADLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_008467158.1| PREDICTED: auxin efflux carrier component 4-like [Cucumis melo]
Length=636

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_007157735.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
 gb|ESW29729.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
Length=658

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWADLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_010672759.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VL A+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP+EMNL FIAADTLQK+IMLV+L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPWEMNLHFIAADTLQKVIMLVLLALWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_010672758.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VL A+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP+EMNL FIAADTLQK+IMLV+L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPWEMNLHFIAADTLQKVIMLVLLALWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AIF28299.1| PIN-like protein, partial [Papaver somniferum]
Length=374

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY V TAVVPLYVAM+LAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDLYHVFTAVVPLYVAMVLAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAAD+LQKII+LVVL FW+  S NGSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNLRFIAADSLQKIIVLVVLAFWSRFSANGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI+EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIVEQFP  166



>ref|XP_007153407.1| hypothetical protein PHAVU_003G032500g [Phaseolus vulgaris]
 gb|ESW25401.1| hypothetical protein PHAVU_003G032500g [Phaseolus vulgaris]
Length=635

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLT+VVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYTVLTSVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQKIIML  L  W NL+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNFRFIAADTLQKIIMLFALTLWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFP  166



>ref|NP_001267715.1| auxin efflux carrier component 3-like [Cucumis sativus]
 dbj|BAJ10466.1| auxin efflux facilitator [Cucumis sativus]
Length=636

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY +N RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAVNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KEH40559.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=523

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MN RFIAADTLQKIIMLV L  W   +KNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYQMNFRFIAADTLQKIIMLVALSLWTLFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_007045127.1| Auxin efflux carrier family protein isoform 4 [Theobroma cacao]
 gb|EOY00959.1| Auxin efflux carrier family protein isoform 4 [Theobroma cacao]
Length=520

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KHN43027.1| Auxin efflux carrier component 3 [Glycine soja]
Length=609

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_007045129.1| Auxin efflux facilitator isoform 6 [Theobroma cacao]
 gb|EOY00961.1| Auxin efflux facilitator isoform 6 [Theobroma cacao]
Length=525

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_004498307.1| PREDICTED: auxin efflux carrier component 3-like [Cicer arietinum]
Length=633

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAM+LAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITLKDLYTVLTAVVPLYVAMLLAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY+MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFGLSLWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|KJB15455.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=540

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>dbj|BAO49658.1| putative auxin efflux carrier protein [Vigna angularis]
Length=636

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKI+ML  L  W NL+K GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIMMLFALTLWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFP  166



>ref|XP_006583898.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Glycine 
max]
Length=662

 Score =   309 bits (792),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_003529411.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Glycine 
max]
Length=665

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>dbj|BAH23798.1| putative auxin transport facilitator protein [Pisum sativum]
Length=617

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT+ DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITFKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY+MN RFIAADTLQKIIML  L  W   +KNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFALSLWTKFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>dbj|BAO49654.1| putative auxin efflux carrier protein [Vigna angularis]
Length=653

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWTDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQKIIML  L  W N + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGQLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>dbj|BAD05032.1| putative auxin transport protein [Pisum sativum]
Length=617

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT+ DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITFKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY+MN RFIAADTLQKIIML  L  W   +KNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFALSLWTKFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_002314810.2| PIN1-like family protein [Populus trichocarpa]
 gb|EEF00981.2| PIN1-like family protein [Populus trichocarpa]
Length=634

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML+ L  W N +KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LTAMYGKYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006849750.1| hypothetical protein AMTR_s00024p00250140 [Amborella trichopoda]
 gb|ERN11331.1| hypothetical protein AMTR_s00024p00250140 [Amborella trichopoda]
Length=669

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIML VL  W NL++ G LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLFVLALWTNLTRAGCLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYDEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|AIF28356.1| PIN-like protein, partial [Posidonia australis]
Length=419

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW+DLY VL AVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWNDLYTVLAAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKIIM VVL  W  ++++G+++W ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMFVVLTVWVGVTRSGTIDWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG Y+GSLMVQVVVLQCIIWYT+LLFLFEYR AKMLIMEQFP
Sbjct  121  LIAMYGSYAGSLMVQVVVLQCIIWYTILLFLFEYRAAKMLIMEQFP  166



>gb|KJB15458.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=609

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|NP_001276316.1| uncharacterized protein LOC100785146 [Glycine max]
 gb|AGJ95054.1| PIN3a [Glycine max]
Length=650

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPYEMN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|KJB15460.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=577

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_007045128.1| Auxin efflux carrier family protein isoform 5 [Theobroma cacao]
 gb|EOY00960.1| Auxin efflux carrier family protein isoform 5 [Theobroma cacao]
Length=542

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_011038656.1| PREDICTED: auxin efflux carrier component 7 [Populus euphratica]
Length=639

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML+ L  W N +KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LTAMYGNYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|KHG04074.1| Auxin efflux carrier component 3 -like protein [Gossypium arboreum]
Length=631

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK++ML VL  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLLMLFVLGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KJB15456.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=630

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_007045126.1| Auxin efflux facilitator isoform 3 [Theobroma cacao]
 gb|EOY00958.1| Auxin efflux facilitator isoform 3 [Theobroma cacao]
Length=609

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AAM55299.1| auxin efflux carrier protein [Medicago truncatula]
 gb|KEH40560.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=621

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MN RFIAADTLQKIIMLV L  W   +KNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYQMNFRFIAADTLQKIIMLVALSLWTLFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_002312436.1| PIN1-like family protein [Populus trichocarpa]
 gb|EEE89803.1| PIN1-like family protein [Populus trichocarpa]
Length=649

