BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS101G10

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13052.1|  unnamed protein product                                384   3e-121   Coffea canephora [robusta coffee]
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    377   8e-119   Sesamum indicum [beniseed]
ref|XP_002277547.1|  PREDICTED: ABC transporter B family member 2       376   1e-118   Vitis vinifera
ref|XP_003628784.1|  ABC transporter B family member                    357   1e-118   
gb|KJB21122.1|  hypothetical protein B456_003G183800                    370   2e-118   Gossypium raimondii
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    374   1e-117   Nicotiana tomentosiformis
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    374   2e-117   Nicotiana sylvestris
ref|XP_010096959.1|  ABC transporter B family member 2                  367   2e-117   
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    372   3e-117   Cicer arietinum [garbanzo]
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             373   3e-117   Prunus persica
gb|KJB21123.1|  hypothetical protein B456_003G183800                    371   6e-117   Gossypium raimondii
ref|XP_007040642.1|  Multidrug/pheromone exporter, MDR family, AB...    369   7e-117   
gb|KJB21124.1|  hypothetical protein B456_003G183800                    371   1e-116   Gossypium raimondii
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    371   1e-116   Glycine max [soybeans]
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    371   1e-116   Prunus mume [ume]
gb|AAF23176.1|AF216497_1  P-glycoprotein                                371   1e-116   Gossypium hirsutum [American cotton]
gb|KJB21121.1|  hypothetical protein B456_003G183800                    371   2e-116   Gossypium raimondii
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             370   3e-116   Phaseolus vulgaris [French bean]
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    370   3e-116   Fragaria vesca subsp. vesca
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    370   4e-116   
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    369   8e-116   Pyrus x bretschneideri [bai li]
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    369   8e-116   
ref|XP_003612850.1|  ABC transporter B family member                    368   1e-115   Medicago truncatula
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    368   1e-115   Glycine max [soybeans]
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                369   1e-115   Erythranthe guttata [common monkey flower]
gb|KHN38940.1|  ABC transporter B family member 2                       366   4e-115   Glycine soja [wild soybean]
gb|EPS64351.1|  hypothetical protein M569_10429                         364   3e-114   Genlisea aurea
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    363   6e-114   Camelina sativa [gold-of-pleasure]
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    363   6e-114   Solanum tuberosum [potatoes]
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    363   7e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB51627.1|  hypothetical protein B456_008G225400                    363   1e-113   Gossypium raimondii
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             362   2e-113   Eutrema salsugineum [saltwater cress]
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    362   2e-113   Solanum lycopersicum
ref|XP_002527657.1|  multidrug resistance protein 1, 2, putative        360   2e-113   
ref|XP_002869639.1|  multidrug resistance protein 2                     362   2e-113   
ref|XP_010538383.1|  PREDICTED: ABC transporter B family member 2...    362   3e-113   Tarenaya hassleriana [spider flower]
emb|CAA71277.1|  P-glycoprotein-2                                       362   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KHN30010.1|  ABC transporter B family member 2                       362   3e-113   Glycine soja [wild soybean]
gb|AAM20507.1|  P-glycoprotein-2                                        362   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             362   3e-113   
ref|XP_006385671.1|  hypothetical protein POPTR_0003s09320g             356   3e-113   
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             362   3e-113   Phaseolus vulgaris [French bean]
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      361   3e-113   Camelina sativa [gold-of-pleasure]
ref|NP_194326.2|  P-glycoprotein 2                                      362   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892589.1|  P-glycoprotein 10                                  360   1e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_010055294.1|  PREDICTED: ABC transporter B family member 2...    360   2e-112   Eucalyptus grandis [rose gum]
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    359   2e-112   Elaeis guineensis
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    359   2e-112   Populus euphratica
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             358   4e-112   Capsella rubella
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    358   4e-112   Arabis alpina [alpine rockcress]
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    358   4e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    358   5e-112   Citrus sinensis [apfelsine]
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       358   5e-112   Brassica rapa
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    358   7e-112   Populus euphratica
emb|CDX94395.1|  BnaC01g17890D                                          358   8e-112   
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             357   9e-112   Eutrema salsugineum [saltwater cress]
emb|CDX89380.1|  BnaA01g15130D                                          358   1e-111   
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    357   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    357   2e-111   Phoenix dactylifera
ref|XP_002304346.1|  P-glycoprotein                                     357   2e-111   Populus trichocarpa [western balsam poplar]
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       355   8e-111   Cucumis sativus [cucumbers]
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    355   1e-110   Cucumis melo [Oriental melon]
ref|NP_172538.1|  ABC transporter B family member 10                    354   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    354   2e-110   Nelumbo nucifera [Indian lotus]
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    353   5e-110   Arabis alpina [alpine rockcress]
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          352   1e-109   Amborella trichopoda
emb|CDX92739.1|  BnaC07g39970D                                          352   1e-109   
emb|CDX93393.1|  BnaA06g06550D                                          352   1e-109   
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      351   2e-109   Brassica rapa
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    351   3e-109   Nelumbo nucifera [Indian lotus]
gb|KHN04865.1|  ABC transporter B family member 2                       350   9e-109   Glycine soja [wild soybean]
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    350   1e-108   Glycine max [soybeans]
emb|CDY37953.1|  BnaC05g08210D                                          349   1e-108   Brassica napus [oilseed rape]
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    349   2e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    349   2e-108   Brachypodium distachyon [annual false brome]
gb|EEC73824.1|  hypothetical protein OsI_08549                          348   6e-108   Oryza sativa Indica Group [Indian rice]
ref|NP_001047803.1|  Os02g0693700                                       347   6e-108   
emb|CDY42770.1|  BnaA03g47690D                                          346   6e-108   Brassica napus [oilseed rape]
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    347   1e-107   Setaria italica
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    346   3e-107   Oryza brachyantha
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          345   7e-107   Sorghum bicolor [broomcorn]
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    344   9e-107   
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    343   3e-106   Brassica rapa
ref|XP_011018529.1|  PREDICTED: ABC transporter B family member 2...    341   1e-105   Populus euphratica
gb|AAF17668.1|AC009398_17  F20B24.12                                    338   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509740.1|  PREDICTED: ABC transporter B family member 2...    333   1e-103   
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    334   3e-103   Cicer arietinum [garbanzo]
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    327   1e-100   
gb|EMT33461.1|  ABC transporter B family member 2                       327   4e-100   
ref|XP_002299180.2|  P-glycoprotein                                     320   7e-98    
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       310   1e-94    
gb|ABG75919.1|  MDR-like ABC transporter                                310   2e-94    Ginkgo biloba [ginkgo]
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    303   4e-92    Elaeis guineensis
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    298   3e-90    Phoenix dactylifera
ref|XP_006368377.1|  P-glycoprotein                                     292   4e-88    
ref|XP_004165322.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    286   3e-86    
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    261   7e-77    
ref|XP_002973102.1|  ATP-binding cassette transporter                   250   4e-73    
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             250   6e-73    
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             249   1e-72    
ref|XP_002965566.1|  ATP-binding cassette transporter                   249   2e-72    
ref|XP_011018527.1|  PREDICTED: ABC transporter B family member 2...    243   1e-70    Populus euphratica
ref|XP_006432794.1|  hypothetical protein CICLE_v100000601mg            221   2e-69    
gb|KDO53158.1|  hypothetical protein CISIN_1g0008302mg                  221   2e-69    Citrus sinensis [apfelsine]
ref|XP_004509739.1|  PREDICTED: ABC transporter B family member 2...    238   7e-69    
ref|XP_010055295.1|  PREDICTED: ABC transporter B family member 2...    238   9e-69    
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    233   9e-67    
ref|XP_002877137.1|  P-glycoprotein 19                                  231   5e-66    Arabidopsis lyrata subsp. lyrata
gb|AAN28720.2|  MDR-like p-glycoprotein                                 229   1e-65    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41846.1|  putative P-glycoprotein                                229   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189528.1|  ABC transporter B family member 19                    229   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             229   2e-65    Capsella rubella
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    229   2e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      229   2e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    229   2e-65    Camelina sativa [gold-of-pleasure]
gb|AFW63453.1|  hypothetical protein ZEAMMB73_169648                    212   3e-65    
emb|CDP02220.1|  unnamed protein product                                228   6e-65    Coffea canephora [robusta coffee]
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      228   7e-65    Brassica rapa
emb|CDX86408.1|  BnaA06g31250D                                          228   7e-65    
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    227   1e-64    Arabis alpina [alpine rockcress]
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       227   1e-64    
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             226   2e-64    Eutrema salsugineum [saltwater cress]
ref|XP_007032498.1|  ATP binding cassette subfamily B19 isoform 2       226   2e-64    
emb|CDY65012.1|  BnaCnng45670D                                          226   2e-64    Brassica napus [oilseed rape]
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      226   2e-64    Sesamum indicum [beniseed]
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                225   6e-64    Populus trichocarpa [western balsam poplar]
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      225   6e-64    Populus euphratica
gb|KJB33609.1|  hypothetical protein B456_006G021600                    225   6e-64    Gossypium raimondii
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    224   7e-64    Sesamum indicum [beniseed]
ref|XP_004173028.1|  PREDICTED: ABC transporter B family member 1...    222   7e-64    
gb|KHG20565.1|  ABC transporter B family member 19                      224   8e-64    Gossypium arboreum [tree cotton]
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    224   9e-64    
emb|CBI22189.3|  unnamed protein product                                223   1e-63    Vitis vinifera
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      224   1e-63    Tarenaya hassleriana [spider flower]
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    224   1e-63    Citrus sinensis [apfelsine]
gb|KDP36504.1|  hypothetical protein JCGZ_09330                         223   1e-63    Jatropha curcas
emb|CDY00109.1|  BnaC09g01920D                                          224   1e-63    
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   224   1e-63    Citrus sinensis [apfelsine]
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             224   1e-63    Citrus clementina [clementine]
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    224   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11390.1|  hypothetical protein B456_001G256100                    224   2e-63    Gossypium raimondii
gb|KHG22495.1|  ABC transporter B family member 19                      223   2e-63    Gossypium arboreum [tree cotton]
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      223   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          223   2e-63    Amborella trichopoda
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      223   2e-63    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        223   2e-63    Ricinus communis
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    223   3e-63    Brassica rapa
emb|CDY20012.1|  BnaA09g02390D                                          223   3e-63    Brassica napus [oilseed rape]
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    223   3e-63    Tarenaya hassleriana [spider flower]
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3       223   3e-63    
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      223   4e-63    Vitis vinifera
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             223   4e-63    Prunus persica
gb|KHN45492.1|  ABC transporter B family member 19                      222   4e-63    Glycine soja [wild soybean]
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      223   4e-63    Prunus mume [ume]
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      222   5e-63    
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    222   5e-63    Glycine max [soybeans]
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             222   6e-63    Eutrema salsugineum [saltwater cress]
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      222   7e-63    Cucumis melo [Oriental melon]
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    222   7e-63    Glycine max [soybeans]
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    222   8e-63    
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        222   8e-63    Ricinus communis
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       222   9e-63    
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    221   9e-63    Cicer arietinum [garbanzo]
emb|CDX84896.1|  BnaC05g21590D                                          220   9e-63    
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    221   1e-62    Arabis alpina [alpine rockcress]
ref|NP_001234209.1|  L04                                                221   1e-62    Solanum lycopersicum
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    221   1e-62    
gb|ABX82929.1|  LO4                                                     221   1e-62    Solanum pennellii
gb|KEH24996.1|  ABC transporter B family protein                        221   1e-62    Medicago truncatula
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    221   1e-62    Solanum tuberosum [potatoes]
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     221   1e-62    Eucalyptus grandis [rose gum]
ref|XP_010108971.1|  ABC transporter B family member 19                 221   1e-62    Morus notabilis
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      221   1e-62    Eucalyptus grandis [rose gum]
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 19      221   2e-62    Fragaria vesca subsp. vesca
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    221   2e-62    Elaeis guineensis
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             221   2e-62    Phaseolus vulgaris [French bean]
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...    221   2e-62    Brassica rapa
ref|XP_009113724.1|  PREDICTED: ABC transporter B family member 1...    221   2e-62    Brassica rapa
ref|XP_002893495.1|  P-glycoprotein 13                                  220   2e-62    Arabidopsis lyrata subsp. lyrata
gb|AIU41631.1|  ABC transporter family protein                          221   2e-62    Hevea brasiliensis [jebe]
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      220   2e-62    Nicotiana sylvestris
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      220   3e-62    Nicotiana tomentosiformis
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      220   4e-62    Elaeis guineensis
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    219   6e-62    Camelina sativa [gold-of-pleasure]
ref|NP_174115.1|  ABC transporter B family member 13                    219   6e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054045.1|  Os04g0642000                                       214   7e-62    
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         219   8e-62    Jatropha curcas
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        219   9e-62    Lactuca sativa [cultivated lettuce]
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...    218   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    218   1e-61    Tarenaya hassleriana [spider flower]
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      218   2e-61    Nelumbo nucifera [Indian lotus]
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    218   2e-61    Arabis alpina [alpine rockcress]
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    218   2e-61    
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      218   2e-61    Pyrus x bretschneideri [bai li]
ref|XP_002890755.1|  P-glycoprotein 14                                  218   2e-61    Arabidopsis lyrata subsp. lyrata
dbj|BAG91391.1|  unnamed protein product                                213   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    218   2e-61    Phoenix dactylifera
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg             218   2e-61    Eutrema salsugineum [saltwater cress]
ref|NP_174122.1|  ABC transporter B family member 14                    218   3e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    217   4e-61    Zea mays [maize]
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    217   4e-61    Oryza brachyantha
ref|XP_011018530.1|  PREDICTED: ABC transporter B family member 2...    216   5e-61    Populus euphratica
ref|NP_001052982.1|  Os04g0459000                                       216   6e-61    
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350          216   7e-61    Sorghum bicolor [broomcorn]
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    216   7e-61    
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    216   8e-61    
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      216   8e-61    Phoenix dactylifera
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             216   1e-60    Phaseolus vulgaris [French bean]
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         216   1e-60    Jatropha curcas
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...    216   1e-60    Setaria italica
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    215   2e-60    Brachypodium distachyon [annual false brome]
dbj|BAJ96840.1|  predicted protein                                      215   2e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    215   2e-60    Setaria italica
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          215   2e-60    Sorghum bicolor [broomcorn]
ref|NP_001169660.1|  uncharacterized protein LOC100383541               214   3e-60    Zea mays [maize]
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    214   4e-60    Prunus mume [ume]
ref|XP_010501626.1|  PREDICTED: ABC transporter B family member 1...    214   4e-60    
ref|XP_011459839.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    214   5e-60    Fragaria vesca subsp. vesca
ref|XP_009113714.1|  PREDICTED: ABC transporter B family member 14      214   5e-60    Brassica rapa
emb|CDP07374.1|  unnamed protein product                                214   5e-60    Coffea canephora [robusta coffee]
gb|EMS51604.1|  ABC transporter B family member 2                       213   6e-60    Triticum urartu
emb|CAC09461.2|  H0423H10.7                                             214   6e-60    Oryza sativa [red rice]
ref|XP_010480688.1|  PREDICTED: ABC transporter B family member 14      213   7e-60    Camelina sativa [gold-of-pleasure]
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...    213   7e-60    Brachypodium distachyon [annual false brome]
emb|CAD59582.1|  MDR-like ABC transporter                               213   7e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    213   8e-60    Glycine max [soybeans]
dbj|BAK05967.1|  predicted protein                                      213   8e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007017851.1|  P-glycoprotein 13                                  213   9e-60    
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    213   1e-59    Glycine max [soybeans]
ref|XP_002962569.1|  ATP-binding cassette transporter                   213   2e-59    
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             212   2e-59    Prunus persica
gb|EAZ32166.1|  hypothetical protein OsJ_16371                          212   2e-59    Oryza sativa Japonica Group [Japonica rice]
gb|KHN39417.1|  ABC transporter B family member 13                      212   2e-59    Glycine soja [wild soybean]
gb|KHN12634.1|  ABC transporter B family member 13                      211   3e-59    Glycine soja [wild soybean]
