BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS102C11

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849  72.8    2e-11   Nicotiana sylvestris
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193  66.2    2e-09   Nicotiana tomentosiformis
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214  61.6    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174  61.2    1e-07   Solanum lycopersicum
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg           60.8    1e-07   Citrus clementina [clementine]
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551  60.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509  60.5    2e-07   Solanum lycopersicum
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                 60.1    2e-07   Citrus sinensis [apfelsine]
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695  60.1    2e-07   Populus euphratica
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g           59.7    3e-07   
ref|XP_006378261.1|  hypothetical protein POPTR_0010s060502g          58.9    4e-07   
gb|KDP26703.1|  hypothetical protein JCGZ_17861                       58.2    9e-07   Jatropha curcas
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...  56.6    3e-06   Solanum lycopersicum
gb|ADN32812.1|  sieve element occlusion c                             56.6    4e-06   Solanum phureja [chaucha]
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329  56.2    4e-06   Solanum tuberosum [potatoes]
gb|ADN32811.1|  sieve element occlusion b                             53.9    3e-05   Solanum phureja [chaucha]
gb|KJB75974.1|  hypothetical protein B456_012G066300                  53.5    4e-05   Gossypium raimondii
emb|CAN65891.1|  hypothetical protein VITISV_041167                   53.1    4e-05   Vitis vinifera
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366  53.1    4e-05   Vitis vinifera
gb|KHN29013.1|  hypothetical protein glysoja_008348                   53.1    4e-05   Glycine soja [wild soybean]
emb|CBI14908.3|  unnamed protein product                              53.1    4e-05   Vitis vinifera
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g           53.1    4e-05   
ref|NP_001240968.1|  uncharacterized protein LOC100799626             53.1    5e-05   Glycine max [soybeans]
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g           53.1    5e-05   Phaseolus vulgaris [French bean]
gb|KHG12713.1|  hypothetical protein F383_04328                       52.4    7e-05   Gossypium arboreum [tree cotton]
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...  51.6    1e-04   Populus euphratica
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...  51.6    1e-04   Populus euphratica
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g           51.6    1e-04   
emb|CBI34823.3|  unnamed protein product                              51.6    1e-04   Vitis vinifera
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...  51.6    1e-04   Solanum lycopersicum
emb|CAN62582.1|  hypothetical protein VITISV_034667                   51.6    2e-04   Vitis vinifera
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g           51.6    2e-04   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g           51.6    2e-04   
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652  51.2    2e-04   Populus euphratica
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392  51.2    2e-04   Vitis vinifera
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310  51.2    2e-04   Populus euphratica
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161  51.2    2e-04   Populus euphratica
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g           50.8    3e-04   Populus trichocarpa [western balsam poplar]
gb|KJB75975.1|  hypothetical protein B456_012G066400                  50.8    3e-04   Gossypium raimondii
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991  50.4    4e-04   Populus euphratica
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294  50.1    5e-04   Vitis vinifera
emb|CBI34821.3|  unnamed protein product                              50.1    6e-04   Vitis vinifera
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167  49.7    6e-04   Vitis vinifera
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666  49.7    7e-04   Populus euphratica



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  512
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  82   INPRTTNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRAP  140

Query  513  AAIPGHVQTILTQPARLDAILEEKVLHSGL  602
            AAIPGH+     Q A L+A LEEKV HSGL
Sbjct  141  AAIPGHLHGGQAQ-AHLEA-LEEKVPHSGL  168



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAN  512
            +NP    R +  RRGD  L  +S+D  MM H+  TH  D   + VKPLLH IEDI+ RA 
Sbjct  76   INPRTPNR-IHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVHRA-  133

Query  513  AAIPGHVQTILTQPARLDAILEEKVLHSGL  602
             AIPGH+     Q A L+A LEEKV HSGL
Sbjct  134  PAIPGHLHGGQAQ-AHLEA-LEEKVPHSGL  161



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +3

Query  378  RGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQ  551
            RGD  L +SS+DTTM++ +RATH  D     V+PL H+IEDI  RA   IPG  Q    +
Sbjct  14   RGDRHLFSSSDDTTMLNQLRATHAPDGRDIDVRPLFHIIEDIFHRAAPTIPGSNQG--AE  71

Query  552  PARLDAILEEKVLHSG  599
            P  LDA L++K L +G
Sbjct  72   P-HLDA-LDDKTLQAG  85



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +3

Query  366  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  93   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  151

Query  540  ILTQPARLDAILEEKVLHSGL  602
               Q A L+A LEEK  HSGL
Sbjct  152  AKVQ-AHLEA-LEEKAPHSGL  170



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +3

Query  351  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  530
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  531  VQTILTQPARLDAILEEKVLHSGL  602
            +Q   TQ A+LD +L++K   SG 
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGF  86