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYSMNFRFIAADTLQKIIMLFALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY +YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYDDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>emb|CDY41467.1| BnaA08g20690D [Brassica napus]
Length=584

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLY AMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYFAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY +NLRFIAADTLQK+IML +L  WAN + +GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYAINLRFIAADTLQKLIMLTLLTLWANFTHSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYGEYS SLMVQVVVLQCI+WYT+LLFLFEYRGAK+LIMEQFP
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIVWYTILLFLFEYRGAKILIMEQFP  166



>gb|AAM54033.1|AF515434_1 PIN1-like auxin transport protein [Populus tremula x Populus 
tremuloides]
Length=640

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML+ L  W N +KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LTAMYGTYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>dbj|BAH47610.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=605

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT HD Y V+ A+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITAHDFYTVMAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY+MN RFIAADTLQKIIMLVVL  WA   KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   LNNPYQMNFRFIAADTLQKIIMLVVLGLWAGFGKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+Y+GSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGDYAGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AIF28330.1| PIN-like protein, partial [Trochodendron aralioides]
Length=538

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W D Y VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDFYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+PY MN RFIAADTLQKIIMLVVL  W N +KNGSL+W ITIFSLSTLPNTL+MGIPL
Sbjct  61   MNDPYSMNFRFIAADTLQKIIMLVVLFIWTNFTKNGSLDWVITIFSLSTLPNTLIMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFP
Sbjct  121  LIAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRSAKILIMEQFP  166



>gb|KJB15457.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=637

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KJB15454.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=645

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KJB15459.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=648

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+IML  L  W NL++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_011023284.1| PREDICTED: auxin efflux carrier component 3-like [Populus euphratica]
Length=649

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYSMNFRFIAADTLQKIIMLFALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY +YSGSLMVQVVVLQCI+WYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYDDYSGSLMVQVVVLQCIVWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_007045125.1| Auxin efflux facilitator isoform 2 [Theobroma cacao]
 gb|EOY00957.1| Auxin efflux facilitator isoform 2 [Theobroma cacao]
Length=649

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>emb|CDX91695.1| BnaC08g06140D [Brassica napus]
Length=571

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY +N+RFIAADTLQK+IML +L  WAN +++GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYTINIRFIAADTLQKLIMLTLLTLWANFTRSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYGEYS SLMVQVVVLQCIIW T+LLFLFEYRGAK+LIMEQFP
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIIWNTVLLFLFEYRGAKILIMEQFP  166



>gb|AIF28374.1| PIN-like protein, partial [Cunninghamia lanceolata]
Length=254

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN++FIAADTLQK+IML VL  W   +++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   GNNPYTMNMKFIAADTLQKLIMLFVLGMWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>gb|AAP59843.1| PIN1-like protein [Populus tomentosa]
Length=619

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI W+DLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MICWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN +FIAADTLQKIIML+ L  W N +KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFKFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LTAMYGTYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006605368.1| PREDICTED: uncharacterized protein LOC100802247 isoform X1 [Glycine 
max]
Length=664

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|NP_001267527.1| uncharacterized protein LOC100802247 [Glycine max]
 gb|AGJ95070.1| PIN3b [Glycine max]
Length=666

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_010260501.1| PREDICTED: auxin efflux carrier component 4-like [Nelumbo nucifera]
Length=644

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VL A+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MN  FIAADTLQKIIMLVVL  WAN ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYKMNFHFIAADTLQKIIMLVVLGIWANFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY + +GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYDKNAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AIF28335.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=638

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VLTAVVPLYVAMILAY SVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWKDLYTVLTAVVPLYVAMILAYCSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML +L  W N ++NG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLGILGIWTNFTRNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGE+SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEFSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_007226967.1| hypothetical protein PRUPE_ppa002528mg [Prunus persica]
 gb|EMJ28166.1| hypothetical protein PRUPE_ppa002528mg [Prunus persica]
Length=662

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_009356144.1| PREDICTED: auxin efflux carrier component 3-like [Pyrus x bretschneideri]
Length=659

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_008243361.1| PREDICTED: auxin efflux carrier component 3-like [Prunus mume]
Length=662

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_007045124.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOY00956.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=697

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML VL  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_009110124.1| PREDICTED: auxin efflux carrier component 7-like [Brassica rapa]
Length=586

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDL  VLTAV+PLY AMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLCTVLTAVIPLYFAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY +NLRFIAADTLQK+IML +L  WAN + +GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYAINLRFIAADTLQKLIMLTLLTLWANFTHSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYGEYS SLMVQVVVLQCI+WYT+LLFLFEYRGAK+LIMEQFP
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIVWYTILLFLFEYRGAKILIMEQFP  166



>ref|XP_006605369.1| PREDICTED: uncharacterized protein LOC100802247 isoform X2 [Glycine 
max]
Length=654

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW D Y V++AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN RFIAADTLQKIIML  L  W N S NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  166



>ref|XP_008389216.1| PREDICTED: auxin efflux carrier component 3-like [Malus domestica]
Length=660

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_008454788.1| PREDICTED: auxin efflux carrier component 7-like [Cucumis melo]
Length=628

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAV+PLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIMLV L  WAN +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AIF28368.1| PIN-like protein, partial [Nageia nagi]
Length=276

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN +FIAADTLQK+IML VL  W + +K+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTSFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP
Sbjct  121  LKAMYGGDSGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFP  166