gb|EMT07148.1|  ABC transporter B family member 19                      211   4e-59    
gb|KJB63497.1|  hypothetical protein B456_010G002700                    211   5e-59    Gossypium raimondii
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             211   5e-59    Capsella rubella
ref|XP_010527726.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    211   5e-59    Tarenaya hassleriana [spider flower]
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    210   1e-58    Camelina sativa [gold-of-pleasure]
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    210   1e-58    
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    209   1e-58    Vitis vinifera
emb|CAN71068.1|  hypothetical protein VITISV_031708                     209   2e-58    Vitis vinifera
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    209   3e-58    Eucalyptus grandis [rose gum]
emb|CAD59581.1|  MDR-like ABC transporter                               209   4e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             208   4e-58    
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    207   7e-58    Populus euphratica
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...    207   1e-57    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32511.1|  ABC transporter B family member 19                      207   2e-57    
gb|KDO84910.1|  hypothetical protein CISIN_1g000851mg                   204   2e-57    Citrus sinensis [apfelsine]
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                206   2e-57    
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    206   2e-57    
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    205   5e-57    Citrus sinensis [apfelsine]
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          205   5e-57    
gb|KHG13479.1|  ABC transporter B family member 13                      205   7e-57    Gossypium arboreum [tree cotton]
emb|CDY27649.1|  BnaA09g27580D                                          204   7e-57    Brassica napus [oilseed rape]
gb|AFP44695.1|  hypothetical protein                                    204   1e-56    Eragrostis tef [tef]
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             204   1e-56    Citrus clementina [clementine]
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   204   1e-56    Citrus sinensis [apfelsine]
gb|AFP44681.1|  hypothetical protein                                    204   2e-56    Eragrostis tef [tef]
ref|XP_002969904.1|  ATP-binding cassette transporter                   203   3e-56    
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    203   3e-56    
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    203   3e-56    Malus domestica [apple tree]
ref|XP_004173771.1|  PREDICTED: ABC transporter B family member 1...    194   3e-56    
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg                203   4e-56    Erythranthe guttata [common monkey flower]
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             202   5e-56    
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    202   9e-56    Cicer arietinum [garbanzo]
emb|CDY18472.1|  BnaA04g21150D                                          199   1e-55    Brassica napus [oilseed rape]
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    201   2e-55    Sesamum indicum [beniseed]
emb|CBI19899.3|  unnamed protein product                                199   4e-55    Vitis vinifera
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    200   5e-55    
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       199   5e-55    Cucumis sativus [cucumbers]
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    199   5e-55    
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1       200   5e-55    Solanum lycopersicum
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       199   7e-55    Brassica rapa
ref|XP_006843046.1|  hypothetical protein AMTR_s00076p00195870          199   8e-55    Amborella trichopoda
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg                199   8e-55    Erythranthe guttata [common monkey flower]
ref|NP_001275319.1|  P-glycoprotein                                     199   9e-55    Solanum tuberosum [potatoes]
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       199   1e-54    Brassica rapa
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    198   1e-54    
ref|XP_003625677.1|  ABC transporter-like protein                       194   3e-54    
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...    197   3e-54    
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             197   3e-54    
emb|CDP06775.1|  unnamed protein product                                197   3e-54    
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...    197   4e-54    
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    197   4e-54    
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...    197   5e-54    
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1       197   5e-54    
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       197   6e-54    
ref|XP_008788471.1|  PREDICTED: ABC transporter B family member 1...    196   7e-54    
emb|CDY46744.1|  BnaA03g16880D                                          196   7e-54    
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             196   8e-54    
emb|CDX79704.1|  BnaC03g20400D                                          196   9e-54    
emb|CBI30138.3|  unnamed protein product                                195   9e-54    
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...    196   1e-53    
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       196   1e-53    
ref|NP_181228.1|  ABC transporter B family member 1                     196   1e-53    
gb|AAM98246.1|  putative ABC transporter                                196   1e-53    
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608             195   1e-53    
tpg|DAA48547.1|  TPA: hypothetical protein ZEAMMB73_189648              191   2e-53    
ref|XP_006660395.1|  PREDICTED: ABC transporter B family member 1...    196   2e-53    
ref|XP_002879630.1|  ATPGP1                                             195   2e-53    
gb|KEH42187.1|  ABC transporter B family protein                        196   2e-53    
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    196   2e-53    
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    196   2e-53    
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       195   2e-53    
ref|NP_001062529.2|  Os08g0564300                                       194   2e-53    
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    195   2e-53    
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...    195   2e-53    
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    195   3e-53    
ref|XP_010101619.1|  ABC transporter B family member 1                  194   4e-53    
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       194   5e-53    
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    194   6e-53    
gb|AAR10387.1|  P-glycoprotein 1                                        194   6e-53    
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1       194   7e-53    
ref|XP_004494063.1|  PREDICTED: ABC transporter B family member 1...    194   7e-53    
gb|AES81895.2|  ABC transporter B family protein                        194   7e-53    
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...    194   8e-53    
gb|KJB16771.1|  hypothetical protein B456_002G246800                    193   9e-53    
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    193   9e-53    
gb|EEC84043.1|  hypothetical protein OsI_30303                          193   9e-53    
gb|EEE69159.1|  hypothetical protein OsJ_28307                          193   1e-52    
ref|XP_004304461.2|  PREDICTED: ABC transporter B family member 1       193   1e-52    
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1       193   1e-52    
dbj|BAD12940.1|  putative P-glycoprotein 1                              193   1e-52    
gb|KHN09525.1|  ABC transporter B family member 1                       193   1e-52    
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...    193   1e-52    
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...    193   1e-52    
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...    193   1e-52    
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    193   1e-52    
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g             193   1e-52    
ref|XP_004974253.1|  PREDICTED: ABC transporter B family member 1...    193   1e-52    
ref|XP_002323485.2|  P glycoprotein1                                    192   2e-52    
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    192   2e-52    
dbj|BAJ99824.1|  predicted protein                                      192   2e-52    
ref|XP_010234205.1|  PREDICTED: ABC transporter B family member 1       192   2e-52    
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    192   3e-52    
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...    192   3e-52    
ref|XP_002445666.1|  hypothetical protein SORBIDRAFT_07g023730          192   4e-52    
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    191   5e-52    
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    191   5e-52    
ref|XP_008645880.1|  PREDICTED: uncharacterized protein LOC100384...    191   5e-52    
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...    191   6e-52    
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       191   7e-52    
gb|KJB36510.1|  hypothetical protein B456_006G163000                    189   8e-52    
gb|KHG25987.1|  ABC transporter B family member 1                       191   8e-52    
gb|KGN58982.1|  Multidrug resistance protein 1, 2                       189   1e-51    
gb|KHN39060.1|  ABC transporter B family member 1                       190   1e-51    
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             190   1e-51    
ref|XP_008241411.1|  PREDICTED: ABC transporter B family member 1       190   1e-51    
gb|KHN48276.1|  ABC transporter B family member 1                       189   2e-51    
gb|AAR00316.1|  PGP1                                                    190   2e-51    
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                   189   2e-51    
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                   189   2e-51    
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg             189   2e-51    
ref|XP_010095132.1|  ABC transporter B family member 9                  189   2e-51    
emb|CAD59580.1|  MDR-like ABC transporter                               189   3e-51    
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         189   3e-51    
gb|KJB36509.1|  hypothetical protein B456_006G163000                    189   3e-51    
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1       189   3e-51    
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative        189   3e-51    
gb|ABG56414.1|  MDR-like ABC transporter                                189   4e-51    
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...    189   4e-51    
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1        188   6e-51    
ref|XP_006381407.1|  P glycoprotein1                                    188   6e-51    
gb|AIU41628.1|  ABC transporter family protein                          188   9e-51    
emb|CAD40903.1|  OSJNBa0036B21.21                                       187   1e-50    
gb|EEC77398.1|  hypothetical protein OsI_16157                          187   1e-50    
gb|KHG30028.1|  ABC transporter B family member 1                       187   2e-50    
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g             187   2e-50    
ref|XP_006597506.1|  PREDICTED: ABC transporter B family member 9...    186   3e-50    
ref|XP_006597507.1|  PREDICTED: ABC transporter B family member 9...    186   3e-50    
ref|XP_003547192.1|  PREDICTED: ABC transporter B family member 9...    186   3e-50    
ref|XP_006597505.1|  PREDICTED: ABC transporter B family member 9...    186   4e-50    
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       186   4e-50    
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    186   5e-50    
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       186   5e-50    
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    185   6e-50    
gb|KGN58980.1|  Multidrug resistance protein 1, 2                       184   2e-49    
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1       184   2e-49    
ref|XP_008225385.1|  PREDICTED: ABC transporter B family member 9       183   4e-49    
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg             182   6e-49    
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...    182   8e-49    
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662             182   1e-48    
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9       181   3e-48    
ref|XP_002986365.1|  ATP-binding cassette transporter                   180   4e-48    
ref|XP_006355579.1|  PREDICTED: ABC transporter B family member 9...    180   5e-48    
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079             180   5e-48    
ref|XP_010095529.1|  ABC transporter B family member 13                 177   6e-48    
gb|AES59767.2|  ABC transporter B family protein                        179   9e-48    
emb|CDY27639.1|  BnaA09g27680D                                          179   1e-47    
ref|XP_003589516.1|  ABC transporter B family member                    179   1e-47    
gb|KHN06940.1|  ABC transporter B family member 9                       178   1e-47    
ref|XP_002969903.1|  ATP-binding cassette transporter                   178   2e-47    
ref|XP_007159375.1|  hypothetical protein PHAVU_002G233000g             177   2e-47    
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    177   3e-47    
ref|XP_010688391.1|  PREDICTED: ABC transporter B family member 1...    177   3e-47    
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...    177   3e-47    
gb|EPS68527.1|  hypothetical protein M569_06241                         169   3e-47    
ref|XP_009772017.1|  PREDICTED: ABC transporter B family member 9...    177   4e-47    
ref|XP_002519336.1|  multidrug resistance protein 1, 2, putative        177   6e-47    
ref|XP_010045610.1|  PREDICTED: ABC transporter B family member 1...    177   6e-47    
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980          176   8e-47    
gb|EYU27077.1|  hypothetical protein MIMGU_mgv1a025774mg                175   2e-46    
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g             176   2e-46    
ref|XP_002271185.1|  PREDICTED: ABC transporter B family member 9...    175   2e-46    
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g             175   2e-46    
ref|XP_009610882.1|  PREDICTED: ABC transporter B family member 9       175   2e-46    
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...    175   3e-46    
ref|XP_002519757.1|  multidrug resistance protein 1, 2, putative        175   3e-46    
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...    174   4e-46    
ref|XP_008798883.1|  PREDICTED: ABC transporter B family member 2...    174   4e-46    
gb|KDO86794.1|  hypothetical protein CISIN_1g000777mg                   174   4e-46    
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...    174   4e-46    
gb|KHN14170.1|  ABC transporter B family member 11                      174   4e-46    
gb|KDO86791.1|  hypothetical protein CISIN_1g000777mg                   174   5e-46    
ref|XP_006492413.1|  PREDICTED: ABC transporter B family member 4...    174   5e-46    
gb|KDO86793.1|  hypothetical protein CISIN_1g000777mg                   174   5e-46    
gb|KDO86792.1|  hypothetical protein CISIN_1g000777mg                   174   5e-46    
ref|XP_006444609.1|  hypothetical protein CICLE_v10018532mg             174   6e-46    
ref|XP_002872874.1|  P-glycoprotein 5                                   174   7e-46    
ref|XP_010905018.1|  PREDICTED: ABC transporter B family member 4...    174   7e-46    
ref|XP_010474667.1|  PREDICTED: ABC transporter B family member 1...    173   8e-46    
ref|XP_004233862.2|  PREDICTED: ABC transporter B family member 9...    173   9e-46    
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg                173   9e-46    
gb|AES64104.2|  ABC transporter B family-like protein                   173   9e-46    
ref|XP_010690905.1|  PREDICTED: ABC transporter B family member 1...    173   1e-45    
gb|KHG29119.1|  ABC transporter B family member 21                      173   1e-45    
emb|CBI37062.3|  unnamed protein product                                172   1e-45    
ref|XP_010457237.1|  PREDICTED: ABC transporter B family member 1...    173   1e-45    
ref|XP_010091424.1|  ABC transporter B family member 11                 173   1e-45    
ref|XP_001784127.1|  ATP-binding cassette transporter, subfamily ...    172   1e-45    
ref|XP_009417767.1|  PREDICTED: ABC transporter B family member 2...    172   1e-45    
gb|AES64094.2|  ABC transporter B family protein                        172   1e-45    
ref|XP_010457236.1|  PREDICTED: ABC transporter B family member 1...    172   1e-45    
ref|XP_004295414.1|  PREDICTED: ABC transporter B family member 9       172   2e-45    
ref|XP_010273385.1|  PREDICTED: ABC transporter B family member 9       172   2e-45    
ref|XP_002273987.1|  PREDICTED: ABC transporter B family member 11      172   2e-45    
ref|XP_009360959.1|  PREDICTED: ABC transporter B family member 9...    172   2e-45    
emb|CAN76787.1|  hypothetical protein VITISV_029557                     172   2e-45    
ref|XP_009417764.1|  PREDICTED: ABC transporter B family member 4...    172   2e-45    
gb|AES76388.2|  ABC transporter B family-like protein                   172   2e-45    
ref|XP_006577182.1|  PREDICTED: ABC transporter B family member 4...    172   2e-45    
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...    172   2e-45    
ref|XP_006577181.1|  PREDICTED: ABC transporter B family member 4...    172   2e-45    
ref|XP_003620170.1|  ABC transporter B family member                    172   2e-45    
gb|KDP28335.1|  hypothetical protein JCGZ_14106                         172   2e-45    
gb|KJB49725.1|  hypothetical protein B456_008G134900                    172   2e-45    
gb|KJB49726.1|  hypothetical protein B456_008G134900                    172   3e-45    
ref|XP_003520772.2|  PREDICTED: ABC transporter B family member 4...    172   3e-45    
ref|XP_006577180.1|  PREDICTED: ABC transporter B family member 4...    172   3e-45    
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...    172   3e-45    
ref|XP_008778177.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    171   3e-45    
ref|XP_011096468.1|  PREDICTED: ABC transporter B family member 9       172   3e-45    
ref|XP_007025208.1|  P-glycoprotein 9 isoform 1                         172   3e-45    
emb|CDP17032.1|  unnamed protein product                                172   3e-45    
ref|XP_011005823.1|  PREDICTED: ABC transporter B family member 9       171   4e-45    
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...    171   5e-45    
ref|XP_010667802.1|  PREDICTED: ABC transporter B family member 9       171   5e-45    
ref|XP_004963620.1|  PREDICTED: ABC transporter B family member 4...    171   6e-45    
ref|XP_011467146.1|  PREDICTED: ABC transporter B family member 1...    171   6e-45    
gb|KHG11900.1|  ABC transporter B family member 21                      171   7e-45    
ref|XP_007163242.1|  hypothetical protein PHAVU_001G218000g             171   7e-45    
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    170   9e-45    
ref|XP_009353526.1|  PREDICTED: ABC transporter B family member 9...    170   9e-45    
ref|XP_004969643.1|  PREDICTED: ABC transporter B family member 4...    170   1e-44    
ref|NP_192092.1|  ABC transporter B family member 5                     170   1e-44    
ref|XP_004308506.1|  PREDICTED: ABC transporter B family member 9...    170   1e-44    
ref|XP_006594001.1|  PREDICTED: ABC transporter B family member 2...    170   1e-44    
gb|KJB41715.1|  hypothetical protein B456_007G116700                    170   1e-44    
gb|KHN45006.1|  ABC transporter B family member 11                      170   1e-44    
ref|XP_010938828.1|  PREDICTED: ABC transporter B family member 2...    170   1e-44    
ref|XP_010938901.1|  PREDICTED: ABC transporter B family member 4...    170   1e-44    
ref|XP_006369863.1|  ABC transporter family protein                     170   1e-44    
ref|XP_006402405.1|  hypothetical protein EUTSA_v10005750mg             170   1e-44    
gb|KFK34765.1|  hypothetical protein AALP_AA5G190700                    170   1e-44    
ref|XP_002988773.1|  hypothetical protein SELMODRAFT_184091             170   2e-44    
ref|XP_007051281.1|  ATP binding cassette subfamily B4 isoform 1        170   2e-44    
ref|XP_011027347.1|  PREDICTED: ABC transporter B family member 20      170   2e-44    
ref|XP_009360960.1|  PREDICTED: ABC transporter B family member 9...    169   2e-44    
ref|XP_007051282.1|  ATP binding cassette subfamily B4 isoform 2        169   2e-44    
ref|XP_006355823.1|  PREDICTED: ABC transporter B family member 2...    169   2e-44    
gb|EMT27767.1|  ABC transporter B family member 4                       169   2e-44    
ref|NP_001288986.1|  ABC transporter B family member 1                  169   2e-44    
ref|XP_003541677.1|  PREDICTED: ABC transporter B family member 9...    169   2e-44    
gb|KHN45005.1|  ABC transporter B family member 11                      169   2e-44    
ref|XP_008383571.1|  PREDICTED: ABC transporter B family member 9...    169   2e-44    
ref|XP_003550577.1|  PREDICTED: ABC transporter B family member 1...    169   2e-44    
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...    169   2e-44    
ref|XP_008349179.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    169   2e-44    
gb|KEH44488.1|  ABC transporter B family protein                        169   2e-44    
ref|XP_011082400.1|  PREDICTED: ABC transporter B family member 1...    169   3e-44    
ref|XP_002301547.1|  multidrug resistant ABC transporter family p...    169   3e-44    
gb|AIU41632.1|  ABC transporter family protein                          169   3e-44    
ref|XP_002881657.1|  At2g39480/F12L6.14                                 169   3e-44    
ref|XP_006386686.1|  hypothetical protein POPTR_0002s18860g             169   3e-44    
ref|XP_011005962.1|  PREDICTED: ABC transporter B family member 1...    169   3e-44    
ref|XP_004303546.2|  PREDICTED: ABC transporter B family member 9...    169   3e-44    
gb|KHN00238.1|  ABC transporter B family member 4                       169   3e-44    
ref|XP_003518599.1|  PREDICTED: ABC transporter B family member 4...    169   3e-44    
ref|XP_002301550.2|  hypothetical protein POPTR_0002s18850g             169   3e-44    