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +3

Query  351  PAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGH  530
            PAGR        + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG 
Sbjct  12   PAGR-----ERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGF  66

Query  531  VQTILTQPARLDAILEEKVLHSGL  602
            +Q   TQ A+LD +L++K   SG 
Sbjct  67   IQE--TQ-AQLD-VLDDKAFQSGF  86



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +3

Query  366  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            L +RRGD  +  +S+D TMM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  86   LPHRRGDHRMFLASDDNTMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRAT-PIAGHVHE  144

Query  540  ILTQPARLDAILEEKVLHSGL  602
               Q A L A L+EK  HSGL
Sbjct  145  AKVQ-AHLQA-LDEKAPHSGL  163



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  554
            R   + A+S+D  M+  V+ATH  D   + VKPLL++IEDI  RA  + PG +Q   TQ 
Sbjct  15   RERHMFATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFPGFIQE--TQ-  71

Query  555  ARLDAILEEKVLHSGL  602
            A+LD +L++K   SG 
Sbjct  72   AQLD-VLDDKAFQSGF  86



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  548
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  549  QPARLDAILEEKVLHSGL  602
              A+LD  LEEK L +G 
Sbjct  70   HQAQLDE-LEEKALQNGF  86



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  548
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  10   RERSMFSSSDDTAMMKQIQATHAPDGREFPVKPLLHIVEDIFLRATPALGMTSIVQQQGA  69

Query  549  QPARLDAILEEKVLHSGL  602
              A+LD  LEEK L +G 
Sbjct  70   HQAQLDE-LEEKALQNGF  86



>ref|XP_006378261.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
 gb|ERP56058.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
Length=340

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI--PGHVQTILT  548
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+     VQ    
Sbjct  13   RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPALGMTSIVQQQGA  72

Query  549  QPARLDAILEEKVLHSGL  602
              A+LD  LEEK L +G 
Sbjct  73   HQAQLDE-LEEKALQNGF  89



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 8/76 (11%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL----TQP  554
            + +SS+D TMM  ++ATH  D   + VKPLLH++EDI  RA    P  + T++       
Sbjct  15   MFSSSDDNTMMKQIQATHAPDGREFAVKPLLHVVEDIFQRAK---PTGLATLVHHQGAHQ  71

Query  555  ARLDAILEEKVLHSGL  602
            A+LDA LEEK L +G 
Sbjct  72   AQLDA-LEEKALQNGF  86



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +3

Query  366  LRNRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            L +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV  
Sbjct  87   LPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHE  145

Query  540  ILTQPARLDAILEEKVLHSGL  602
               Q A L+A LEEK  H+ L
Sbjct  146  AKVQ-AHLEA-LEEKAPHNEL  164



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +3

Query  375  RRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILT  548
            RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V     
Sbjct  119  RRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAKV  177

Query  549  QPARLDAILEEKVLHSGL  602
            Q A L+A LEEK  HSGL
Sbjct  178  Q-AHLEA-LEEKAPHSGL  193



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (61%), Gaps = 5/79 (6%)
 Frame = +3

Query  372  NRRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +RRGD  +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I G V    
Sbjct  111  HRRGDHHMFLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAK  169

Query  546  TQPARLDAILEEKVLHSGL  602
             Q A L+A LEEK  HSGL
Sbjct  170  VQ-AHLEA-LEEKAPHSGL  186



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  375  RRGD--LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILT  548
            RRGD  +  +S+D  MM H+  TH  D   + VKPL+ +IEDI+ RA   I G V     
Sbjct  123  RRGDHHMFLTSDDNAMMRHIEETHIPDGRDFDVKPLVDIIEDIVHRA-TPIAGRVHEAKV  181

Query  549  QPARLDAILEEKVLHSGL  602
            Q A L+A LEEK  HSGL
Sbjct  182  Q-AHLEA-LEEKAPHSGL  197



>gb|KJB75974.1| hypothetical protein B456_012G066300 [Gossypium raimondii]
Length=807

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +R+ RG +L+ S+D  MM  + ATH  D   + V+PLL+L+EDI+ RA+     HV  ++
Sbjct  102  IRSDRGSMLSLSDDNVMMKQILATHAPDGREFDVRPLLNLVEDILNRASQ----HVDFLV  157

Query  546  TQPARLDAILEEKVLHS  596
                +    +EEK L +
Sbjct  158  KGTTQAQIEMEEKALQA  174



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 4/72 (6%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  566
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPXHLE  81

Query  567  AILEEKVLHSGL  602
            A LE++    GL
Sbjct  82   A-LEDRSSQDGL  92