>gb|AIF28388.1| PIN-like protein, partial [Chamaecyparis hodginsii]
Length=544

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP++MN+RFIAAD+LQKII+LVVL  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFP  166



>ref|XP_010274646.1| PREDICTED: auxin efflux carrier component 4-like [Nelumbo nucifera]
Length=645

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VL A+VPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWGDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MN  FIAADTLQKIIM+VVL  WAN ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYKMNFHFIAADTLQKIIMIVVLGIWANFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMY   +G+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LIAMYNPEAGNLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>gb|AIF28371.1| PIN-like protein, partial [Chamaecyparis lawsoniana]
Length=367

 Score =   293 bits (749),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISPKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNL+FIAADTLQK+IML VL  W   +++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNLKFIAADTLQKLIMLFVLGIWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>gb|AIF28355.1| PIN-like protein, partial [Talbotia elegans]
Length=199

 Score =   286 bits (733),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VL+A+VPLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISWGDLYTVLSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMN RFIAADTLQKII+L  L  W+ ++ +GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNFRFIAADTLQKIIVLAALAVWSCVAPSGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG ++G LMVQ+VVLQCIIWYTL+LFLFEYR A++LI++QFP
Sbjct  121  LIAMYGPFAGPLMVQIVVLQCIIWYTLMLFLFEYRAARLLIVDQFP  166



>ref|XP_004505266.1| PREDICTED: auxin efflux carrier component 3-like [Cicer arietinum]
Length=653

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VL AVVPLYVAMILAY SVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWGDLYTVLAAVVPLYVAMILAYSSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY M+ RFIAADTLQKIIML  L  W N + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   INNPYAMDFRFIAADTLQKIIMLFALSIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG+LM+QVVVLQCI+WYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGEYSGTLMIQVVVLQCIVWYTLLLFLFEYRGAKLLIMEQFP  166



>gb|AAQ14258.1|AF247005_1 auxin efflux carrier [Momordica charantia]
Length=634

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIML  L  WAN +KNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLAALTVWANFTKNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LQAMYGGNSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|AIF28430.1| PIN-like protein, partial [Amentotaxus argotaenia]
Length=347

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  138  DLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFISSNNPY  317
            DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS+NNPY
Sbjct  1    DLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNNPY  60

Query  318  EMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPLLIAMY  497
             MNLRFIAAD+LQKI+ L++L  W  ++KNGSLEW IT+FSLSTLPNTLVMGIPLL AMY
Sbjct  61   TMNLRFIAADSLQKIMTLLMLGIWTKVAKNGSLEWMITLFSLSTLPNTLVMGIPLLKAMY  120

Query  498  GEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            GE+SG LMVQVVVLQCIIWYTL+LFLFEYRGAK+LIMEQFP
Sbjct  121  GEFSGDLMVQVVVLQCIIWYTLMLFLFEYRGAKLLIMEQFP  161



>gb|AIF28379.1| PIN-like protein, partial [Podocarpus coriaceus]
Length=179

 Score =   285 bits (728),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+P++MNLRFIAADTLQK+I+L+VL  WA +S+ G+LEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNDPFKMNLRFIAADTLQKVIVLMVLGLWAKISRRGNLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP
Sbjct  121  LKGMYGADSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFP  166



>gb|AIF28366.1| PIN-like protein, partial [Prumnopitys andina]
Length=332

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISPKDLYTVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN +FIAADTLQK+IML VL  W   +K+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTTFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP
Sbjct  121  LKAMYGGASGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFP  166



>gb|AIF28377.1| PIN-like protein, partial [Amentotaxus argotaenia]
Length=526

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN +FIAADTLQKIIML VL  W   +K+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFKFIAADTLQKIIMLFVLGIWTTFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>gb|AIF28317.1| PIN-like protein, partial [Nuphar advena]
Length=349

 Score =   290 bits (743),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITAADFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L +L  W N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIVLALLTVWTNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAK+LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKILITEQFP  166



>gb|AIF28378.1| PIN-like protein, partial [Taxus baccata]
Length=362

 Score =   291 bits (744),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MN +FIAADTLQK+IML VL  W   +++GSL W ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYTMNFKFIAADTLQKVIMLFVLGIWTTFTRSGSLGWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>gb|KJB30812.1| hypothetical protein B456_005G161800 [Gossypium raimondii]
Length=325

 Score =   289 bits (739),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W DLY VL  V+PLYVAM +AYGSVRWWKIF+PD+CSGINRFV IFAVPLLSFHFIS
Sbjct  1    MISWGDLYTVLMVVIPLYVAMNIAYGSVRWWKIFSPDECSGINRFVTIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN++FIAADTLQK+IML  L  WAN + NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNVKFIAADTLQKLIMLFALGLWANFTTNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEY G KMLIMEQFP
Sbjct  121  LIAMYGEYSGMLMVQVVVLQCIIWYTLLLFLFEYHGDKMLIMEQFP  166



>ref|XP_004140432.1| PREDICTED: auxin efflux carrier component 7-like [Cucumis sativus]
 ref|XP_004170112.1| PREDICTED: auxin efflux carrier component 7-like [Cucumis sativus]
 gb|KGN50836.1| hypothetical protein Csa_5G284520 [Cucumis sativus]
Length=629

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAV+PLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIMLV L  WAN +KNGSLE  ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLESMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>gb|KCW86214.1| hypothetical protein EUGRSUZ_B02902 [Eucalyptus grandis]
Length=636

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 154/172 (90%), Gaps = 6/172 (3%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VL+AVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MNLRFIAADTLQK+IML VL  WAN ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNLRFIAADTLQKLIMLAVLALWANFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYG------EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG      + +G LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LEAMYGPGASKRDDAGGLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  172