>emb|CDP13052.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   384 bits (985),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMFVG +GACVHGASVPVFF+FFGK+ID+IG A+LFPAEASHKV KYSLDFVYLS+VIL
Sbjct  47   FLMFVGAIGACVHGASVPVFFIFFGKMIDIIGLAYLFPAEASHKVGKYSLDFVYLSVVIL  106

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DIIVVQDA
Sbjct  107  FSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDIIVVQDA  166

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHYISRF AGF IGF+R+WQISLVTLSIVPLIALAGGVYA+VATGLIARVRK
Sbjct  167  ISEKVGNFMHYISRFFAGFAIGFVRVWQISLVTLSIVPLIALAGGVYAYVATGLIARVRK  226

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+ NVRTVQAF
Sbjct  227  SYVKAGEIAEEVIANVRTVQAF  248


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 98/201 (49%), Gaps = 6/201 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIV-ILFS  187
            FVG V A + GA +P+F +    +   +   ++      H+V K +  F   +++ ++F 
Sbjct  697  FVGTVCAFICGAQMPLFAL---GVTQALVSYYMDWDTTRHEVKKIAFLFCGGAVITVIFH  753

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAI  364
            S T + C+   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  +
Sbjct  754  SITHL-CFGIMGERLTLRVREKMFSAILRNEIGWFDDMDNTSSMLASRLESDATLLRTVV  812

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             ++    +  +   +  F I FI  W+++LV ++  PLI            G    + K+
Sbjct  813  VDRSTILLQNVGLAVTAFIIAFILNWRLTLVVMATYPLIVSGHISEKLFMKGYGGDLNKA  872

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y++A  +A E V N+RTV AF
Sbjct  873  YLKANMLAGEAVSNIRTVAAF  893



>ref|XP_011082358.1| PREDICTED: ABC transporter B family member 2-like [Sesamum indicum]
Length=1260

 Score =   377 bits (968),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMFVG VGACVHGASVPVFF+FFG++I++IG A+LFP EASHKVA YSLDFVYLSIVI+
Sbjct  55   FLMFVGSVGACVHGASVPVFFIFFGQLINIIGLAYLFPKEASHKVAMYSLDFVYLSIVIM  114

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMH+GERQAAKMRMAYL+SML+QDIS+FDTEASTGEVISAITTDIIVVQDA
Sbjct  115  FSSWTEVACWMHSGERQAAKMRMAYLKSMLSQDISIFDTEASTGEVISAITTDIIVVQDA  174

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HYISRFIAGF IGFIR+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR 
Sbjct  175  ISEKVGNFLHYISRFIAGFAIGFIRVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRN  234

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SYV+AGEIA+EV+GNVRTVQAFT
Sbjct  235  SYVKAGEIAEEVIGNVRTVQAFT  257


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 70/136 (51%), Gaps = 3/136 (2%)
 Frame = +2

Query  206  CWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEKVGN  382
            C+   GER   ++R     +ML  +I  FD   +T  ++ S + +D  +++  + ++   
Sbjct  758  CFGIMGERLTLRVREKMFTAMLRNEIGWFDDMNNTSSMLASQLESDATLLRTLVVDRWTI  817

Query  383  FMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFV-ATGLIARVRKSYVRAG  559
             +  +   +  F I FI  W+++LV ++  PL  ++G +   +   G    + K+Y++A 
Sbjct  818  LLQNVGLVVTSFIIAFILNWRLTLVVIATYPL-TISGHISEKIFMKGYGVDLNKAYLKAN  876

Query  560  EIAQEVVGNVRTVQAF  607
             +A E V N+RTV AF
Sbjct  877  MLAGEAVSNIRTVAAF  892



>ref|XP_002277547.1| PREDICTED: ABC transporter B family member 2 [Vitis vinifera]
 emb|CBI33860.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   376 bits (966),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM VG VGAC+HGASVPVFF+FFGK+ID+IG A+LFPA ASHKVAKYSLDFVYLS+VIL
Sbjct  38   FLMAVGSVGACIHGASVPVFFIFFGKLIDIIGLAYLFPAAASHKVAKYSLDFVYLSLVIL  97

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWMHTGERQAAKMRMAY+RSMLNQDISLFDTEA+TGEVISAIT+DIIVVQDA
Sbjct  98   FSSWAEVACWMHTGERQAAKMRMAYVRSMLNQDISLFDTEATTGEVISAITSDIIVVQDA  157

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +SEKVGNFMHYISRFIAGF IGFIR+WQISLVTL+IVPLIA+AGGVYA++ATGLIARVRK
Sbjct  158  LSEKVGNFMHYISRFIAGFAIGFIRVWQISLVTLAIVPLIAIAGGVYAYIATGLIARVRK  217

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  218  SYVKAGEIAEEVIGNVRTVQAF  239


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 93/200 (47%), Gaps = 4/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             VG + A + GA +P+F +    + + +   ++      H+V K +  F   + + +   
Sbjct  680  LVGTICALIAGAQMPLFAL---GVTEALVSYYMDWDTTRHQVKKIAFLFCGGAFITVIVH  736

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  + +  I 
Sbjct  737  AIEHTCFGIMGERLTLRIREMLFSAILGNEIGWFDDANNTSSMLSSRLESDATLFRTIIV  796

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +  F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  797  DRSTILIQNLGLVVTSFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  856

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  IA E V N+RTV AF
Sbjct  857  LKANMIAGEAVSNMRTVAAF  876



>ref|XP_003628784.1| ABC transporter B family member [Medicago truncatula]
 gb|AET03260.1| ABC transporter transmembrane region protein [Medicago truncatula]
Length=488

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGAC+HGASVPVFF+FFGKII+V+G A+LFP EASH+VAKY+LDFVYLSI+ILF
Sbjct  27   LMAVGSVGACIHGASVPVFFIFFGKIINVVGLAYLFPKEASHQVAKYALDFVYLSIIILF  86

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQ AKMRMAYLRSMLNQDISLFDTE STGEVIS+IT+DIIVVQ+A+
Sbjct  87   SSWAEVACWMHTGERQVAKMRMAYLRSMLNQDISLFDTEGSTGEVISSITSDIIVVQEAL  146

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMH+ISRFIAGF IGF+R+WQISLVTL+IVPLIA+AGG+YA+V  GLIA+VRKS
Sbjct  147  SEKVGNFMHFISRFIAGFIIGFLRVWQISLVTLAIVPLIAIAGGLYAYVTFGLIAKVRKS  206

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y+RAGEIAQEV+GNVRTVQAF
Sbjct  207  YLRAGEIAQEVIGNVRTVQAF  227



>gb|KJB21122.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=938

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 94/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G V A + GA +P+F +   + +     A+    E + H+V K ++ F   +++ +    
Sbjct  687  GTVNALIAGAQMPLFALGVSQAL----VAYYMDWETTCHEVKKIAILFCCAAVITVIVHA  742

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + +
Sbjct  743  IEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASRLETDATFLRGVVVD  802

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   IA F I FI  W+I+L+ L+  PLI            G    + K+Y+
Sbjct  803  RTSILIQNVGLVIAAFIIAFILNWRITLIILATFPLIISGHISEKLFMQGYGGNLSKAYL  862

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  IA E V N+RTV AF
Sbjct  863  KANMIAGEAVSNMRTVAAF  881



>ref|XP_009595706.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
tomentosiformis]
Length=1256

 Score =   374 bits (959),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVAKY+LDFVYLS+V+L
Sbjct  42   FLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVAKYALDFVYLSVVVL  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWMH+GERQAAKMRMAYL+S+LNQDISLFDTEASTGEVISAIT+DII+VQDA
Sbjct  102  FSSWIEVACWMHSGERQAAKMRMAYLKSILNQDISLFDTEASTGEVISAITSDIIIVQDA  161

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHY+SRF AGFTIGFIR+WQISLVTLSIVPLIALAGG+YA++ATGLIARVRK
Sbjct  162  ISEKVGNFMHYVSRFFAGFTIGFIRVWQISLVTLSIVPLIALAGGIYAYIATGLIARVRK  221

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SY++AGEIA+EVV NVRTVQAFT
Sbjct  222  SYIKAGEIAEEVVANVRTVQAFT  244


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 91/199 (46%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G + A + GA +P+F +    +   +   ++      H+V +    F   +++ +    
Sbjct  693  IGTICAFIAGAQMPLFAL---GVSQALVSYYMDWDTTRHEVKRICFLFCGGAVLTVVVHA  749

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAISE  370
                C+   GER   ++R     +ML  +I  FD    S+  + S + +D  +++  + +
Sbjct  750  IAHTCFGIIGERLTLRVREMMFSAMLRNEIGWFDEMNNSSSTLASRLESDATLLRTVVVD  809

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +  F I FI  W+++LV +++ PLI        F   G    + K+Y+
Sbjct  810  RSTILLQNVGLVVTSFIIAFILNWRLTLVVMAMYPLIVSGHISEKFFMQGFGGDLSKAYL  869

Query  551  RAGEIAQEVVGNVRTVQAF  607
            RA   A E V N+RTV AF
Sbjct  870  RANMFAGEAVSNIRTVVAF  888



>ref|XP_009764894.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
sylvestris]
Length=1260

 Score =   374 bits (959),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVAKY+LDFVYLS+V+L
Sbjct  46   FLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVAKYALDFVYLSVVVL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWMH+GERQAAKMRMAYL+SMLNQDIS FDTEASTGEVISAIT+DII+VQDA
Sbjct  106  FSSWIEVACWMHSGERQAAKMRMAYLKSMLNQDISFFDTEASTGEVISAITSDIIIVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHY+SRF AGFTIGFIR+WQISLVTLSIVPLIALAGG+YA++ATGLIARVRK
Sbjct  166  ISEKVGNFMHYVSRFFAGFTIGFIRVWQISLVTLSIVPLIALAGGIYAYIATGLIARVRK  225

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SY++AGEIA+EVV NVRTVQAFT
Sbjct  226  SYIKAGEIAEEVVANVRTVQAFT  248


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 65/135 (48%), Gaps = 1/135 (1%)
 Frame = +2

Query  206  CWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAISEKVGN  382
            C+   GER   ++R     +ML  +I  FD    S+  + S + +D  +++  + ++   
Sbjct  758  CFGIIGERLTLRVREMMFSAMLRNEIGWFDEMNNSSSTLASRLESDATLLRTVVVDRSTI  817

Query  383  FMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGE  562
             +  +   +  F I FI  W+++L+ +++ PLI            G    + K+Y+RA  
Sbjct  818  LLQNVGLVVTSFIIAFILNWRLTLIVMAMYPLIVSGHISEKLFMQGFGGDLSKAYLRANM  877

Query  563  IAQEVVGNVRTVQAF  607
             A E V N+RTV AF
Sbjct  878  FAGEAVSNIRTVAAF  892



>ref|XP_010096959.1| ABC transporter B family member 2 [Morus notabilis]
 gb|EXB66536.1| ABC transporter B family member 2 [Morus notabilis]
Length=945

 Score =   367 bits (943),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVP+FF+FFG++I+VIG A+LFP EASHKVAKYSLDFVYLSI ILF
Sbjct  48   LMAIGSIGACIHGASVPIFFIFFGQLINVIGMAYLFPKEASHKVAKYSLDFVYLSIAILF  107

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYLR+ML+QDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  108  SSWTEVACWMHTGERQAAKMRMAYLRAMLSQDISLFDTEASTGEVISAITSDIIVVQDAL  167

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHY+SRF+ GF IGF R+WQISLVTLSIVPLIALAGGVYA++ATGLIARVRKS
Sbjct  168  SEKVGNFMHYMSRFVVGFIIGFARVWQISLVTLSIVPLIALAGGVYAYIATGLIARVRKS  227

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  228  YVKAGEIAEEVIGNVRTVQAF  248


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 1/161 (1%)
 Frame = +2

Query  128  HKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS  307
             ++ K SL F   S++ +     E  C+   GER   ++R     +ML  +I  FD   +
Sbjct  726  REIKKISLLFCGASVLTVIVHAIEHLCFGTMGERLTLRVRERMFSAMLRNEIGWFDDTDN  785

Query  308  TGEVISA-ITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIA  484
            T  ++S+ + +D  +++  + ++    +  +   +A F I F+  W+I+LV L+  PLI 
Sbjct  786  TSSMLSSRLESDATLLKTIVVDRSTILLQNVGLVVASFIIAFLLNWRITLVVLATYPLII  845

Query  485  LAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                       G    + K+Y++A  +A E V N+RTV AF
Sbjct  846  SGHISEKLFMQGYGGNLSKAYLKANMLAGEAVSNIRTVAAF  886



>ref|XP_004512509.1| PREDICTED: ABC transporter B family member 2-like [Cicer arietinum]
Length=1237

 Score =   372 bits (956),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G +GAC+HGASVPVFF+FFGK+I+VIG A+LFP EASH+VAKYS+DFVYLSI ILF
Sbjct  32   LMFIGSIGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHEVAKYSMDFVYLSIAILF  91

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA+
Sbjct  92   SSWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDAL  151

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGFTIGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRKS
Sbjct  152  SEKVGNFMHYISRFIAGFTIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKS  211

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTV AF
Sbjct  212  YVKAGEIAEEVIGNVRTVHAF  232


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 93/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    I   +   ++      H+V K +  F   ++V +     
Sbjct  675  GTLCAFIAGAQMPLFAL---GISHALVSYYMDWDTTRHEVKKIAFLFCGAAVVTITVHAI  731

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + ++
Sbjct  732  EHLFFGIMGERLTLRVREKMFTAILKNEIGWFDDTTNTSSMLSSRLESDATLLRTIVVDR  791

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +A F I F+  W+I+LV L+  PLI            G    + K+Y++
Sbjct  792  STILLQNVGLVVASFIIAFLLNWRITLVVLATYPLIISGHISEKLFMKGYGGNLSKAYLK  851

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  852  ANMLAGEAVSNIRTVAAF  869



>ref|XP_007210429.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
 gb|EMJ11628.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
Length=1267

 Score =   373 bits (957),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLS+ IL
Sbjct  62   FLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVAKYSLDFVYLSVAIL  121

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DIIVVQDA
Sbjct  122  FSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDIIVVQDA  181

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGGVYA+V  GLIARVRK
Sbjct  182  LSEKVGNFMHYISRFLAGFIIGFVRVWQISLVTLSIVPLIALAGGVYAYVTIGLIARVRK  241

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  242  SYVKAGEIAEEVIGNVRTVQAF  263


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 98/200 (49%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            +G +GA + GA +P+F +   + +     +F    + +  ++ K SL F   +++ +   
Sbjct  705  IGTIGALIAGAQMPLFALGVSQAL----VSFYMDWDTTCREIKKISLLFCGAAVLTVIVH  760

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + 
Sbjct  761  AIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLLRTIVV  820

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  821  DRSTILLQNVGLVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  880

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  881  LKANMLAGEAVSNMRTVAAF  900



>gb|KJB21123.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1219

 Score =   371 bits (953),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 94/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G V A + GA +P+F +   + +     A+    E + H+V K ++ F   +++ +    
Sbjct  687  GTVNALIAGAQMPLFALGVSQAL----VAYYMDWETTCHEVKKIAILFCCAAVITVIVHA  742

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + +
Sbjct  743  IEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASRLETDATFLRGVVVD  802

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   IA F I FI  W+I+L+ L+  PLI            G    + K+Y+
Sbjct  803  RTSILIQNVGLVIAAFIIAFILNWRITLIILATFPLIISGHISEKLFMQGYGGNLSKAYL  862

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  IA E V N+RTV AF
Sbjct  863  KANMIAGEAVSNMRTVAAF  881



>ref|XP_007040642.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
 gb|EOY25143.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
Length=1075

 Score =   369 bits (946),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+RMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKIRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 91/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    +   +   ++       +V K ++ F   +++ +     
Sbjct  688  GTIAALIAGAQMPLFAL---GVSQALVAYYMDWDTTCREVKKIAILFSCAAVITVIVHAI  744

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + ++
Sbjct  745  EHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASHLETDATFLKGVVVDR  804

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y++
Sbjct  805  SAILIQNVGLLVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAYLK  864

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  865  ANMLAAEAVSNIRTVAAF  882



>gb|KJB21124.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1249

 Score =   371 bits (953),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 94/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G V A + GA +P+F +   + +     A+    E + H+V K ++ F   +++ +    
Sbjct  687  GTVNALIAGAQMPLFALGVSQAL----VAYYMDWETTCHEVKKIAILFCCAAVITVIVHA  742

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + +
Sbjct  743  IEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASRLETDATFLRGVVVD  802

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   IA F I FI  W+I+L+ L+  PLI            G    + K+Y+
Sbjct  803  RTSILIQNVGLVIAAFIIAFILNWRITLIILATFPLIISGHISEKLFMQGYGGNLSKAYL  862

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  IA E V N+RTV AF
Sbjct  863  KANMIAGEAVSNMRTVAAF  881



>ref|XP_006585887.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1254

 Score =   371 bits (953),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+KY+LDFVYLSI ILF
Sbjct  36   LMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSKYALDFVYLSIAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIS+IT+DIIVVQDA+
Sbjct  96   SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISSITSDIIVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGFTIGF+R+WQISLVTL+IVPLIALAGG+YA+V  GLI +VRKS
Sbjct  156  SEKVGNFMHYISRFIAGFTIGFVRVWQISLVTLAIVPLIALAGGLYAYVTIGLIGKVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  216  YVRAGEIAEEVIGNVRTVQAF  236