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 4/72 (6%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  566
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  567  AILEEKVLHSGL  602
            A LE++    GL
Sbjct  82   A-LEDRSSQDGL  92



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQ  536
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ
Sbjct  9    IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ  58



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 4/72 (6%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  566
             L  S+DTTMM  ++ATH  D    +VKP++ +IEDI+  A  AI G   T+   P  L+
Sbjct  25   FLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGNPPHLE  81

Query  567  AILEEKVLHSGL  602
            A LE++    GL
Sbjct  82   A-LEDRSSQDGL  92



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAI  521
            R   + +SS+DT MM  ++ATH  D   + VKPLLH++EDI  RA  A+
Sbjct  9    RERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRAAPAL  57



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQ  536
            + ++S+DTTM  ++RATH     H  V+PLLH+++DI  RA + IPG VQ
Sbjct  16   IFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQ  65



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  384  DLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQ  536
            ++ ++S+DTTM  +VRATH  D  H +V+PLL++++DI+ R  + IP  VQ
Sbjct  15   NIFSASDDTTMTKNVRATHAPDDRHVEVRPLLNVVQDILHRVASLIPDIVQ  65



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +R  RG +L+ S+D  MM+ + ATH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  143  IRGDRGSMLSMSDDNVMMNQILATHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  202

Query  546  TQ  551
             Q
Sbjct  203  DQ  204



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT--  78

Query  546  TQPARLDAILEEK  584
               ++  A LE+K
Sbjct  79   ---SQAHAELEDK  88



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTT  78



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  546  TQPARLDAILEEK  584
               ++  A LE+K
Sbjct  79   ---SQAHAELEDK  88



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  519  I  521
            +
Sbjct  114  V  114



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +3

Query  387  LLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQPARLD  566
            +  +S+D  MM H+  TH  D   + VKPL+H+IEDI+ RA   I GHV     Q A L+
Sbjct  1    MFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRAT-PIAGHVHEAKVQ-AHLE  58

Query  567  AILEEKVLHSGL  602
            A LEEK  H+ L
Sbjct  59   A-LEEKAPHNEL  69



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  519  I  521
            +
Sbjct  114  V  114



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT  78



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT  78



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T  
Sbjct  21   IKSDRGTMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT--  78

Query  546  TQPARLDAILEEK  584
               ++  A LE+K
Sbjct  79   ---SQAHAELEDK  88



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  +  R+ R  ++  S+D  MM  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  55   INPVPLHQLTRHDR-SMITMSDDNIMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  113

Query  519  I  521
            +
Sbjct  114  V  114



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +3

Query  375  RRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTILTQP  554
            R   + A+S++  MM  ++ATH  D   + VK LLH++EDI  R  +A PG    +  Q 
Sbjct  10   RERTVFAASDENVMMKQIQATHAPDGREFSVKLLLHIVEDIFHRTTSA-PGITDFVQHQG  68

Query  555  ARLDAI--LEEKVLHSGL  602
            +    +  LEEKVL +G 
Sbjct  69   SHQAQLYELEEKVLQNGF  86



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQT  539
            ++  RG +L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + T
Sbjct  21   IKGDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTT  78



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 5/76 (7%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM+ +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMNQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTT--  78

Query  546  TQPARLDAILEEKVLH  593
               ++  A +E+K  H
Sbjct  79   ---SKAHAEMEDKTYH  91



>gb|KJB75975.1| hypothetical protein B456_012G066400 [Gossypium raimondii]
Length=865

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +R  RG +L+ S+D  MM+ +  TH  D   + V+PLL+L+EDI+ RA   +   V+  L
Sbjct  161  IRGDRGSMLSMSDDNVMMNQILTTHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGTL  220

Query  546  TQ  551
             Q
Sbjct  221  DQ  222



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 5/76 (7%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQ  80

Query  546  TQPARLDAILEEKVLH  593
             Q     A +E+K  H
Sbjct  81   AQ-----AEMEDKTYH  91



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  41   INPVPLQKLIKHDR-SMITMSDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  99

Query  519  I  521
            +
Sbjct  100  V  100



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  78   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  136

Query  519  I  521
            +
Sbjct  137  V  137



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +3

Query  339  VNPIPAGRYLRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAA  518
            +NP+P  + +++ R  ++  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   
Sbjct  32   INPVPLQQLIKHDR-SMITMSDDNIMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPG  90

Query  519  I  521
            +
Sbjct  91   V  91



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query  366  LRNRRGDLLASSEDTTMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRANAAIPGHVQTIL  545
            +++ RG +L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + T  
Sbjct  21   IKSDRGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTS-  79

Query  546  TQPARLDAILEEKVLH  593
              PA ++   E+K  H
Sbjct  80   QAPAEME---EDKTYH  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370