>ref|XP_009339666.1| PREDICTED: auxin efflux carrier component 3-like [Pyrus x bretschneideri]
Length=664

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 152/173 (88%), Gaps = 7/173 (4%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY-------SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG           SLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHKYRHKRPDPASLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  173



>ref|XP_009357924.1| PREDICTED: auxin efflux carrier component 3 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009358002.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=636

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_009357915.1| PREDICTED: auxin efflux carrier component 3 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357993.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_008775285.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Phoenix 
dactylifera]
Length=509

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+I+L  L  W  LS  GSL W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALAAWTRLSSRGSLNWAITVFSLATLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFP  166



>ref|XP_008339560.1| PREDICTED: auxin efflux carrier component 3 isoform X1 [Malus 
domestica]
Length=636

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>gb|AIF28259.1| PIN-like protein, partial [Elegia tectorum]
Length=413

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WW+IF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITAADFYHVMTAVVPLYVAMILAYGSVKWWRIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+++L +L  W++LSK GSLEW+IT+FSL TLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLMVLAILTAWSHLSKRGSLEWTITLFSLGTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAK+LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKILITEQFP  166



>gb|AIF28386.1| PIN-like protein, partial [Chamaecyparis lawsoniana]
Length=683

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP++MN+RFIAAD+LQKII+LVVL  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFP  166



>ref|XP_010044176.1| PREDICTED: auxin efflux carrier component 4-like [Eucalyptus 
grandis]
 gb|KCW86213.1| hypothetical protein EUGRSUZ_B02902 [Eucalyptus grandis]
Length=657

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 154/172 (90%), Gaps = 6/172 (3%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VL+AVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             N+ Y MNLRFIAADTLQK+IML VL  WAN ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNLRFIAADTLQKLIMLAVLALWANFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYG------EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG      + +G LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LEAMYGPGASKRDDAGGLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFP  172



>gb|AIF28364.1| PIN-like protein, partial [Keteleeria evelyniana]
Length=463

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VL AVVPLYVAMILAYGSV+WWKIFTP+QCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISAKDLYNVLVAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAVFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
             NNPY MN +FIAADTLQK+IMLVVL  W N +++GS EW ITIFS+STLPNTLVMGIPL
Sbjct  61   GNNPYTMNFKFIAADTLQKVIMLVVLGLWTNFTRSGSPEWMITIFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG +SG LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP
Sbjct  121  LKAMYGGFSGDLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  166



>ref|XP_006490773.1| PREDICTED: auxin efflux carrier component 1-like [Citrus sinensis]
Length=480

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLADFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY+MNLRFIAADTLQKII+LVVL  W+ LSK G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNDPYKMNLRFIAADTLQKIIVLVVLAIWSKLSKRGCLEWTITLFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFP  166



>dbj|BAJ10462.1| auxin efflux facilitator [Cucumis sativus]
Length=629

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY V TAV+PLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITGKDLYTVFTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIMLV L  WAN +KNGSLE  ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLESMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFP  166



>ref|XP_010924933.1| PREDICTED: probable auxin efflux carrier component 3a [Elaeis 
guineensis]
Length=648

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+I+L  L  WA LS  GSL+W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALTAWARLSSRGSLDWAITVFSLATLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFP  166



>ref|XP_008339561.1| PREDICTED: auxin efflux carrier component 3 isoform X2 [Malus 
domestica]
Length=583

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>gb|AIF28248.1| PIN-like protein, partial [Trochodendron aralioides]
Length=373

 Score =   288 bits (737),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAM LAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMFLAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MNLRFIAADTLQKII+L VL  W  +SK G LEW+IT+FSLS+LPNTLVMGIPL
Sbjct  61   SNDPYTMNLRFIAADTLQKIIILAVLAVWTKVSKRGCLEWTITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLITEQFP  166



>ref|XP_004297366.1| PREDICTED: auxin efflux carrier component 3-like [Fragaria vesca 
subsp. vesca]
Length=662

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 153/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+W+DLY VLTAVVPLYVAMILAYGSVRWWKIF+ DQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISWNDLYKVLTAVVPLYVAMILAYGSVRWWKIFSTDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALALWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG     +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGHQIPEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>gb|AIF28425.1| PIN-like protein, partial [Manoao colensoi]
Length=478

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI   DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MINGGDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAAD++QKII+LV+L  W  + KNGSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADSMQKIIILVLLGIWTKVGKNGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG +SG LMVQVVVLQCIIWYTL+LF+FEYRGAK+LIMEQFP
Sbjct  121  LKAMYGSFSGDLMVQVVVLQCIIWYTLMLFMFEYRGAKLLIMEQFP  166



>dbj|BAK02872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   297 bits (761),  Expect = 7e-93, Method: Composition-based stats.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAM+LAYGSV+WW+IFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDFYHVMTAMVPLYVAMMLAYGSVKWWRIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+I+L +L  W++LS+NGSLEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNLRFIAADTLQKLIVLALLTLWSHLSRNGSLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGDESGSLMVQIVVLQCIIWYTLMLFMFEYRGARILITEQFP  166



>ref|XP_009357931.1| PREDICTED: auxin efflux carrier component 3 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009358009.1| PREDICTED: auxin efflux carrier component 3-like isoform X3 [Pyrus 
x bretschneideri]
Length=583

 Score =   294 bits (753),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 3/169 (2%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+WHDLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFIS
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RF+AADTLQKIIML  L  W N ++NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFP
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFP  169