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA + GA +P+F +    I   +   ++      H+V K +L F   +++ + +   
Sbjct  689  GTLGAFIAGAQMPLFAL---GISHALVSYYMDWHTTRHEVKKVALLFCGAAVLTITAHAI  745

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   + R     ++L  +I  FD   +T  ++S+ + TD   ++  + ++
Sbjct  746  EHLSFGIMGERLTLRAREKMFSAILKSEIGWFDDINNTSSMLSSRLETDATFLRTVVVDR  805

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +A F I F+  W+I+LV L+  PLI            G    + K+Y++
Sbjct  806  STILLQNVGLVVASFIIAFMLNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  865

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  866  ANMLAGEAVSNIRTVAAF  883



>ref|XP_008238211.1| PREDICTED: ABC transporter B family member 2-like [Prunus mume]
Length=1271

 Score =   371 bits (953),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLS+ IL
Sbjct  63   FLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVAKYSLDFVYLSVAIL  122

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DIIVVQDA
Sbjct  123  FSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDIIVVQDA  182

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIARVRK
Sbjct  183  LSEKVGNFMHYISRFLAGFIIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIARVRK  242

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  243  SYVKAGEIAEEVIGNVRTVQAF  264


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 98/200 (49%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            +G +GA + GA +P+F +   + +     +F    + +  ++ K SL F   +++ +   
Sbjct  706  IGTIGALIAGAQMPLFALGVSQAL----VSFYMDWDTTCREIKKISLLFCGAAVLTVIVH  761

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + 
Sbjct  762  AIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLLRTIVV  821

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  822  DRSTILLQNVGLVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  881

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            +RA  +A E V N+RTV AF
Sbjct  882  LRANMLAGEAVSNMRTVAAF  901



>gb|AAF23176.1|AF216497_1 P-glycoprotein [Gossypium hirsutum]
Length=1249

 Score =   371 bits (952),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 95/201 (47%), Gaps = 6/201 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFS  187
            F G V A + GA +P+F +   + +     A+    E + H+V K ++ F   S++ +  
Sbjct  685  FFGTVTALIAGAQMPLFALGVSQAL----VAYYMDWETTCHEVKKIAILFCCASVITVIV  740

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAI  364
               E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  +
Sbjct  741  HAIEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASRLETDATFLRGVV  800

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             ++    +  +   IA F I FI  W+I+L+ L+  PLI            G    + K+
Sbjct  801  VDRTSILIQNVGLVIAAFIIAFILNWRITLIILATFPLIISGHISEKLFMQGYGGNLSKA  860

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y++A  IA E V N+RTV AF
Sbjct  861  YLKANMIAGEAVSNMRTVAAF  881



>gb|KJB21121.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1281

 Score =   371 bits (952),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  76   LMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  135

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  136  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  195

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  196  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  255

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  256  YVKAGEIAEEVIGNVRTVQAF  276


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 94/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G V A + GA +P+F +   + +     A+    E + H+V K ++ F   +++ +    
Sbjct  719  GTVNALIAGAQMPLFALGVSQAL----VAYYMDWETTCHEVKKIAILFCCAAVITVIVHA  774

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + +
Sbjct  775  IEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASRLETDATFLRGVVVD  834

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   IA F I FI  W+I+L+ L+  PLI            G    + K+Y+
Sbjct  835  RTSILIQNVGLVIAAFIIAFILNWRITLIILATFPLIISGHISEKLFMQGYGGNLSKAYL  894

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  IA E V N+RTV AF
Sbjct  895  KANMIAGEAVSNMRTVAAF  913



>ref|XP_007158282.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
 gb|ESW30276.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
Length=1245

 Score =   370 bits (950),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGAC+HGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILF
Sbjct  39   LMTIGSVGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA+
Sbjct  99   SSWAEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDAL  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRK+
Sbjct  159  SEKVGNFMHYISRFIAGFIIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKA  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  219  YVRAGEIAEEVIGNVRTVQAF  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + ++    +  I
Sbjct  748  GERLTLRVREKMFSAILKNEIGWFDDTNNTSSMLSSQLETDATLLRTIVVDRSTILLQNI  807

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +A F I FI  W+I+L+ ++  P +            G    + K+Y++A  +A E 
Sbjct  808  GLVVASFIIAFILNWRITLIVIATYPFVISGHISEKLFMKGYGGNLSKAYLKANMLAGEA  867

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  868  VSNIRTVAAF  877



>ref|XP_004301784.1| PREDICTED: ABC transporter B family member 2-like [Fragaria vesca 
subsp. vesca]
Length=1261

 Score =   370 bits (950),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLSI ILF
Sbjct  61   LMAIGSVGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASSKVAKYSLDFVYLSIAILF  120

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  121  SSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDILVVQDAL  180

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGGVYA+V  GLIARVRKS
Sbjct  181  SEKVGNFMHYISRFLAGFIIGFVRVWQISLVTLSIVPLIALAGGVYAYVTIGLIARVRKS  240

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  241  YVKAGEIAEEVIGNVRTVQAF  261


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +GA + GA +P+F +    +   +   ++       +V K SL F   ++V +    
Sbjct  700  MGTIGALIAGAQMPLFAL---GVSQALVSYYMDWETTCREVKKISLLFCGAAVVTVIVHA  756

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
                C    GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + +
Sbjct  757  VAHLCMGTMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLLRTIVVD  816

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +A F I FI  W+I+LV L+  PLI            G    +  +Y+
Sbjct  817  RSTILLQNVGLIVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMKGYGGNLSTAYL  876

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  877  KANMLAGEAVSNIRTVAAF  895



>ref|XP_007040641.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
 gb|EOY25142.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
Length=1251

 Score =   370 bits (949),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  44   LMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+RMAYL+SMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  104  SSWIEVACWMHTGERQAAKIRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF+IGF R+WQISLVTLSIVPLIALAGG+YA+VATGLIARVR S
Sbjct  164  SEKVGNFMHYISRFIAGFSIGFARVWQISLVTLSIVPLIALAGGIYAYVATGLIARVRNS  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  224  YVKAGEIAEEVIGNVRTVQAF  244


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 93/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G + A + GA +P+F +   + +     A+    + +  +V K ++ F   +++ +    
Sbjct  688  GTIAALIAGAQMPLFALGVSQAL----VAYYMDWDTTCREVKKIAILFSCAAVITVIVHA  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + TD   ++  + +
Sbjct  744  IEHLCFGIMGERLTLRVREGMFSAILKNEIGWFDDLNNASSMLASHLETDATFLKGVVVD  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y+
Sbjct  804  RSAILIQNVGLLVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAYL  863

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  864  KANMLAAEAVSNIRTVAAF  882



>ref|XP_009371200.1| PREDICTED: ABC transporter B family member 2-like [Pyrus x bretschneideri]
Length=1261

 Score =   369 bits (947),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM VG VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLS+ IL
Sbjct  56   LLMAVGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVAKYSLDFVYLSVAIL  115

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DIIVVQDA
Sbjct  116  FSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDIIVVQDA  175

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +SEKVGNF+HY+SRF+AGF IGF+R+WQISLVTLSIVPLIALAGGVYA+V  GLIARVRK
Sbjct  176  LSEKVGNFLHYVSRFLAGFIIGFVRVWQISLVTLSIVPLIALAGGVYAYVTIGLIARVRK  235

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  236  SYVKAGEIAEEVIGNVRTVQAF  257


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 96/200 (48%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            +G  G  + GA +P+F +   + +     +F    E + H+V K SL F   + + +   
Sbjct  698  IGTFGGLIAGAQMPLFALGVSQAL----VSFYMDWETTKHEVKKISLLFCGAAFLTVIVH  753

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + 
Sbjct  754  AIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLLRTIVV  813

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  814  DRSTILIQNLGLVVASFVIAFILNWRITLVVLATYPLIISGHISEKLFFQGYGGNLSKAY  873

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  874  LKANMLAGEAVSNIRTVAAF  893



>ref|XP_008373592.1| PREDICTED: ABC transporter B family member 2-like [Malus domestica]
Length=1261

 Score =   369 bits (947),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM VG VGACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLS+ IL
Sbjct  56   LLMAVGSVGACVHGASVPIFFIFFGKLINIIGXAYLFPKEASSKVAKYSLDFVYLSVAIL  115

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMRMAYLR+MLNQDISLFDTEASTGEVISAIT+DIIVVQDA
Sbjct  116  FSSWTEVACWMHTGERQAAKMRMAYLRAMLNQDISLFDTEASTGEVISAITSDIIVVQDA  175

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +SEKVGNF+HY+SRF+AGF IGF+R+WQISLVTLSIVPLIALAGGVYA+V  GLIARVRK
Sbjct  176  LSEKVGNFLHYVSRFLAGFIIGFVRVWQISLVTLSIVPLIALAGGVYAYVTIGLIARVRK  235

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  236  SYVKAGEIAEEVIGNVRTVQAF  257


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 96/200 (48%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            +G  G  + GA +P+F +   + +     +F    E + H+V K SL F   + + +   
Sbjct  698  IGTFGGLIAGAQMPLFALGVSQAL----VSFYMDWETTKHEVKKISLLFCGAAFLTVIVH  753

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + 
Sbjct  754  AIEHLCFGIMGERLTLRVREKMFSAILRNEIGWFDDTNNTSSMLSSRLESDATLLRTIVV  813

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +A F I FI  W+I+LV ++  PLI            G    + K+Y
Sbjct  814  DRTTILIQNLGLVVASFVIAFILNWRITLVVIATYPLIISGHISEKLFFQGYGGNLSKAY  873

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  874  LKANMLAGEAVSNIRTVAAF  893



>ref|XP_003612850.1| ABC transporter B family member [Medicago truncatula]
 gb|AES95808.1| ABC transporter B family-like protein [Medicago truncatula]
Length=1234

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G +GA VHGASVP+FF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  31   LMFIGSIGAIVHGASVPIFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSVAILF  90

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA+
Sbjct  91   SSWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDAL  150

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGFTIGF+R+WQISLVTLSIVP IALAGG YA+V  GLIA+VRK+
Sbjct  151  SEKVGNFLHYISRFIAGFTIGFVRVWQISLVTLSIVPAIALAGGCYAYVTIGLIAKVRKA  210

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  211  YVRAGEIAEEVIGNVRTVQAF  231


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 66/130 (51%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD   +T  ++S+ + +D  +++  + ++    +  +
Sbjct  737  GERLTLRVREMMFTAILKNEIGWFDETTNTSSMLSSRLESDATLMRTIVVDRSTILLQNL  796

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +A F I F+  W+I+LV L+  PLI            G    + K+Y++A  +A E 
Sbjct  797  GLVVASFIIAFLLNWRITLVVLATYPLIISGHISEKLFMKGYGGNLSKAYLKANMLAGEA  856

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  857  VSNIRTVAAF  866



>ref|XP_003533440.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1245

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILF
Sbjct  41   LMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILF  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA+
Sbjct  101  SSWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDAL  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRK+
Sbjct  161  SEKVGNFMHYISRFVAGFVIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKA  220

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  221  YVRAGEIAEEVIGNVRTVQAF  241


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 94/203 (46%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F    G + A + GA +P+F +    I   +   ++      H+V K +  F   +++ +
Sbjct  680  FYGVAGTLCAFIAGAQMPLFAL---GISHALVSYYMDWETTCHEVKKIAFLFCGAAVITV  736

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQD  358
                 E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++ 
Sbjct  737  TVHAIEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDTNNTSSMLSSQLETDATLLRT  796

Query  359  AISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVR  538
             + ++    +  I   IA F I FI  W+I+LV ++  PL+            G    + 
Sbjct  797  IVVDRSTILLQNIGLVIASFIIAFILNWRITLVVIATYPLVISGHISEKLFMKGYGGNLS  856

Query  539  KSYVRAGEIAQEVVGNVRTVQAF  607
            K+Y++A  +A E V N+RTV AF
Sbjct  857  KAYLKANMLAGEAVSNIRTVAAF  879



>gb|EYU34148.1| hypothetical protein MIMGU_mgv1a000301mg [Erythranthe guttata]
Length=1278

 Score =   369 bits (946),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVA YSLDFVYLSIVI+
Sbjct  60   LLMFVGSIGACVHGASVPIFFIFFGKLINIIGLAYLFPKEASSKVAMYSLDFVYLSIVIM  119

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMH+GERQAAKMRMAY+RSML+QDIS+FDTE+STGEVISAITTDIIVVQDA
Sbjct  120  FSSWTEVACWMHSGERQAAKMRMAYVRSMLSQDISIFDTESSTGEVISAITTDIIVVQDA  179

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HYISRF+AGFTIGFIR+WQISLVTLSIVPLIA+AGG+YA+VATGLIARVRK
Sbjct  180  ISEKVGNFLHYISRFLAGFTIGFIRVWQISLVTLSIVPLIAVAGGIYAYVATGLIARVRK  239

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SYV+AGEIA+EV+ NVRTVQAF+
Sbjct  240  SYVKAGEIAEEVIANVRTVQAFS  262


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 91/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    +   +   ++       +V K +  F   +++ +F    
Sbjct  718  GTLCAFIAGAQMPLFAL---GVTQALVSYYMDWDTTRREVRKIAFLFCGGAVITVFVHAI  774

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
               C+   GER   ++R     +ML  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  775  THLCFGIMGERLTLRVREKMFTAMLRNEIGWFDDVNNTSSMLASQLESDATLLRTVVVDR  834

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+++LV ++  PLI            G    + K+Y++
Sbjct  835  STILLQNVGLIVTSFIIAFILNWRLTLVVMATYPLIISGHISEKLFMKGYGVDLNKAYLK  894

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  895  ANMLAGEAVSNIRTVAAF  912



>gb|KHN38940.1| ABC transporter B family member 2 [Glycine soja]
Length=1204

 Score =   366 bits (940),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            M VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILFS
Sbjct  1    MGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILFS  60

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAIS  367
            SWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA+S
Sbjct  61   SWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDALS  120

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            EKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRK+Y
Sbjct  121  EKVGNFMHYISRFVAGFVIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKAY  180

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            VRAGEIA+EV+GNVRTVQAF
Sbjct  181  VRAGEIAEEVIGNVRTVQAF  200


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 94/203 (46%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F    G + A + GA +P+F +    I   +   ++      H+V K +  F   +++ +
Sbjct  639  FYGVAGTLCAFIAGAQMPLFAL---GISHALVSYYMDWETTCHEVKKIAFLFCGAAVITV  695

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQD  358
                 E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++ 
Sbjct  696  TVHAIEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDTNNTSSMLSSQLETDATLLRT  755

Query  359  AISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVR  538
             + ++    +  I   IA F I FI  W+I+LV ++  PL+            G    + 
Sbjct  756  IVVDRSTILLQNIGLVIASFIIAFILNWRITLVVIATYPLVISGHISEKLFMKGYGGNLS  815

Query  539  KSYVRAGEIAQEVVGNVRTVQAF  607
            K+Y++A  +A E V N+RTV AF
Sbjct  816  KAYLKANMLAGEAVSNIRTVAAF  838



>gb|EPS64351.1| hypothetical protein M569_10429, partial [Genlisea aurea]
Length=1241

 Score =   364 bits (935),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMF+G +GACVHGASVPVFFVFFGKII++IG A+LFP EA+ +VAKYS+DFVYLS VIL
Sbjct  30   LLMFLGSIGACVHGASVPVFFVFFGKIINIIGLAYLFPKEAAPQVAKYSIDFVYLSAVIL  89

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SSWTEVACWMH+GERQAAKMRMAYLRSMLNQDIS FDTEASTGEVISAIT+DI+VVQDA
Sbjct  90   LSSWTEVACWMHSGERQAAKMRMAYLRSMLNQDISTFDTEASTGEVISAITSDIVVVQDA  149

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HYISRF+AGF IGFIR+WQISLVTLSI+PLI LAGGVYA+V TGLIARVRK
Sbjct  150  ISEKVGNFLHYISRFVAGFAIGFIRVWQISLVTLSILPLIVLAGGVYAYVTTGLIARVRK  209

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  210  SYVQAGEIAEEVIGNVRTVQAF  231


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 92/203 (45%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F   VG + A + GA +P+F +    +   +   ++       ++ K SL F   ++V +
Sbjct  680  FYGVVGTICAFIAGAQMPLFAL---GVTQALVSYYMDWDTTKREIRKISLLFCGGAVVTV  736

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQD  358
                    C+   GER   ++R     +ML  +I  FD   +T  ++ S +  D  +++ 
Sbjct  737  VVHAIAHLCFGIMGERLTLRVREKMFNAMLRNEIGWFDDVDNTSSMLASQLEIDATLLRS  796

Query  359  AISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVR  538
             + ++    +  +   +  F I FI  W+++LV ++  PLI            G    + 
Sbjct  797  LVVDRSSILLQNVGLVVTSFIIAFILNWRLTLVVMATYPLIISGHISEKLFMKGYGLDLD  856