>ref|XP_008345946.1| PREDICTED: auxin efflux carrier component 1-like [Malus domestica]
Length=248

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+I+L VL  W  +SK G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   TNDPYNMNTRFIAADTLQKLIVLAVLGVWTKVSKRGCLEWTITLFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFP  166



>ref|XP_011075451.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X2 [Sesamum indicum]
Length=564

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISITDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMN RFIAADTLQK+I+L VL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNYRFIAADTLQKLIVLAVLAVWSRASSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>dbj|BAO49652.1| putative auxin efflux carrier protein [Vigna angularis]
Length=592

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA++PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLADFYHVMTAMLPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPYEMN RFIAADTLQK+I+LVVL  W+N+SK GSLEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNNPYEMNFRFIAADTLQKMIVLVVLTIWSNVSKRGSLEWTITLFSISTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>gb|KJB53043.1| hypothetical protein B456_008G290000 [Gossypium raimondii]
Length=534

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQKII+LVVL  W+ +SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNFRFIAADTLQKIIVLVVLAIWSKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFP  166



>emb|CDP06197.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITITDLYHVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKII+LVVL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>gb|AIF28385.1| PIN-like protein, partial [Sciadopitys verticillata]
Length=647

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI   DLY V+TAVVPLYVAMILAY SV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MINGRDLYHVMTAVVPLYVAMILAYASVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNP++MNLRFIAADTLQKIIML VL  WA  S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   SNNPFDMNLRFIAADTLQKIIMLAVLGIWAKASRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFP  166



>gb|AIF28304.1| PIN-like protein, partial [Platanus occidentalis]
Length=603

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGADLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI++LVVL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIMVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFP  166



>ref|XP_011075450.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X1 [Sesamum indicum]
Length=595

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISITDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMN RFIAADTLQK+I+L VL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNYRFIAADTLQKLIVLAVLAVWSRASSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>ref|XP_002282220.1| PREDICTED: probable auxin efflux carrier component 1c [Vitis 
vinifera]
 emb|CAN64182.1| hypothetical protein VITISV_007800 [Vitis vinifera]
Length=604

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISLLDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQKII+L VL  W+N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIVLAVLAVWSNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGEYSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLI EQFP
Sbjct  121  LKGMYGEYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLISEQFP  166



>gb|AIF28390.1| PIN-like protein, partial [Thuja plicata]
Length=680

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI W DLY V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MIGWRDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP++MN+RFIAAD+LQKII+LVVL  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFP  166



>ref|XP_007036847.1| Auxin efflux facilitator isoform 2, partial [Theobroma cacao]
 gb|EOY21348.1| Auxin efflux facilitator isoform 2, partial [Theobroma cacao]
Length=476

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MN RFIAADTLQKII+LVVL  W  +SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNDPYSMNFRFIAADTLQKIIVLVVLAVWTKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFP  166



>ref|XP_007028296.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOY08798.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=594

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKII+LVVL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP
Sbjct  121  LKGMYGENSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFP  166



>gb|KJB46196.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=576

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNL+FIAADTLQK+I+LV+L  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFP  166



>ref|XP_007028297.1| Auxin efflux carrier family protein isoform 3 [Theobroma cacao]
 gb|EOY08799.1| Auxin efflux carrier family protein isoform 3 [Theobroma cacao]
Length=595

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKII+LVVL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP
Sbjct  121  LKGMYGENSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFP  166



>gb|AIF28391.1| PIN-like protein, partial [Thujopsis dolabrata]
Length=680

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI W DLY V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MIGWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP++MN+RFIAAD+LQKII+LVVL  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGMWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFP  166



>gb|KJB46194.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=585

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNL+FIAADTLQK+I+LV+L  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFP  166



>gb|AIF28389.1| PIN-like protein, partial [Papuacedrus papuana]
Length=537

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITW DLY V+TAVVPLYVAMI+AYGSV+WWKIF+P+QCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITWRDLYHVMTAVVPLYVAMIMAYGSVKWWKIFSPEQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNP++MN+RFIAAD+LQK+I+LVV+  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKVIVLVVVGAWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI++QFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIIDQFP  166



>gb|AIF28395.1| PIN-like protein, partial [Taxus baccata]
Length=608

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY V+TAVVPLYVAMILA+GSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDLYHVMTAVVPLYVAMILAFGSVRWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MNLRFIAADTLQKII++VVL  WA +S+ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPYQMNLRFIAADTLQKIIVVVVLGTWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP
Sbjct  121  LKGMYGASSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFP  166



>ref|XP_010271843.1| PREDICTED: probable auxin efflux carrier component 1b [Nelumbo 
nucifera]
Length=608

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKI+ L VL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIMALTVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFP  166



>gb|AIF28415.1| PIN-like protein, partial [Juniperus scopulorum]
Length=243

 Score =   281 bits (720),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITAKDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NN Y MN RFIAAD+LQK I+L+VL  WA   KNGSLEW IT+F+LSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKGIVLLVLGIWAQFGKNGSLEWMITLFALSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQVVVLQ +IWYTL++ LFEYRGAK+LIMEQFP
Sbjct  121  LKGMYGEFSGSLMVQVVVLQSVIWYTLMMVLFEYRGAKILIMEQFP  166



>ref|NP_001275530.1| auxin efflux carrier component 1-like [Cucumis sativus]
 dbj|BAC41319.1| PIN1-like auxin transport protein [Cucumis sativus]
 gb|KGN64175.1| hypothetical protein Csa_1G042820 [Cucumis sativus]
Length=617