Query  539  KSYVRAGEIAQEVVGNVRTVQAF  607
            K+Y++A  +A E V N+RTV AF
Sbjct  857  KAYLKANMLAGEAVSNIRTVAAF  879



>ref|XP_010458427.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1226

 Score =   363 bits (932),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  40   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVAKYSLDFVYLSVVILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDAI
Sbjct  100  SSWIEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG+YAFV TGLIARVRKS
Sbjct  160  SEKVGNFLHYISRFIAGFVIGFTSVWQISLVTLAIVPLIALAGGIYAFVGTGLIARVRKS  219

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  220  YVKANEIAEEVIGNVRTVQAFT  241


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 95/198 (48%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +G+ V GA +P+F +    I + +   ++      H+V + S+ F   S++ + S   
Sbjct  666  GTLGSFVAGALMPLFAL---GISEALVSYYMDWDTTQHEVKRISILFCCASVITVISHAI  722

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  723  EHTSFGIMGERLTLRVRQKMFSAILRNEIGWFDKVDNTSSMLASRLESDAALLKTIVVDR  782

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+++LV L+  PLI            G    + K+Y++
Sbjct  783  STILLENLGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAYLK  842

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  843  ANMLAGESISNIRTVAAF  860



>ref|XP_006352948.1| PREDICTED: ABC transporter B family member 2-like [Solanum tuberosum]
Length=1257

 Score =   363 bits (933),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHKVAKYSLDFVYLS+VIL
Sbjct  53   LLMILGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKVAKYSLDFVYLSVVIL  112

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWMH+GERQAAK+RMAYL+SMLNQDISLFDTEASTGEVISAIT+DII+VQDA
Sbjct  113  FSSWIEVACWMHSGERQAAKIRMAYLKSMLNQDISLFDTEASTGEVISAITSDIIIVQDA  172

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK GNF+HYISRF+AGFTIGFIR+WQISLVTLSIVPLIALAGG+YA+V  GLIARVRK
Sbjct  173  ISEKAGNFLHYISRFLAGFTIGFIRVWQISLVTLSIVPLIALAGGIYAYVTIGLIARVRK  232

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SY++AGEIA+EVV N+RTVQAFT
Sbjct  233  SYIKAGEIAEEVVANIRTVQAFT  255


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 90/199 (45%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G V A + GA +P+F +    +   +   ++      H+V K    F   +++ +    
Sbjct  696  IGTVCAFIAGAQMPLFAL---GVSQALVSYYMDWDTTRHEVKKICFLFCVGAVLTVVVHA  752

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAISE  370
                C+   GER   +MR     +ML  +I  FD    S+  + S + +D  +++  + +
Sbjct  753  IAHTCFGIIGERLTLRMRERMFSAMLRNEIGWFDEMNNSSSTLASRLESDATLLRTVVVD  812

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +      F I FI  W+++LV +++ PLI           +G    + K+Y+
Sbjct  813  RSTILLQNVGLVATSFIIAFILNWRLTLVVIAMYPLIVSGHISEKLFMSGFGGDLSKAYL  872

Query  551  RAGEIAQEVVGNVRTVQAF  607
            RA   A E V N+RTV AF
Sbjct  873  RANMFAGEAVSNIRTVAAF  891



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   363 bits (932),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC HGASVPVFF+FFGK+I++IG AFLFP   SH+VAKYSLDFVYL I IL
Sbjct  38   FLMALGSIGACAHGASVPVFFIFFGKLINIIGVAFLFPTTVSHRVAKYSLDFVYLGIAIL  97

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMR+AYLRSML+QDI++FDTEASTGEVI+AIT+DIIVVQDA
Sbjct  98   FSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIAVFDTEASTGEVIAAITSDIIVVQDA  157

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHYISRFIAGF IGF R+WQISLVTLSIVPLIA+AGG+YA+VATGLIARVRK
Sbjct  158  ISEKVGNFMHYISRFIAGFAIGFARVWQISLVTLSIVPLIAIAGGIYAYVATGLIARVRK  217

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  218  SYVKAGEIAEEVIGNVRTVQAF  239


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +GA V GA +P+F +    +   +   ++       +V K +L F   +++ +F   
Sbjct  682  IGTLGAFVAGAQMPLFAL---GVTQALVSYYMVWETTQREVKKIALLFCGGAVLTVFFHV  738

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R      +L  +I  FD  ++T  ++ S + TD  +++  + +
Sbjct  739  IEHLNFGIMGERLTLRVRERMFGVILRNEIGWFDDMSNTSAMLTSRLETDATLLRTIVVD  798

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  I   +    I FI  W+I+LV L+  PL+            G    + K+Y+
Sbjct  799  RSTILLQNIGMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKLFMRGYGGNLSKTYL  858

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  859  KANMLAAEAVSNIRTVAAF  877



>gb|KJB51627.1| hypothetical protein B456_008G225400 [Gossypium raimondii]
Length=1248

 Score =   363 bits (931),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I+V G A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  45   LMGLGSIGACVHGASVPVFFIFFGKLINVAGMAYLFPKEASHKVAKYSLDFVYLSVAILF  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTG+VISAIT+DII+VQDA+
Sbjct  105  SSWIEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGQVISAITSDIILVQDAL  164

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFI GF IGF R+WQISLVTLSIVPLIA+AGG+YA+VATGLIARVR S
Sbjct  165  SEKVGNFMHYISRFIVGFCIGFARVWQISLVTLSIVPLIAIAGGLYAYVATGLIARVRNS  224

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  225  YVKAGEIAEEVIGNVRTVQAF  245


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 93/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSSW  193
            G + A + GA +P+F +   + +     A+    E + ++V K +  F   +++ +    
Sbjct  687  GTIAALIAGAQMPLFALGVSQAL----VAYYMDWETTCNEVKKIATLFCCAAVITVIVHA  742

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E  C+   GER   ++R     ++L  +I  FD   +   ++ S + +D   ++  + +
Sbjct  743  IEHLCFGIMGERLTLRVREVMFSAILRNEIGWFDDPNNASSMLASHLESDATFLKGVVVD  802

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +A F I FI  W+I+LV L+  PLI            G    + K+Y+
Sbjct  803  RTSILIQNLGLVVAAFIIAFILSWRITLVILATFPLIISGHISEKLFMQGFGGDLSKAYL  862

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  863  KANMLAGEAVSNIRTVAAF  881



>ref|XP_006413247.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
 gb|ESQ54700.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
Length=1239

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVAKYSLDFVYLS+ ILF
Sbjct  40   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPHQASHKVAKYSLDFVYLSVAILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  100  SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  160  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  219

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  220  YIKAGEIAEEVIGNVRTVQAFT  241


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 76/161 (47%), Gaps = 1/161 (1%)
 Frame = +2

Query  128  HKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS  307
             +V K ++ F   S + L     E  C+   GER   ++R     ++L  +I  FD   +
Sbjct  712  KEVKKIAILFCCASFITLVVYTIEHVCFGTMGERLTLRVREKMFSAILKNEIGWFDEVDN  771

Query  308  TGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIA  484
            T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV ++  PL+ 
Sbjct  772  TSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFILNWRLTLVVIATYPLVI  831

Query  485  LAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                       G    + K+Y++A  +A E V N+RTV AF
Sbjct  832  SGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  872



>ref|XP_004245909.2| PREDICTED: ABC transporter B family member 2-like [Solanum lycopersicum]
Length=1257

 Score =   362 bits (930),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMF+G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHK+AKYSLDFVYLS+VIL
Sbjct  53   LLMFLGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKIAKYSLDFVYLSVVIL  112

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVACWMH+GERQAAK+RMAYL+SMLNQDISLFDTEASTGEVI+AIT+DII+VQDA
Sbjct  113  FASWIEVACWMHSGERQAAKIRMAYLKSMLNQDISLFDTEASTGEVIAAITSDIIIVQDA  172

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK GNF+HYISRF+AGFTIGFIR+WQISLVTLSIVPLIALAGG+YA+V  GLIARVRK
Sbjct  173  ISEKAGNFLHYISRFLAGFTIGFIRVWQISLVTLSIVPLIALAGGIYAYVTIGLIARVRK  232

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            SY++AGEIA+EVV N+RTVQAFT
Sbjct  233  SYIKAGEIAEEVVANIRTVQAFT  255


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 90/199 (45%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G + A + GA +P+F +    +   +   ++      H+V K    F   +++ +    
Sbjct  696  IGTICAFIAGAQMPLFAL---GVSQALVSYYMDWDTTRHEVKKICFLFCVGAVLTVVVHA  752

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAISE  370
                C+   GER   ++R     +ML  +I  FD    S+  + S + +D  +++  + +
Sbjct  753  IAHTCFGIIGERLTLRVREMMFSAMLRNEIGWFDEVNNSSSTLASRLESDATLLRTVVVD  812

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +      F I FI  W+++LV +++ PLI           +G    + K+Y+
Sbjct  813  RSTILLQNVGLVATSFIIAFILNWRLTLVVMAMYPLIVSGHISEKLFMSGFGGDLSKAYL  872

Query  551  RAGEIAQEVVGNVRTVQAF  607
            RA   A E V N+RTV AF
Sbjct  873  RANMFAGEAVSNIRTVAAF  891



>ref|XP_002527657.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF34728.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1156

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G V A  HGASVPVFF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  52   LMGLGSVAAIAHGASVPVFFIFFGKMINIIGLAYLFPQQASHRVAKYSLDFVYLSVAILF  111

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQA KMRMAYLRSMLNQDISLFDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  112  SSWIEVACWMHTGERQATKMRMAYLRSMLNQDISLFDTEASTGEVIAAITSDILVVQDAI  171

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHY+SRF+AGFTIGFIR+WQISLVTLSIVPLIALAGG+YAFV+ GLIARVRK+
Sbjct  172  SEKVGNFMHYMSRFLAGFTIGFIRVWQISLVTLSIVPLIALAGGIYAFVSIGLIARVRKA  231

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  232  YVRAGEIAEEVIGNVRTVQAF  252


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 100/202 (50%), Gaps = 10/202 (5%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIV--ILF  184
            VG + A + G+ +P+F +   + +     A+    + + H++ K S+ F+  ++V  I+F
Sbjct  694  VGTISAFMAGSQMPLFALGVSQAL----VAYYMDWDTTRHEIKKISILFICGAVVSVIVF  749

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDA  361
            S   E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  ++++ 
Sbjct  750  S--IEHLSFGIMGERLTFRVRERMFSAILRNEIGWFDDLNNTSAMLASRLESDATLLRNL  807

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            + ++    +  +   +  F I F+  W+I+LV ++  PLI            G    + K
Sbjct  808  VVDRTTILLQNVGLVVTSFIIAFLLNWRITLVVIATYPLIISGHFSEKLFMKGYGGNLSK  867

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y++A  +A E V N+RTV AF
Sbjct  868  AYLKANMLAGEAVSNMRTVAAF  889



>ref|XP_002869639.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45898.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=1233

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  36   LMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  156  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  216  YIKAGEIAEEVIGNVRTVQAFT  237


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   SI+ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  704  ETQKEIKKIAILFCCASIITLIVYTIEHICFGTMGERLTLRVRENMFRAILKNEIGWFDE  763

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  764  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNWRLTLVVLATYP  823

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  824  LVISGHISEKLFMQGYGGDLNKAYLKANMLAGESVSNIRTVAAF  867



>ref|XP_010538383.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1256

 Score =   362 bits (929),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GACVHGASVPVFF+FFGK+I++IG A+LFP +AS +VAKYSLDFVYLS+ ILF
Sbjct  47   LMAVGSMGACVHGASVPVFFIFFGKLINIIGIAYLFPKQASPQVAKYSLDFVYLSVAILF  106

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  107  SSWIEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDIIVVQDAL  166

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF R+WQISLVTLSIVPLIALAGG+YAFVATGL+ARVRKS
Sbjct  167  SEKVGNFLHYISRFIAGFAIGFARVWQISLVTLSIVPLIALAGGIYAFVATGLLARVRKS  226

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  227  YVKAGEIAEEVIGNVRTVQAF  247


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 90/198 (45%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G  GA V GA +P+F +    +   +   ++      H+V + ++ F   S+V +     
Sbjct  688  GTFGALVAGAQMPLFAL---GVSQALVSYYMDWDTTQHEVKRIAVLFCCASVVTVIVYTI  744

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S +  D  +++  + ++
Sbjct  745  EHLSFGIMGERLTLRVREMMFSAILRNEIGWFDDVNNTSSMLASRLEGDATLLKTIVVDR  804

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +      F I FI  W+++LV L+  PL+            G    + K+Y++
Sbjct  805  STILLQNVGLVATSFIIAFILNWRLTLVVLATYPLVISGHISEKLFMQGYGGNLSKAYLK  864

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  865  ANMLAGEAVSNIRTVAAF  882



>emb|CAA71277.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAA71276.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAB39661.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
 emb|CAB79451.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
Length=1233

 Score =   362 bits (928),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  36   LMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  156  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  216  YIKAGEIAEEVIGNVRTVQAFT  237


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   S++ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  704  ETQKEIKKIAILFCCASVITLIVYTIEHICFGTMGERLTLRVRENMFRAILKNEIGWFDE  763

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  764  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNWRLTLVVLATYP  823

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  824  LVISGHISEKLFMQGYGGDLNKAYLKANMLAGESVSNIRTVAAF  867



>gb|KHN30010.1| ABC transporter B family member 2 [Glycine soja]
Length=1253

 Score =   362 bits (929),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 190/201 (95%), Gaps = 1/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+KY+LDFVYLSI ILF
Sbjct  36   LMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSKYALDFVYLSIAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIS+IT+DIIVVQDA+
Sbjct  96   SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISSITSDIIVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGFTIGF+R+WQISLVTL+IVPLIALAGG+YA+V  GLI +VRKS
Sbjct  156  SEKVGNFMHYISRFIAGFTIGFVRVWQISLVTLAIVPLIALAGGLYAYVTIGLIGKVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+E   NVRTVQAF
Sbjct  216  YVRAGEIAEE-ASNVRTVQAF  235


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA + GA +P+F +    I   +   ++      H+V K +L F   +++ + +   
Sbjct  688  GTLGAFIAGAQMPLFAL---GISHALVSYYMDWDTTRHEVKKVALLFCGAAVLTITAHAI  744

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   + R     ++L  +I  FD   +T  ++S+ + TD   ++  + ++
Sbjct  745  EHLSFGIMGERLTLRAREKMFSAILKSEIGWFDDINNTSSMLSSRLETDATFLRTVVVDR  804

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +A F I F+  W+I+LV L+  PLI            G    + K+Y++
Sbjct  805  STILLQNVGLVVASFIIAFMLNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  864

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  865  ANMLAGEAVSNIRTVAAF  882



>gb|AAM20507.1| P-glycoprotein-2 [Arabidopsis thaliana]
Length=1233

 Score =   362 bits (928),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  36   LMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  156  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  216  YIKAGEIAEEVIGNVRTVQAFT  237


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   S++ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  704  ETQKEIKKIAILFCCASVITLIVYTIEHICFGTMGERLTLRVRENMFRAILKNEIGWFDE  763

Query  299  -EASTGEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
             + ++  + S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  764  VDNASSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNWRLTLVVLATYP  823

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  824  LVISGHISEKLFMQGYGGDLNKAYLKANMLAGESVSNIRTVAAF  867



>ref|XP_006282856.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
 gb|EOA15754.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
Length=1239

 Score =   362 bits (928),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  44   LMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  104  SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  164  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  223

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  224  YIKAGEIAEEVIGNVRTVQAFT  245


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   S++ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  710  ETQKEIKKIAILFCCASVITLIVYTIEHVCFGTMGERLTLRVRENMFRAILKNEIGWFDE  769

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  770  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVIAFILNWRLTLVVLATFP  829

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  830  LVISGHISEKLFMQGYGGDLSKAYLKANMLAGESVSNIRTVAAF  873



>ref|XP_006385671.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
 gb|ERP63468.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
Length=922

 Score =   356 bits (913),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYSLDFVYLS+VILF
Sbjct  43   LMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYSLDFVYLSVVILF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +SW EVACWMHTGERQAAKMRMAYL+SML+QDISLFDTEASTGEVI+AIT+DIIVVQDAI
Sbjct  103  ASWIEVACWMHTGERQAAKMRMAYLKSMLSQDISLFDTEASTGEVIAAITSDIIVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+ GF IGF+R+WQISLVTLSIVPLIALAGG+YA++  GLIA+VRKS
Sbjct  163  SEKVGNFMHYISRFLGGFIIGFVRIWQISLVTLSIVPLIALAGGIYAYITIGLIAKVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A ++A+EV+GNVRTVQAFT
Sbjct  223  YVKASQVAEEVIGNVRTVQAFT  244


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +GA + G+++P+F +    +   +   ++      H+V K ++ F   + + +    
Sbjct  685  LGTMGAFIAGSAMPLFAL---GVSQALVAYYMDWDTTRHEVKKIAILFCCGAAISVIVYA  741

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + +
Sbjct  742  IEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDLNNTSSMLTSRLESDATLLRTIVVD  801

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +  F I F   W+I+LV ++  PLI            G    + K+Y+
Sbjct  802  RSTILLQNVGLVVTSFIIAFTLNWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAYL  861

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  862  KANMLAGEAVSNIRTVAAF  880



>ref|XP_007156412.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
 gb|ESW28406.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
Length=1235

 Score =   362 bits (928),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGACVHGASVPVFFVFFGKII+VIG A+L P EASH+VAKY+LDFVYLSIVILF
Sbjct  27   LMGVGSVGACVHGASVPVFFVFFGKIINVIGFAYLSPKEASHEVAKYALDFVYLSIVILF  86

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYLRSM+NQDI+LFDT+ASTGEVIS+ITTDIIVVQDA+
Sbjct  87   SSWTEVACWMHTGERQAAKMRMAYLRSMMNQDITLFDTQASTGEVISSITTDIIVVQDAL  146

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFI GF IGF+R+WQISLVTL+IVPLIA+AGG+YA+V  GLI +VRK+
Sbjct  147  SEKVGNFMHYISRFIGGFVIGFVRVWQISLVTLAIVPLIAIAGGLYAYVTIGLIGKVRKA  206

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  207  YVRAGEIAEEVIGNVRTVQAF  227


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 93/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA + GA +P+F +    I   +   ++      H+V K +  F   +++ + +   
Sbjct  669  GTLGAFIAGAQMPLFAL---GISHALVSYYMDWDTTRHEVKKVAFLFCGAAVLTITAHAI  725

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   + R     ++L  +IS FD   +T  ++S+ + TD   ++  I ++
Sbjct  726  EHLSFGIMGERLTLRAREKMFSAILKSEISWFDDINNTSSMLSSRLETDATFLRTIIVDR  785

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F + F+  W+I+LV L+  PLI            G    + K+Y++
Sbjct  786  STILLQNVGLVVTSFIVAFMLNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  845

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  846  ANMLAGEAVSNIRTVAAF  863



>ref|XP_010491749.1| PREDICTED: ABC transporter B family member 10 [Camelina sativa]
Length=1226

 Score =   361 bits (927),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  40   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVAKYSLDFVYLSVVILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE+STGEVISAIT+DI+VV+DAI
Sbjct  100  SSWIEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVRDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG+YAFV TGLIARVRKS
Sbjct  160  SEKVGNFLHYISRFIAGFVIGFTSVWQISLVTLAIVPLIALAGGIYAFVGTGLIARVRKS  219

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  220  YVKANEIAEEVIGNVRTVQAFT  241


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 95/198 (48%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +G+ V GA +P+F +    I + +   ++      H+V + S+ F   S++ + S   
Sbjct  666  GTLGSFVAGALMPLFAL---GISEALVSYYMDWDTTQHEVKRISILFCCASVITVISHAI  722

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  723  EHTSFGIMGERLTLRVRQKMFSAILRNEIGWFDKVDNTSSMLASRLESDAALLKTIVVDR  782

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+++LV L+  PLI            G    + K+Y++
Sbjct  783  STILLENLGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAYLK  842

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  843  ANMLAGESISNIRTVAAF  860



>ref|NP_194326.2| P-glycoprotein 2 [Arabidopsis thaliana]
 sp|Q8LPK2.3|AB2B_ARATH RecName: Full=ABC transporter B family member 2; Short=ABC transporter 
ABCB.2; Short=AtABCB2; AltName: Full=Multidrug resistance 
protein 2; AltName: Full=P-glycoprotein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAE99138.1| P-glycoprotein-2 [Arabidopsis thaliana]
 gb|AEE85137.1| P-glycoprotein 2 [Arabidopsis thaliana]
Length=1273

 Score =   362 bits (928),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  76   LMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  135

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  136  SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  195

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  196  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  255

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  256  YIKAGEIAEEVIGNVRTVQAFT  277


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   S++ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  744  ETQKEIKKIAILFCCASVITLIVYTIEHICFGTMGERLTLRVRENMFRAILKNEIGWFDE  803

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  804  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNWRLTLVVLATYP  863

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  864  LVISGHISEKLFMQGYGGDLNKAYLKANMLAGESVSNIRTVAAF  907



>ref|XP_002892589.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68848.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
Length=1229

 Score =   360 bits (924),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  41   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVVILF  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE STGEVISAIT+DI+VVQDAI
Sbjct  101  SSWLEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTETSTGEVISAITSDILVVQDAI  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H+ISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFV TGLI RVRKS
Sbjct  161  SEKVGNFLHFISRFIAGFAIGFASVWQISLVTLSIVPLIALAGGIYAFVGTGLIVRVRKS  220

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  221  YVKANEIAEEVIGNVRTVQAFT  242


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 98/201 (49%), Gaps = 6/201 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
              G +G+ + G+ +P+F +    I   +   ++      ++V + S+ F   S++ +   
Sbjct  665  LCGTLGSFIAGSQMPLFAL---GIAQALVSYYMDWETTQNEVKRISILFCCGSVITVIVH  721

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIS-AITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  +++  + +D  +++  + 
Sbjct  722  TIEHTTFGIMGERLTLRVRQNMFSAILRNEIGWFDKVDNTSSMLALRLESDATLLRTIVV  781

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFV-ATGLIARVRKS  544
            ++    +  +   +  F I FI  W+++LV L+  PLI ++G +   +   G    + K+
Sbjct  782  DRSTILLENLGLVVTSFIISFILNWRLTLVVLATYPLI-ISGHISEKIFMQGYGGNLSKA  840

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y++A  +A E + N+RTV AF
Sbjct  841  YLKANMLAGESISNIRTVAAF  861



>ref|XP_010055294.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW71762.1| hypothetical protein EUGRSUZ_E00260 [Eucalyptus grandis]
Length=1255

 Score =   360 bits (923),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGACVHG SVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  53   LMAVGSVGACVHGVSVPVFFIFFGKLINVIGMAYLFPKEASHKVAKYSLDFVYLSVAILF  112

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYLRSML+QDIS+FDTEASTGEVISAIT+DII+VQDA+
Sbjct  113  SSWIEVACWMHTGERQAAKMRMAYLRSMLSQDISIFDTEASTGEVISAITSDIILVQDAL  172

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRF+ GF IGF+R+WQI+LVTLSIVPLIA+AGG+YA+VATGLIAR RKS
Sbjct  173  SEKVGNFIHYISRFLGGFIIGFVRVWQITLVTLSIVPLIAIAGGLYAYVATGLIARARKS  232

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTV AF
Sbjct  233  YVKAGEIAEEVIGNVRTVHAF  253


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    +   +   ++      H+V K SL F   ++V +     
Sbjct  696  GTICALIAGAQMPLFAL---GVSQALVSYYMGWETTKHEVKKISLLFCGAAVVTVIVHAI  752

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + ++
Sbjct  753  EHCCFGIMGERLTLRVRERMFAAILKNEIGWFDDVNNTSAMLSSRLETDATLLRTVVVDR  812

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+I+LV ++  PLI            G    + K+Y+R
Sbjct  813  ATILLQNMGLVLGSFVIAFILNWRITLVVIATYPLIISGHISEKMFMRGYGGNLSKAYLR  872

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RT+ AF
Sbjct  873  ANMLAGEAVSNIRTIAAF  890



>ref|XP_010908483.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1249

 Score =   359 bits (922),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VAKYSLDFVYL IVIL
Sbjct  43   FLMALGSIGACVHGASVPVFFIFFGKLINIIGVAYLFPTSVTHRVAKYSLDFVYLGIVIL  102

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWMHTGERQAAKMR+AYLRSML+QDI +FDTEASTGEVISAIT+DIIVVQDA
Sbjct  103  FSSWIEVACWMHTGERQAAKMRLAYLRSMLDQDIGVFDTEASTGEVISAITSDIIVVQDA  162

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHYISRFI GF IGF R+WQI LVTLSIVPLIA+AGG+YA++ATGLIARVRK
Sbjct  163  ISEKVGNFMHYISRFIGGFAIGFARIWQIGLVTLSIVPLIAIAGGIYAYIATGLIARVRK  222

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  223  SYVKAGEIAEEVIGNVRTVQAF  244


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 92/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA V G+ +P+F +    +   +   ++       +V K ++ F   +++ +     
Sbjct  687  GTIGALVAGSQMPLFAL---GVTQALVSYYMGWETTQREVKKIAILFCCGAVLTVIFHVI  743

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + ++
Sbjct  744  EHLNFGIMGERLTLRVREKMFGAILRNEIGWFDDTNNTSAMLSSRLETDATLLRTIVVDR  803

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  I   +    I FI  W+++LV L+  PL+            G    + K+Y++
Sbjct  804  STILLQNIGMIVTSLIIAFILNWRLTLVVLATYPLMVSGHISEKLFMQGYGGNLNKAYLK  863

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  864  ANMLAAEAVSNIRTVAAF  881



>ref|XP_011018526.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1253

 Score =   359 bits (922),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS VIL
Sbjct  42   LLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSAVIL  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVACWMHTGERQAAKMRMAYL+SML+QDISLFDTEASTGEVI+AIT+DIIVVQDA
Sbjct  102  FASWIEVACWMHTGERQAAKMRMAYLKSMLSQDISLFDTEASTGEVIAAITSDIIVVQDA  161

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNFMHY+SRF+ GF IGF+R+WQISLVTLSIVPLIALAGG+YA++  GLIA+VRK
Sbjct  162  ISEKVGNFMHYVSRFLGGFIIGFVRIWQISLVTLSIVPLIALAGGIYAYITIGLIAKVRK  221

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AG+IA+EV+GNVRTVQAF
Sbjct  222  SYVKAGQIAEEVIGNVRTVQAF  243


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 97/200 (49%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H+V K ++ F   +++ +   
Sbjct  682  VGTIGAFVAGSLMPLFALGVTQAL----VAFYMDWDMTRHEVKKIAILFCCGAVISVIFY  737

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  738  GIEHLSFGIMGERLTLRVREMMFSAILRNEIGWFDDFNNTSSMLTSRLESDATLLRTIVV  797

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +H +   +  F I FI  W+I+LV ++  PLI            G    + K+Y
Sbjct  798  DRSTVLLHNVGLVVTSFVIAFILSWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAY  857

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  858  LKANMLAGEAVSNIRTVAAF  877



>ref|XP_006303653.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
 gb|EOA36551.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
Length=1229

 Score =   358 bits (920),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G + AC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  41   LMALGSIAACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVVILF  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDAI
Sbjct  101  SSWIEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAI  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFV TGL  RVRKS
Sbjct  161  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVGTGLTVRVRKS  220

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  221  YVKANEIAEEVIGNVRTVQAFT  242


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 97/200 (49%), Gaps = 4/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
            F G +G+ V GA +P+F +    I D +   ++      ++V + S+ F   S++ + S 
Sbjct  665  FCGTLGSFVSGAQMPLFAL---GISDALVSYYMDWDTTRNEVKRISILFCCASVITVISH  721

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  722  IIEHTSFGIVGERLTLRVRQKMFTAILRNEIGWFDKVDNTSSMLASRLESDATLLKTIVV  781

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  ++  +  F I FI  W+++LV L+  PLI            G    + K+Y
Sbjct  782  DRSTILLENLALVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  841

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E + N+RTV AF
Sbjct  842  LKANMLAGESISNIRTVAAF  861



>gb|KFK29108.1| hypothetical protein AALP_AA7G090300 [Arabis alpina]
Length=1235

 Score =   358 bits (920),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP E SH+VAKYSLDFVYLS+ ILF
Sbjct  37   LMALGSIGACIHGASVPIFFIFFGKLINIIGVAYLFPKETSHQVAKYSLDFVYLSVAILF  96

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV+CWMHTGERQAAKMR AYLRSML+QDISL+DTEASTGEVISAIT+DI+VVQDA+
Sbjct  97   SSWLEVSCWMHTGERQAAKMRRAYLRSMLSQDISLYDTEASTGEVISAITSDILVVQDAL  156

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  157  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  216

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  217  YIKAGEIAEEVIGNVRTVQAFT  238


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 77/161 (48%), Gaps = 1/161 (1%)
 Frame = +2

Query  128  HKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS  307
             +V K ++ F   S++ L     E  C+   GER   ++R     ++L  +I  FD   +
Sbjct  708  KEVKKIAILFCCASVITLIVYTIEHICFSTMGERLTLRVREKMFSAILKNEIGWFDEVDN  767

Query  308  TGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIA  484
            T  ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV L+  PL+ 
Sbjct  768  TSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVIAFMLNWRLTLVVLATFPLVI  827

Query  485  LAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                       G    + K+Y++A  +A E V N+RTV AF
Sbjct  828  CGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  868



>ref|XP_010475946.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1224

 Score =   358 bits (919),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G  GAC+HGASVPVFF+FFGK+I++IG A+LFP EAS KVAKYSLDFVYLS+VILF
Sbjct  39   LMALGSTGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASPKVAKYSLDFVYLSVVILF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDAI
Sbjct  99   SSWIEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG+YAFV TGLIARVRKS
Sbjct  159  SEKVGNFLHYISRFIAGFVIGFTSVWQISLVTLAIVPLIALAGGIYAFVGTGLIARVRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  219  YVKANEIAEEVIGNVRTVQAFT  240


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +G+ V GA +P+F +    I + +   ++      H+V + S+ F   S++ + S   
Sbjct  665  GTLGSFVAGALMPLFAL---GISEALVSYYMDWDTTQHEVKRISILFCCASVITVISHTI  721

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
                +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  722  GHTSFGIMGERLTLRVRQKMFSAILRNEIGWFDKVDNTSSMLASRLESDAALLKTIVVDR  781

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+++LV L+  PLI            G    + K+Y++
Sbjct  782  STILLENLGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAYLK  841

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  842  ANMLAGESISNIRTVAAF  859



>ref|XP_006471591.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006471592.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Citrus sinensis]
Length=1265

 Score =   358 bits (920),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVAKYSLDFVYLS+ ILF
Sbjct  57   LMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVAKYSLDFVYLSVAILF  116

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV+CWM+TGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  117  SSWIEVSCWMYTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  176

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+ GF IGF R+WQISLVTLSIVPLIALAGG+YA+V  GLIARVRKS
Sbjct  177  SEKVGNFMHYISRFLGGFIIGFARVWQISLVTLSIVPLIALAGGMYAYVTIGLIARVRKS  236

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  237  YVKAGEIAEEVIGNVRTVQAF  257


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 93/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK-VAKYSLDFVYLSIVILFSSW  193
            G + A + GA +P+F +   + +     A+    + + + V K ++ F   +++ +    
Sbjct  701  GTICAIIAGAQMPLFALGVSQAL----VAYYMDWDTTQREVKKITILFCCAAVITVIVHA  756

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L+ +I  FD   ++  ++ S + +D  +++  + +
Sbjct  757  IEHLSFGIMGERLTLRVREKMFSAILSNEIGWFDEMDNSSSILASRLESDATLLRTIVVD  816

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +       A F I FI  W+I+LV ++  PLI            G    + K+Y+
Sbjct  817  RSTILIQNFGLVAASFVIAFILNWRITLVVVATYPLIISGHISEKLFFQGYGGNLSKAYL  876

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  877  KANMLAAEAVSNIRTVAAF  895



>ref|XP_009139729.1| PREDICTED: ABC transporter B family member 2 [Brassica rapa]
Length=1234

 Score =   358 bits (919),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVAKYSLDFVYLS+ ILF
Sbjct  36   LMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  156  SEKVGNFLHYISRFIAGFAIGFSSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  216  YIKAGEIAEEVIGNVRTVQAFT  237


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 77/164 (47%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            +   +V K ++ F   S + L     E  C+   GER   ++R     ++L  +I  FD 
Sbjct  705  DTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNEIGWFDE  764

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV ++  P
Sbjct  765  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVVATYP  824

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  825  LVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  868



>ref|XP_011028150.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1250

 Score =   358 bits (919),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+VAKYSLDFVYLS+VILF
Sbjct  43   LMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVAKYSLDFVYLSVVILF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +SW EVACWMHTGERQAAKMRMAYL+SML+QDIS+FDTEASTGEVI+AIT+DIIVVQDAI
Sbjct  103  ASWIEVACWMHTGERQAAKMRMAYLKSMLSQDISVFDTEASTGEVIAAITSDIIVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+ GF IGF+R+WQISLVTLSIVPLIALAGG+YA+V+ GLIA+VRKS
Sbjct  163  SEKVGNFMHYISRFLGGFIIGFVRIWQISLVTLSIVPLIALAGGIYAYVSIGLIAKVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A ++A+EV+GNVRTVQAFT
Sbjct  223  YVKASQVAEEVIGNVRTVQAFT  244


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 96/200 (48%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA + G+S+P+F +   + +     A+    + + H+V K ++ F   + + +   
Sbjct  685  VGTMGAFIAGSSMPLFALGVSQAL----VAYYMDWDTTRHEVKKIAILFCCGAAISVIVY  740

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD  ++T  ++ S + +D  +++  + 
Sbjct  741  AIEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDLSNTSSMLTSRLESDATLLRTIVV  800

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  +   +  F I F   W+I+LV ++  PLI            G    + K+Y
Sbjct  801  DRSTILLQNVGLVVTSFIIAFTLNWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAY  860

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  861  LKANMLAGEAVSNIRTVAAF  880



>emb|CDX94395.1| BnaC01g17890D [Brassica napus]
Length=1234

 Score =   358 bits (918),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVP+FF+FFGK+I++IG A+L+P  ASHKVAKYSLDFVYLS+ ILF
Sbjct  36   LMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  156  SEKVGNFLHYISRFIAGFAIGFSSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  216  YIKAGEIAEEVIGNVRTVQAFT  237