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L VL  W+N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLAVLAVWSNISKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>ref|NP_001234204.1| auxin efflux facilitator SlPIN7 [Solanum lycopersicum]
 gb|ADR30408.1| auxin efflux facilitator SlPIN7 [Solanum lycopersicum]
Length=586

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITVSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQK+I+LVVL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>ref|XP_009803280.1| PREDICTED: auxin efflux carrier component 1-like [Nicotiana sylvestris]
Length=592

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQKII+L VL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKIIVLFVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>gb|AGG79241.1| auxin efflux facilitator PIN9 [Nicotiana tabacum]
Length=592

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQK+I+L VL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLFVLAIWSRMSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>ref|XP_006339260.1| PREDICTED: auxin efflux carrier component 1-like [Solanum tuberosum]
Length=587

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITVSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQK+I+LVVL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>gb|AIF28280.1| PIN-like protein, partial [Sabal bermudana]
Length=380

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITPSDFYNVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAADTLQK++ML +L  W+N+S+ G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYRMNLRFIAADTLQKLMMLAILTVWSNVSRRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAK+LI EQFP
Sbjct  121  LKGMYGGDSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKLLITEQFP  166



>gb|AIF28383.1| PIN-like protein, partial [Manoao colensoi]
Length=161

 Score =   278 bits (711),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  138  DLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFISSNNPY  317
            D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFISSN+P+
Sbjct  1    DFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISSNDPF  60

Query  318  EMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPLLIAMY  497
            +MNLRFIAADTLQK+I+L VL  WA +S+ G+LEW IT+FSLSTLPNTLVMGIPLL  MY
Sbjct  61   KMNLRFIAADTLQKLIVLAVLGLWAKMSRRGNLEWMITLFSLSTLPNTLVMGIPLLKGMY  120

Query  498  GEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            G  SGSLMVQ+VVLQCIIWYTL+LFLFEYR AKMLIM+QFP
Sbjct  121  GANSGSLMVQIVVLQCIIWYTLMLFLFEYRAAKMLIMDQFP  161



>gb|AIF28381.1| PIN-like protein, partial [Prumnopitys andina]
Length=658

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNP++MNLRFIAADTLQKII+LVVL  WA LS+ G+LEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPFKMNLRFIAADTLQKIIVLVVLGLWAKLSRRGNLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SG+LMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP
Sbjct  121  LKGMYGPSSGTLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFP  166



>ref|XP_008464398.1| PREDICTED: probable auxin efflux carrier component 1c [Cucumis 
melo]
Length=616

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L VL  W+N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLAVLAVWSNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>gb|AIF28305.1| PIN-like protein, partial [Platanus occidentalis]
Length=589

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISGTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKII+LVVL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP
Sbjct  121  LKGMYGDSSGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFP  166



>ref|XP_009602422.1| PREDICTED: auxin efflux carrier component 1-like [Nicotiana tomentosiformis]
Length=592

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQK+I+L VL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLFVLAIWSRMSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>emb|CDO98348.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLVDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQKII+L VL  W  +SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNLRFIAADTLQKIIVLAVLAVWTKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFP  166



>ref|XP_011084207.1| PREDICTED: probable auxin efflux carrier component 1c [Sesamum 
indicum]
Length=599

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITSSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+++L +L  WAN+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLMVLAILAVWANVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SG+LMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGALMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>gb|KJB53042.1| hypothetical protein B456_008G290000 [Gossypium raimondii]
Length=604

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQKII+LVVL  W+ +SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNFRFIAADTLQKIIVLVVLAIWSKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFP  166



>ref|XP_008775284.1| PREDICTED: probable auxin efflux carrier component 3a isoform 
X1 [Phoenix dactylifera]
Length=646

 Score =   293 bits (751),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MITWHDLY VLTAVVPLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN RFIAADTLQK+I+L  L  W  LS  GSL W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALAAWTRLSSRGSLNWAITVFSLATLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFP  166



>gb|AIF28376.1| PIN-like protein, partial [Thuja plicata]
Length=679

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISPKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNL+FIAADTLQK+IML VL  W   +++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNLKFIAADTLQKLIMLFVLGIWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFP  166



>gb|KJB46195.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
 gb|KJB46197.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=581

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNL+FIAADTLQK+I+LV+L  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFP  166



>ref|XP_006341527.1| PREDICTED: auxin efflux carrier component 1-like [Solanum tuberosum]
Length=614

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN+RFIAADTLQK+I+L VL  WAN+SK GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGVLAVWANVSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFP  166



>gb|AAQ14257.1|AF247004_1 auxin efflux carrier [Momordica charantia]
Length=607

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISLLDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L VL  W+N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLAVLAVWSNISKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>gb|KDP28042.1| hypothetical protein JCGZ_19719 [Jatropha curcas]
Length=592

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISLTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQKII+LVVL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIVLVVLAVWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARILIGEQFP  166



>ref|XP_006490772.1| PREDICTED: probable auxin efflux carrier component 1c-like [Citrus 
sinensis]
 gb|KDO63826.1| hypothetical protein CISIN_1g007420mg [Citrus sinensis]
Length=604

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLADFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY+MNLRFIAADTLQKII+LVVL  W+ LSK G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNDPYKMNLRFIAADTLQKIIVLVVLAIWSKLSKRGCLEWTITLFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFP  166