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 77/164 (47%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            +   +V K ++ F   S + L     E  C+   GER   ++R     ++L  +I  FD 
Sbjct  705  DTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNEIGWFDE  764

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV ++  P
Sbjct  765  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVVATFP  824

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  825  LVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  868



>ref|XP_006417431.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
 gb|ESQ35784.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
Length=1226

 Score =   357 bits (917),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVAKYSLDFVYLS+VILF
Sbjct  36   LMVLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQQASHKVAKYSLDFVYLSVVILF  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDA+
Sbjct  96   SSWLEVACWMHTGERQAAKMRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAL  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H +SRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAF+ TGL+ RVRKS
Sbjct  156  SEKVGNFLHCMSRFIAGFVIGFTSVWQISLVTLSIVPLIALAGGIYAFIGTGLVVRVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+AGEIA+EV+GNVRTVQAFT
Sbjct  216  YVKAGEIAEEVIGNVRTVQAFT  237


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/198 (24%), Positives = 93/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +G+ + G+ +P+F +    I   +   ++      H+V + S+ F   S++ + +   
Sbjct  662  GTLGSLIAGSQMPLFAL---GISQALVSYYMDWETTQHEVKRISIFFCCASVITVIAHAI  718

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  719  EHTTFGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASRLESDATLLRTIVVDR  778

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +      +  F I FI  W+++LV L+  PLI            G    + K+Y++
Sbjct  779  STILLENFGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGGNLSKAYMK  838

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  839  ANMLAGESVSNIRTVAAF  856



>emb|CDX89380.1| BnaA01g15130D [Brassica napus]
Length=1275

 Score =   358 bits (919),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVAKYSLDFVYLS+ ILF
Sbjct  77   LMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVAKYSLDFVYLSVAILF  136

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+DI+VVQDA+
Sbjct  137  SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDAL  196

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  197  SEKVGNFLHYISRFIAGFAIGFSSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  256

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  257  YIKAGEIAEEVIGNVRTVQAFT  278


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 77/164 (47%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            +   +V K ++ F   S + L     E  C+   GER   ++R     ++L  +I  FD 
Sbjct  746  DTQKEVKKIAILFCCASAITLIVYTIEHICFGTMGERLTLRVREKMFSAILRNEIGWFDE  805

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV ++  P
Sbjct  806  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVVATYP  865

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  866  LVISGHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  909



>ref|XP_010540773.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1250

 Score =   357 bits (916),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EAS +VAKYSLDFVYLS+ ILF
Sbjct  45   LMAIGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPKEASPQVAKYSLDFVYLSVAILF  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYL SML QDIS+FDTEASTGEVISAIT+DIIVVQDA+
Sbjct  105  SSWIEVACWMHTGERQAAKMRMAYLSSMLRQDISVFDTEASTGEVISAITSDIIVVQDAL  164

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRF AGF IGF R+WQISLVTLSIVPLIALAGG+YA++ATGL+ARVRKS
Sbjct  165  SEKVGNFLHYISRFTAGFAIGFARVWQISLVTLSIVPLIALAGGLYAYIATGLLARVRKS  224

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  225  YVKAGEIAEEVIGNVRTVQAF  245


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA + GA +P+F +    +   +   ++      H+V + S+ F   +IV +     
Sbjct  686  GMIGALIAGAQMPLFAL---GVSHALVSYYMDWDTTRHEVRRISILFCCAAIVTVIVHTI  742

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  743  EHTSFGIMGERLTLRVREMMFSAVLKNEIGWFDDMNNTSSMLASRLESDATLMRTIVVDR  802

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +A F I FI  W+++LV L+  PL+            G    + K+Y++
Sbjct  803  STILLQNVGLVVASFIISFILNWRLTLVVLATYPLVISGHISEKLFMQGYGGNLSKAYLK  862

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  IA E V N+RTV AF
Sbjct  863  ANMIAGEAVSNIRTVAAF  880



>ref|XP_008800115.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1250

 Score =   357 bits (916),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VAKYSLDFVYL IVIL
Sbjct  43   FLMALGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPTSVTHRVAKYSLDFVYLGIVIL  102

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMR+AYLRSML+QDI +FDTEASTGEVI+AIT+DIIVVQDA
Sbjct  103  FSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIGVFDTEASTGEVIAAITSDIIVVQDA  162

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HYISRF+AGF +GF  +WQI LVTLSIVPLIA+AGG+YA++ATGLIARVRK
Sbjct  163  ISEKVGNFLHYISRFVAGFAVGFAHIWQIGLVTLSIVPLIAIAGGIYAYIATGLIARVRK  222

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+GNVRTVQAF
Sbjct  223  SYVKAGEIAEEVIGNVRTVQAF  244


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 92/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G +GA V G+ +P+F +    +   +   ++       +V K ++ F   +++ +     
Sbjct  688  GTIGALVAGSQMPLFAL---GVTQALVSYYMGWETTQREVKKIAILFCGGAVLTVIFHVI  744

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + ++
Sbjct  745  EHLNFGIMGERLTVRVREEMFGAILRNEIGWFDDTNNTSAMLSSRLETDATLLRTIVVDR  804

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  I   +    I FI  W+++LV L+  PL+            G    + K+Y++
Sbjct  805  STILLQNIGMIVTSLIIAFILNWRLTLVVLATYPLMVSGHISEKLFMQGYGGNLNKAYLK  864

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  865  ANMLAAEAVSNIRTVAAF  882



>ref|XP_002304346.1| P-glycoprotein [Populus trichocarpa]
 gb|EEE79325.1| P-glycoprotein [Populus trichocarpa]
Length=1250

 Score =   357 bits (916),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYSLDFVYLS+VILF
Sbjct  43   LMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYSLDFVYLSVVILF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +SW EVACWMHTGERQAAKMRMAYL+SML+QDISLFDTEASTGEVI+AIT+DIIVVQDAI
Sbjct  103  ASWIEVACWMHTGERQAAKMRMAYLKSMLSQDISLFDTEASTGEVIAAITSDIIVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+ GF IGF+R+WQISLVTLSIVPLIALAGG+YA++  GLIA+VRKS
Sbjct  163  SEKVGNFMHYISRFLGGFIIGFVRIWQISLVTLSIVPLIALAGGIYAYITIGLIAKVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A ++A+EV+GNVRTVQAFT
Sbjct  223  YVKASQVAEEVIGNVRTVQAFT  244


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 93/199 (47%), Gaps = 4/199 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +GA + G+++P+F +    +   +   ++      H+V K ++ F   + + +    
Sbjct  685  LGTMGAFIAGSAMPLFAL---GVSQALVAYYMDWDTTRHEVKKIAILFCCGAAISVIVYA  741

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + +
Sbjct  742  IEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDLNNTSSMLTSRLESDATLLRTIVVD  801

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  +   +  F I F   W+I+LV ++  PLI            G    + K+Y+
Sbjct  802  RSTILLQNVGLVVTSFIIAFTLNWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAYL  861

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E V N+RTV AF
Sbjct  862  KANMLAGEAVSNIRTVAAF  880



>gb|KGN60362.1| hypothetical protein Csa_3G901080 [Cucumis sativus]
Length=1272

 Score =   355 bits (912),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVAKYSLDF+YLS+ ILF
Sbjct  69   LMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVAKYSLDFLYLSVAILF  128

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMH+GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  129  SSWAEVACWMHSGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIAAITSDIVVVQDAI  188

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFI+GF IGF+R+WQISLVTLSIVPLIALAGG+YAFV  GLIA+VRKS
Sbjct  189  SEKVGNFLHYISRFISGFIIGFVRVWQISLVTLSIVPLIALAGGLYAFVTIGLIAKVRKS  248

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+E++GNVRTVQAF
Sbjct  249  YVKAGEIAEEILGNVRTVQAF  269


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H++ K SL F   +++ +   
Sbjct  710  VGVIGAFVTGSQMPLFALGVSQAL----VAFYMDWDTTQHEIKKISLLFCGGAVLTVIFH  765

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + 
Sbjct  766  AVEHLCFGIMGERLTLRVREMMFHAILRNEIGWFDDMNNTSAMLSSRLETDATLLRTIVV  825

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  ++  +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  826  DRSTILLQNLALVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  885

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E VGN+RTV AF
Sbjct  886  LKANTLAGEAVGNIRTVAAF  905



>ref|XP_008465999.1| PREDICTED: ABC transporter B family member 2-like [Cucumis melo]
Length=1237

 Score =   355 bits (910),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVAKYSLDF+YLS+ ILF
Sbjct  34   LMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVAKYSLDFLYLSVAILF  93

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMH+GERQAAKMRMAYL+SMLNQDISLFDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  94   SSWAEVACWMHSGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVIAAITSDIVVVQDAI  153

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFI+GF IGF+R+WQISLVTLSIVPLIALAGG+YAFV  GLIA+VRKS
Sbjct  154  SEKVGNFLHYISRFISGFIIGFVRVWQISLVTLSIVPLIALAGGLYAFVTIGLIAKVRKS  213

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+E++GNVRTVQAF
Sbjct  214  YVKAGEIAEEILGNVRTVQAF  234


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H++ K SL F   +++ +   
Sbjct  675  VGVIGAFVTGSQMPLFALGVSQAL----VAFYMDWDTTQHEIKKISLLFCGGAVLTVIFH  730

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + 
Sbjct  731  AVEHLCFGIMGERLTLRVREMMFHAILRNEIGWFDDMNNTSAMLSSRLETDATLLRTIVV  790

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  ++  +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  791  DRSTILLQNLALVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  850

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E VGN+RTV AF
Sbjct  851  LKANTLAGEAVGNIRTVAAF  870



>ref|NP_172538.1| ABC transporter B family member 10 [Arabidopsis thaliana]
 sp|Q9SGY1.2|AB10B_ARATH RecName: Full=ABC transporter B family member 10; Short=ABC transporter 
ABCB.10; Short=AtABCB10; AltName: Full=Multidrug 
resistance protein 10; AltName: Full=P-glycoprotein 10 [Arabidopsis 
thaliana]
 gb|AEE28628.1| ABC transporter B family member 10 [Arabidopsis thaliana]
Length=1227

 Score =   354 bits (909),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  40   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVVILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+R AYLRSML+QDISLFDTE STGEVISAIT++I+VVQDAI
Sbjct  100  SSWLEVACWMHTGERQAAKIRKAYLRSMLSQDISLFDTEISTGEVISAITSEILVVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMH+ISRFIAGF IGF  +WQISLVTLSIVP IALAGG+YAFV++GLI RVRKS
Sbjct  160  SEKVGNFMHFISRFIAGFAIGFASVWQISLVTLSIVPFIALAGGIYAFVSSGLIVRVRKS  219

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+A EIA+EV+GNVRTVQAFT
Sbjct  220  YVKANEIAEEVIGNVRTVQAFT  241


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 98/201 (49%), Gaps = 6/201 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
              G +G+ + G+ +P+F +    I   +   ++      ++V + S+ F   S++ +   
Sbjct  663  LCGTLGSFIAGSQMPLFAL---GIAQALVSYYMDWETTQNEVKRISILFCCGSVITVIVH  719

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  720  TIEHTTFGIMGERLTLRVRQKMFSAILRNEIGWFDKVDNTSSMLASRLESDATLLRTIVV  779

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFV-ATGLIARVRKS  544
            ++    +  +   +  F I FI  W+++LV L+  PLI ++G +   +   G    + K+
Sbjct  780  DRSTILLENLGLVVTAFIISFILNWRLTLVVLATYPLI-ISGHISEKIFMQGYGGNLSKA  838

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y++A  +A E + N+RTV AF
Sbjct  839  YLKANMLAGESISNIRTVVAF  859



>ref|XP_010240898.1| PREDICTED: ABC transporter B family member 2-like [Nelumbo nucifera]
Length=1246

 Score =   354 bits (909),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G VGACVHGASVPVFF+FFGK+I++IG  +LFP   SHKV KYSLDFVYLSIV+LF
Sbjct  43   LMFLGSVGACVHGASVPVFFIFFGKLINIIGIGYLFPELVSHKVGKYSLDFVYLSIVMLF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV CWMHTGERQAAKMR+AYLR+MLNQDISLFDTEAST EVI+AIT+D+IVVQDAI
Sbjct  103  SSWIEVGCWMHTGERQAAKMRLAYLRAMLNQDISLFDTEASTAEVIAAITSDVIVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF R+WQISLVTLSIVPLIA+AGG+YA++A GL+ARVRKS
Sbjct  163  SEKVGNFIHYISRFIAGFAIGFARVWQISLVTLSIVPLIAIAGGLYAYIAIGLMARVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  223  YVKAGEIAEEVIGNVRTVQAF  243


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 96/199 (48%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVY-LSIVILFSSW  193
            G  GA + GA +P+F +    + + +   ++      H++ K +  F    +  I+F S 
Sbjct  685  GVTGAIMSGAQMPLFAL---GVTEALVAYYMDWNTTRHQIKKIAFLFCGGAAATIIFHSI  741

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
              ++  +  GER   ++R     ++L  +I  FD  ++T  ++S+ + +D  +++  + +
Sbjct  742  EHLSFGI-IGERLTLRVREKMFAAILRNEIGWFDDTSNTSSMLSSRLESDATLLRTIVVD  800

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +  IS     F I F   W+++LV L+  PLI            G    + K+Y+
Sbjct  801  RSTILIMNISMIFTSFIIAFNLNWRVTLVVLATFPLIVSGHISEKLFMKGYGGDLNKAYL  860

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E VGN+RTV AF
Sbjct  861  KANMLAGEAVGNIRTVAAF  879



>gb|KFK43347.1| hypothetical protein AALP_AA1G113900 [Arabis alpina]
Length=1230

 Score =   353 bits (905),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+ FP EASHKVAKYSLDFVYLS+V+LF
Sbjct  39   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYFFPQEASHKVAKYSLDFVYLSVVVLF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AY+RSML+QDISLFDTE+STGEVISAIT+DI+VVQDA+
Sbjct  99   SSWIEVACWMHTGERQAAKMRKAYIRSMLSQDISLFDTESSTGEVISAITSDILVVQDAL  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H +SRFIAGF IGF  +WQI+LVTL+IVP IALAGG+YAFV+TGLIAR+RKS
Sbjct  159  SEKVGNFLHCLSRFIAGFAIGFTSVWQITLVTLAIVPFIALAGGLYAFVSTGLIARIRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+AGEIA+EV+GNVRTVQAFT
Sbjct  219  YVKAGEIAEEVIGNVRTVQAFT  240


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/198 (23%), Positives = 91/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + + + G+ +P+F +    I   +   ++       +V + S+ F   S++ + +   
Sbjct  668  GTLSSLIGGSQMPLFAL---GITQALVSYYMEWDTTQKEVKRISILFCCASVLTVVAHAI  724

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + ++
Sbjct  725  EHTTYGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASRLESDATLLKSIVVDR  784

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +      +  F I FI  W+++LV L+  PLI            G    + K+Y++
Sbjct  785  STILLENFGLIVTSFIISFILNWRLTLVVLATYPLIISGHISERLFMQGYGGNLSKAYLK  844

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  845  ANMLAGESVSNIRTVAAF  862



>ref|XP_006854029.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
 gb|ERN15496.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
Length=1263

 Score =   352 bits (904),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL I ILF
Sbjct  51   LMAIGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPRSVSDRVAKYSLDFVYLGIAILF  110

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWM+TGERQA KMR+AY+RSMLNQDISLFDTEASTGEVISAITTDI+VVQDAI
Sbjct  111  SSWTEVACWMYTGERQARKMRLAYVRSMLNQDISLFDTEASTGEVISAITTDILVVQDAI  170

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRFIAGF IGF+ +WQ+SLVTLSIVPLIA+AGG+YA++ATGL+ARVRKS
Sbjct  171  SEKVGNFMHYISRFIAGFAIGFMHVWQLSLVTLSIVPLIAIAGGIYAYIATGLMARVRKS  230

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  231  YVKAGEIAEEVIGNVRTVQAF  251


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD T  ++  + S + +D  +++  + ++    +  I
Sbjct  759  GERLTLRVREKMFGAILRNEIGWFDNTNNNSAMLASRLESDATLLRTIVVDRSTILLQNI  818

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  I  F I F+  W+I+L+ ++  PL+            G    + K+Y++A  +A E 
Sbjct  819  ALVITSFIIAFMLNWRIALLMIATYPLLISGHISEKLFMQGYGGNLSKAYLQANMLAGEA  878

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  879  VSNIRTVTAF  888



>emb|CDX92739.1| BnaC07g39970D [Brassica napus]
Length=1241

 Score =   352 bits (903),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVAKYSLDFVYLS+VILF
Sbjct  38   LMTLGSIGACIHGASVPVFFIFFGKLINIIGTAYMDRHQASHKVAKYSLDFVYLSVVILF  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTEASTGEVISAIT+D++VVQDA+
Sbjct  98   SSWIEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDMLVVQDAL  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG+YAFVA GLIARVRKS
Sbjct  158  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLAIVPLIALAGGIYAFVAIGLIARVRKS  217

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AG++A+EV+GNVRTVQAFT
Sbjct  218  YIKAGQVAEEVIGNVRTVQAFT  239