>gb|AIF28262.1| PIN-like protein, partial [Lepidosperma gibsonii]
Length=631

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGQDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY+MNL+FIAADTLQK+++L +L  W+NLS+ GSLEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNNPYKMNLKFIAADTLQKLMVLAILTAWSNLSRRGSLEWTITLFSVSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAK+LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKLLITEQFP  166



>gb|AGV28593.1| auxin efflux carrier 1a [Oryza sativa Indica Group]
Length=593

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WW+IFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGADFYHVMTAMVPLYVAMILAYGSVKWWRIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L +L  W++LS+ GSLEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLALLTLWSHLSRRGSLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARILITEQFP  166



>ref|NP_001234163.1| auxin efflux facilitator SlPIN1 [Solanum lycopersicum]
 gb|ADR30406.1| auxin efflux facilitator SlPIN1 [Solanum lycopersicum]
Length=611

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L VL  WAN+SK GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYAMNLRFIAADTLQKLIVLGVLAVWANVSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA++LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFP  166



>dbj|BAH47609.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=582

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITSSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQK+++LV L FW+ LS  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNTRFIAADTLQKLMVLVGLAFWSRLSPRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFE+RGA++LI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEFRGARLLIAEQFP  166



>gb|KHN00146.1| Auxin efflux carrier component 1 [Glycine soja]
Length=601

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPYEMN RFIAADTLQK+I+LVVL  WAN+SK G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNNPYEMNFRFIAADTLQKMIVLVVLGIWANVSKRGCLEWTITLFSISTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFP  166



>gb|AIF28295.1| PIN-like protein, partial [Nuphar advena]
Length=633

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITVSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAADTLQK+I+L VL  WAN+S+ G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKLIVLGVLGVWANVSRRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGEYSGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGEYSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLITEQFP  166



>ref|NP_001267515.1| uncharacterized protein LOC100786572 [Glycine max]
 gb|AGJ95055.1| PIN5 [Glycine max]
Length=603

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPYEMN RFIAADTLQK+I+LVVL  WAN+SK G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   SNNPYEMNFRFIAADTLQKMIVLVVLGIWANVSKRGCLEWTITLFSISTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFP  166



>gb|AIF28369.1| PIN-like protein, partial [Manoao colensoi]
Length=649

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MISGKDLYTVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MN +FIAADTLQK+IML VL  W + +K+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTSCTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP
Sbjct  121  LKAMYGGESGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFP  166



>emb|CAJ84441.1| auxin efflux carrier [Lupinus albus]
Length=606

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLIDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY+MNLRF+AADTLQKII+LVVL  W+N++K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYKMNLRFLAADTLQKIIVLVVLAIWSNVTKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>ref|XP_006376716.1| hypothetical protein POPTR_0012s04470g [Populus trichocarpa]
 gb|ERP54513.1| hypothetical protein POPTR_0012s04470g [Populus trichocarpa]
Length=540

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  D Y V+TA+VPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISLLDFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY+MN RFIAADTLQKII+LVVL FW   SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYKMNFRFIAADTLQKIIVLVVLAFWTMFSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+YSGSLMVQVVVLQCIIWYTL+LFLFEYRGAK+LI EQFP
Sbjct  121  LKGMYGDYSGSLMVQVVVLQCIIWYTLMLFLFEYRGAKLLISEQFP  166



>dbj|BAJ97950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WW IFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDFYHVMTAVVPLYVAMILAYGSVKWWGIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK++ML +L  W++LS+ GSLEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLMMLAMLTAWSHLSRRGSLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLITEQFP  166



>gb|AGJ95058.1| PIN4b [Glycine max]
 gb|KHN43633.1| Auxin efflux carrier component 1 [Glycine soja]
Length=605

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPYEMNLRF+AADTLQKII+LV+L  W+N++K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYEMNLRFLAADTLQKIIILVLLAVWSNITKRGCLEWAITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFE+RGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEFRGARMLISEQFP  166



>ref|NP_001057227.1| Os06g0232300 [Oryza sativa Japonica Group]
 sp|Q67UL3.1|PIN1C_ORYSJ RecName: Full=Probable auxin efflux carrier component 1c; AltName: 
Full=OsPIN1c [Oryza sativa Japonica Group]
 dbj|BAD38156.1| putative auxin transporter [Oryza sativa Japonica Group]
 dbj|BAF19141.1| Os06g0232300 [Oryza sativa Japonica Group]
 dbj|BAG95954.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80279.1| hypothetical protein OsI_22273 [Oryza sativa Indica Group]
 tpd|FAA00678.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group]
 gb|AGV28595.1| auxin efflux carrier 1d [Oryza sativa Indica Group]
Length=592

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WW+IFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGADFYHVMTAMVPLYVAMILAYGSVKWWRIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+I+L +L  W++LS+ GSLEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLALLTLWSHLSRRGSLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARILITEQFP  166



>ref|XP_009783366.1| PREDICTED: probable auxin efflux carrier component 1c [Nicotiana 
sylvestris]
Length=610

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN+RFIAADTLQK+I+L  L  WAN SK GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGALAIWANFSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARMLISEQFP  166



>gb|EYU24143.1| hypothetical protein MIMGU_mgv1a003175mg [Erythranthe guttata]
Length=603

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLGDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MNLRFIAADTLQK+I+L VL  WAN SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIVLAVLAVWANFSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SG+LMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGNLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFP  166



>gb|AIF28257.1| PIN-like protein, partial [Hakea drupacea]
Length=535

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLLDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +N+PY MNLRFIAADTLQK+I+L VL  W+N+SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNLRFIAADTLQKLIVLAVLFVWSNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SG+LMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGDFSGALMVQIVVLQCIIWYTLMLFMFEYRGAKMLITEQFP  166



>gb|AGG79244.1| auxin efflux facilitator PIN1b [Nicotiana tabacum]
Length=610

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN+RFIAADTLQK+I+L  L  WAN SK GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGALAIWANFSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARMLISEQFP  166



>gb|AIF28382.1| PIN-like protein, partial [Dacrycarpus compactus]
Length=576

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNP++MNLRFIAADTLQK+I+L+VL  WA +S+ G+LEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPFKMNLRFIAADTLQKLIVLMVLGLWAKVSRRGNLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP
Sbjct  121  LKGMYGTDSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFP  166



>gb|AIF28417.1| PIN-like protein, partial [Torreya taxifolia]
Length=306

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VL+AVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITAKDLYNVLSAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NN Y MN RFIAAD+LQK I+L+VL  W    KNGSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKAIILLVLGTWTQFGKNGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQVVVLQ +IWYTL++FLFEYRGAKMLI EQFP
Sbjct  121  LRGMYGEFSGSLMVQVVVLQSVIWYTLMIFLFEYRGAKMLISEQFP  166



>ref|XP_009391391.1| PREDICTED: probable auxin efflux carrier component 1c [Musa acuminata 
subsp. malaccensis]
Length=642

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLADFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPYEMN+RFIAADTLQK+++L VL  W  LS+ GSLEW+ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNMRFIAADTLQKLMVLAVLAAWCRLSRRGSLEWTITIFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG YSG+LMVQ+VVLQCIIWYTL+LFLFEYR A+MLI EQFP
Sbjct  121  LKGMYGSYSGTLMVQIVVLQCIIWYTLMLFLFEYRAARMLISEQFP  166



>gb|EYU18610.1| hypothetical protein MIMGU_mgv1a003446mg [Erythranthe guttata]
Length=584

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISLTDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN RFIAADTLQK+I+L VL  W+  S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKLIVLAVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGENSGTLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>gb|AIF28418.1| PIN-like protein, partial [Amentotaxus argotaenia]
Length=391

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VL+AVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITAKDLYNVLSAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NN Y MN RFIAAD+LQK I+L+VL  W    K+GSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKAIILLVLGTWTQFGKSGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQVVVLQ +IWYTL+LFLFEYRGAKMLIMEQFP
Sbjct  121  LKGMYGEFSGSLMVQVVVLQSVIWYTLMLFLFEYRGAKMLIMEQFP  166



>dbj|BAH47608.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=590

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY+MNLRFIAADTLQK+++L  L  W+NLSK GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYKMNLRFIAADTLQKLVVLAALAVWSNLSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LFLFE+R A+MLI EQFP
Sbjct  121  LKGMYGGESGSLMVQIVVLQCIIWYTLMLFLFEFRAARMLISEQFP  166



>ref|XP_009609779.1| PREDICTED: probable auxin efflux carrier component 1b [Nicotiana 
tomentosiformis]
Length=592

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SNNPY MN +FIAADTLQK+I+LVVL  W+ +S  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYKFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFP  166



>gb|AIF28308.1| PIN-like protein, partial [Maranta leuconeura]
Length=283

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MI+  DLY VLTAVVPLYVAMILAYGSV+WW+IF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MISAGDLYHVLTAVVPLYVAMILAYGSVKWWRIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MN RFIAAD+LQK+I L VL  WA LS  G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADSLQKVIALAVLAAWAKLSVRGCLEWAITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQ+VVLQCI+WYTL+LFLFE+RGA++LIMEQFP
Sbjct  121  LKGMYGPDSGSLMVQIVVLQCIVWYTLMLFLFEFRGARLLIMEQFP  166



>gb|AIF28411.1| PIN-like protein, partial [Torreya taxifolia]
Length=279

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  DLY VLTAVVPLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFIS
Sbjct  1    MITAKDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NN Y MN RFIAAD+LQK+I+L+VL  W    K+GSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKVIILLVLGTWTQFGKSGSLEWLITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG  SGSLMVQVVVLQ +IWYTL+L LFEYRGAKMLIMEQFP
Sbjct  121  LKGMYGASSGSLMVQVVVLQSVIWYTLMLVLFEYRGAKMLIMEQFP  166



>ref|XP_007036846.1| Auxin efflux facilitator isoform 1 [Theobroma cacao]
 gb|EOY21347.1| Auxin efflux facilitator isoform 1 [Theobroma cacao]
Length=606

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TA+VPLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            SN+PY MN RFIAADTLQKII+LVVL  W  +SK G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNDPYSMNFRFIAADTLQKIIVLVVLAVWTKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFP  166



>ref|XP_008646250.1| PREDICTED: auxin efflux carrier component 1 [Zea mays]
 gb|ABH09243.1| putative auxin efflux carrier [Zea mays]
 gb|AFW73387.1| putative auxin efflux carrier [Zea mays]
Length=595

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  302
            MIT  D Y V+TAVVPLYVAMILAYGSVRWW+IF+PDQCSGINRFVA+FAVPLLSFHFIS
Sbjct  1    MITGTDFYHVMTAVVPLYVAMILAYGSVRWWRIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  303  SNNPYEMNLRFIAADTLQKIIMLVVLCFWANLSKNGSLEWSITIFSLSTLPNTLVMGIPL  482
            +NNPY MNLRFIAADTLQK+++L +L  W++LS+ GSLEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLMVLAMLTAWSHLSRRGSLEWTITLFSLSTLPNTLVMGIPL  120

Query  483  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP  620
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLITEQFP  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950