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 77/160 (48%), Gaps = 1/160 (1%)
 Frame = +2

Query  131  KVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAST  310
            +V K ++ F + S + L     E  C+   GER   ++R     ++L  ++  FD   +T
Sbjct  709  EVKKIAILFCFASAITLIVHTIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNT  768

Query  311  GEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIAL  487
              ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV L+  PL+  
Sbjct  769  SSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVLATYPLVIS  828

Query  488  AGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                      G    + K+Y++A  +A E V N+RTV AF
Sbjct  829  GHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  868



>emb|CDX93393.1| BnaA06g06550D [Brassica napus]
Length=1225

 Score =   352 bits (902),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  39   LMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVAILF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+R AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDA+
Sbjct  99   SSWLEVACWMHTGERQAAKIRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAL  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H +SRFIAGF IGF  +WQISLVTLSIVPLIA+AGG+YA+V+TGL+A VRKS
Sbjct  159  SEKVGNFLHCMSRFIAGFAIGFASVWQISLVTLSIVPLIAVAGGIYAYVSTGLLASVRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+AGEIA+EV+GNVRTVQAFT
Sbjct  219  YVKAGEIAEEVIGNVRTVQAFT  240


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 93/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK-VAKYSLDFVYLSIVILFSSW  193
            G  G+ V G+ +P+F +   + +     ++    E + K V + S+ F   S++ + S  
Sbjct  665  GLFGSLVAGSQMPLFALGISQAL----VSYYMDWETTQKEVKRISILFCCASVITVISHA  720

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + +
Sbjct  721  IEHTTFGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASQLESDSTLLRTIVVD  780

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +      +  F I FI  W+++LV L+  PLI            G    + K+Y+
Sbjct  781  RSTILLENFGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGVNLNKAYL  840

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E + N+RTV AF
Sbjct  841  KANMLAGEAISNIRTVAAF  859



>ref|XP_009148411.1| PREDICTED: ABC transporter B family member 10 [Brassica rapa]
Length=1225

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  39   LMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVAILF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+R AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDA+
Sbjct  99   SSWLEVACWMHTGERQAAKIRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAL  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H +SRFIAGF IGF  +WQISLVTLSIVPLIA+AGG+YA+V+TGL+A VRKS
Sbjct  159  SEKVGNFLHCMSRFIAGFAIGFASVWQISLVTLSIVPLIAVAGGIYAYVSTGLLASVRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+AGEIA+EV+GNVRTVQAFT
Sbjct  219  YVKAGEIAEEVIGNVRTVQAFT  240


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 98/200 (49%), Gaps = 8/200 (4%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK-VAKYSLDFVYLSIVILFSSW  193
            G  G+ V G+ +P+F +   + +     ++    E + K V + S+ F   S++ + S  
Sbjct  665  GLFGSLVAGSQMPLFALGISQAL----VSYYMDWETTQKEVKRISILFCCASVITVISHA  720

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + +
Sbjct  721  IEHTTFGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASQLESDSTLLRTIVVD  780

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFV-ATGLIARVRKSY  547
            +    +      +  F I FI  W+++LV L+  PLI ++G +   +   G    + K+Y
Sbjct  781  RSTILLENFGLVVTSFIISFILNWRLTLVVLARYPLI-ISGHISEKIFMQGYGVNLNKAY  839

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E + N+RTV AF
Sbjct  840  LKANMLAGEAISNIRTVAAF  859



>ref|XP_010274279.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Nelumbo nucifera]
Length=1252

 Score =   351 bits (901),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP   SHKVA Y+LDFVYLSIV++F
Sbjct  43   LMLLGSVGACVHGASVPVFFIFFGKLINIIGVAYLFPTLVSHKVAMYALDFVYLSIVVMF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV+CWM+TGERQAAKMR+ YL+SMLNQDISLFDTEAST EVISAIT+D+IVVQDAI
Sbjct  103  SSWIEVSCWMYTGERQAAKMRLVYLKSMLNQDISLFDTEASTAEVISAITSDVIVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEK+GNFMHYISRFIAGF IGF R+WQISLVTLSIVPLIA+AGGVYA++A GL+ARVRKS
Sbjct  163  SEKIGNFMHYISRFIAGFAIGFARVWQISLVTLSIVPLIAIAGGVYAYIAIGLMARVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  223  YVKAGEIAEEVIGNVRTVQAF  243


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/198 (24%), Positives = 92/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G  GA + GA +P+F +    +   +   ++      H++ K +  F   ++V +     
Sbjct  686  GVTGAIMSGAQMPLFAL---GVTQALVAYYMDWDTTRHQIKKIAFLFCGGAVVTVIFHSI  742

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +I  FD   +T  ++S+ +  D  +++  + ++
Sbjct  743  EHLSFGIIGERLTLRVREKMFAAILRNEIGWFDDTNNTSSMLSSRLEADATLLRTIVVDR  802

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  IS  +  F I F+  W+I+LV ++  PLI            G    + ++Y++
Sbjct  803  YSILIMNISMIVTSFIIAFLLNWRITLVIMATYPLIVSGHISEKLFMKGYGGNLNQAYLK  862

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RTV AF
Sbjct  863  ANMLAGEAVSNIRTVAAF  880



>gb|KHN04865.1| ABC transporter B family member 2 [Glycine soja]
Length=1246

 Score =   350 bits (897),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILF
Sbjct  41   LMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILF  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVIS+IT+DII+VQDA+
Sbjct  101  SSWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISSITSDIIIVQDAL  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRK+
Sbjct  161  SEKVGNFMHYISRFVAGFVIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKA  220

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  221  YVRAGEIAEEVIGNVRTVQAF  241


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 94/203 (46%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F    G + A + GA +P+F +    I   +   ++      H+V K +  F   +++ +
Sbjct  680  FYGVAGTLCAFIAGAQMPLFAL---GISHALVSYYMDWETTCHEVKKIAFLFCGAAVITV  736

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQD  358
                 E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++ 
Sbjct  737  TVHAIEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDTNNTSSMLSSQLETDATLLRT  796

Query  359  AISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVR  538
             + ++    +  I   +A F + FI  W+I+LV ++  PLI            G    + 
Sbjct  797  IVVDRSTILLQNIGLVVASFIVAFILNWRITLVVIATYPLIISGHISEKLFMKGYGGNLS  856

Query  539  KSYVRAGEIAQEVVGNVRTVQAF  607
            K+Y++A  +A E V N+RTV AF
Sbjct  857  KAYLKANMLAGEAVSNIRTVAAF  879



>ref|XP_003517674.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1246

 Score =   350 bits (897),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILF
Sbjct  41   LMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILF  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL+SMLNQDISLFDTEASTGEVIS+IT+DII+VQDA+
Sbjct  101  SSWTEVACWMHTGERQAAKMRMAYLKSMLNQDISLFDTEASTGEVISSITSDIIIVQDAL  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF+R+WQISLVTLSIVPLIALAGG+YA+V  GLIA+VRK+
Sbjct  161  SEKVGNFMHYISRFVAGFVIGFVRVWQISLVTLSIVPLIALAGGLYAYVTIGLIAKVRKA  220

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAGEIA+EV+GNVRTVQAF
Sbjct  221  YVRAGEIAEEVIGNVRTVQAF  241


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 94/203 (46%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F    G + A + GA +P+F +    I   +   ++      H+V K +  F   +++ +
Sbjct  680  FYGVAGTLCAFIAGAQMPLFAL---GISHALVSYYMDWETTCHEVKKIAFLFCGAAVITV  736

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQD  358
                 E   +   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++ 
Sbjct  737  TVHAIEHLSFGIMGERLTLRVREMMFSAILKNEIGWFDDTNNTSSMLSSQLETDATLLRT  796

Query  359  AISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVR  538
             + ++    +  I   +A F + FI  W+I+LV ++  PLI            G    + 
Sbjct  797  IVVDRSTILLQNIGLVVASFIVAFILNWRITLVVIATYPLIISGHISEKLFMKGYGGNLS  856

Query  539  KSYVRAGEIAQEVVGNVRTVQAF  607
            K+Y++A  +A E V N+RTV AF
Sbjct  857  KAYLKANMLAGEAVSNIRTVAAF  879



>emb|CDY37953.1| BnaC05g08210D [Brassica napus]
Length=1225

 Score =   349 bits (895),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+ ILF
Sbjct  39   LMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVAILF  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+R AYLRSML+QDISLFDTE+STGEVISAIT+DI+VVQDA+
Sbjct  99   SSWLEVACWMHTGERQAAKIRKAYLRSMLSQDISLFDTESSTGEVISAITSDILVVQDAL  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+H +SRF AGF IGF  +WQISLVTLSIVPLIA+AGG+YA+V+TGL++ VRKS
Sbjct  159  SEKVGNFLHCMSRFTAGFAIGFASVWQISLVTLSIVPLIAVAGGIYAYVSTGLLSSVRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV+AGEIA+EV+GNVRTVQAFT
Sbjct  219  YVKAGEIAEEVIGNVRTVQAFT  240


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 93/199 (47%), Gaps = 6/199 (3%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK-VAKYSLDFVYLSIVILFSSW  193
            G  G+ V G+ +P+F +   + +     ++    E + K V + S+ F   S++ + S  
Sbjct  665  GLFGSLVAGSQMPLFALGISQAL----VSYYMDWETTQKEVKRISILFCCASVITVISHA  720

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + +
Sbjct  721  IEHTTFGIMGERLTLRVRQMMFSAILRNEIGWFDKVDNTSSMLASQLESDSTLLRTIVVD  780

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +      +  F I FI  W+++LV L+  PLI            G    + K+Y+
Sbjct  781  RSTILLENFGLVVTSFIISFILNWRLTLVVLATYPLIISGHISEKLFMQGYGVNLNKAYL  840

Query  551  RAGEIAQEVVGNVRTVQAF  607
            +A  +A E + N+RTV AF
Sbjct  841  KANMLAGEAISNIRTVAAF  859



>ref|XP_010677330.1| PREDICTED: ABC transporter B family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=1256

 Score =   349 bits (895),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMF G +GA  HGASVPVFF+FFGK+I++IG A+LFP E SH VAKYSLDFVYLS+VIL
Sbjct  54   LLMFFGTIGAIAHGASVPVFFIFFGKLINLIGVAYLFPRETSHDVAKYSLDFVYLSVVIL  113

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSW EVACWM TGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI+AIT+DI++VQDA
Sbjct  114  FSSWVEVACWMQTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVINAITSDILIVQDA  173

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVG  +HYISRFIAGF IGF R+WQISL+TLSIVP IA AGG+YA+VATGLIARVRK
Sbjct  174  ISEKVGKILHYISRFIAGFAIGFARVWQISLITLSIVPAIAFAGGIYAYVATGLIARVRK  233

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SYV+AGEIA+EV+ NVRTVQAF
Sbjct  234  SYVKAGEIAEEVIANVRTVQAF  255


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 78/160 (49%), Gaps = 1/160 (1%)
 Frame = +2

Query  131  KVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAST  310
            +V K +L F   ++V + +     +C+   GER   ++R     ++L+ +I  FD   ++
Sbjct  731  EVRKIALLFCGGAVVCIANHGLAHSCFGIMGERLTLRVRQKMFSAILSNEIGWFDDSRNS  790

Query  311  GEVISA-ITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIAL  487
               IS+ + +D  +++  + ++    +      I  F I F+  W+++LV LS+ PLI  
Sbjct  791  SSTISSRLESDATLLKSIVVDRTTILLLNCGFVITAFIIAFMLNWRLTLVVLSMYPLIIS  850

Query  488  AGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                      G    + K+Y+ A  +A E V N+RTV AF
Sbjct  851  GHFSEKLFMQGFGGNLSKAYLGANMLAGEAVSNMRTVAAF  890



>ref|XP_003572841.1| PREDICTED: ABC transporter B family member 2-like [Brachypodium 
distachyon]
Length=1256

 Score =   349 bits (895),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP E S +VAKYSLDFVYL +VILF
Sbjct  40   LMAVGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPTEVSGRVAKYSLDFVYLGVVILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR+AYLRSML QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  100  SSWTEVACWMHTGERQAAKMRLAYLRSMLEQDIAVFDTEASTGEVINAITSDILVVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGGVYA+V  GL+ARVRKS
Sbjct  160  SEKVGNFMHYISRFVAGFAIGFSQVWQISLVTLAIVPLIAIAGGVYAYVTIGLMARVRKS  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+E +GNVRTVQAF
Sbjct  220  YVKAGEIAEEAIGNVRTVQAF  240


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD+ + T  ++S+ + TD  +V+  + ++    +  +
Sbjct  753  GERLTLRVREKMFAAILRNEIGWFDSTSHTSAMLSSRLETDATLVRTIVVDRSTILLQNV  812

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  813  GMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  872

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  873  VSNIRTVAAF  882



>gb|EEC73824.1| hypothetical protein OsI_08549 [Oryza sativa Indica Group]
Length=1264

 Score =   348 bits (892),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL IVILF
Sbjct  51   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGIVILF  110

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR AYLRSML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  111  SSWTEVACWMHTGERQAAKMRQAYLRSMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  170

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG+YA+V  GL+ARVRKS
Sbjct  171  SEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGIYAYVTIGLMARVRKS  230

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  231  YVKAGEIAEEVIGNVRTVQAF  251


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  + T  ++S+ + TD  +V+  + ++    +  I
Sbjct  762  GERLTLRVRERMFAAILRNEIGWFDDTSHTSSMLSSRLETDATLVRTIVVDRSTILLQNI  821

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  822  GMIVTSLIIAFIINWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  881

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  882  VSNIRTVAAF  891



>ref|NP_001047803.1| Os02g0693700 [Oryza sativa Japonica Group]
 emb|CAD59583.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07906.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07706.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09717.1| Os02g0693700 [Oryza sativa Japonica Group]
 gb|EEE57613.1| hypothetical protein OsJ_08005 [Oryza sativa Japonica Group]
Length=1264

 Score =   347 bits (891),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL IVILF
Sbjct  51   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGIVILF  110

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR AYLRSML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  111  SSWTEVACWMHTGERQAAKMRQAYLRSMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  170

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG+YA+V  GL+ARVRKS
Sbjct  171  SEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGIYAYVTIGLMARVRKS  230

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  231  YVKAGEIAEEVIGNVRTVQAF  251


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  + T  ++S+ + TD  +V+  + ++    +  I
Sbjct  762  GERLTLRVRERMFAAILRNEIGWFDDTSHTSSMLSSRLETDATLVRTIVVDRSTILLQNI  821

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  822  GMIVTSLIIAFIINWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  881

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  882  VSNIRTVAAF  891



>emb|CDY42770.1| BnaA03g47690D [Brassica napus]
Length=1135

 Score =   346 bits (887),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVAKYSLDFVYLS+ ILF
Sbjct  38   LMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVAKYSLDFVYLSVAILF  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRS+L+QDISLFDTEAS+GEVISAIT+DI+VVQDA+
Sbjct  98   SSWLEVACWMHTGERQAAKMRRAYLRSILSQDISLFDTEASSGEVISAITSDILVVQDAL  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG+YAFVA GLIARVRKS
Sbjct  158  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLAIVPLIALAGGMYAFVAIGLIARVRKS  217

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AG++A+EV+GNVRTVQAFT
Sbjct  218  YIKAGQVAEEVIGNVRTVQAFT  239


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 16/159 (10%)
 Frame = +2

Query  131  KVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAST  310
            +V K ++ F + S + L     E  C+   GER   ++R     ++L  ++  FD   +T
Sbjct  620  EVKKIAILFCFASAITLIVYSIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNT  679

Query  311  GEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALA  490
                S++    I++Q+            +   +  F I F+  W+++LV L+  PL+   
Sbjct  680  ----SSMLASTILLQN------------LGLVVTSFVISFMLNWRLTLVVLATYPLVISG  723

Query  491  GGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                     G    + K+Y++A  +A E V N+RTV AF
Sbjct  724  HISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  762



>ref|XP_004953524.1| PREDICTED: ABC transporter B family member 2-like [Setaria italica]
Length=1257

 Score =   347 bits (889),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL IVILF
Sbjct  43   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGIVILF  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR+AYLR+ML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  103  SSWTEVACWMHTGERQAAKMRLAYLRAMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG YA+V  GL+ARVRKS
Sbjct  163  SEKVGNFMHYISRFVAGFAIGFSQVWQISLVTLAIVPLIAIAGGTYAYVTIGLMARVRKS  222

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  223  YVKAGEIAEEVIGNVRTVQAF  243


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  ++T  ++S+ +  D  +V+  + ++    +  +
Sbjct  754  GERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSSRLEADATLVRTIVVDRSTILLQNV  813

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  814  GMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  873

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  874  VSNIRTVAAF  883



>ref|XP_006647720.1| PREDICTED: ABC transporter B family member 2-like [Oryza brachyantha]
Length=1261

 Score =   346 bits (887),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL +VILF
Sbjct  50   LMAMGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGVVILF  109

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR AYLRSML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  110  SSWTEVACWMHTGERQAAKMRQAYLRSMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  169

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG+YA+V  GL+ARVRKS
Sbjct  170  SEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGIYAYVTIGLMARVRKS  229

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  230  YVKAGEIAEEVIGNVRTVQAF  250


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  + T  ++S+ + TD  +V+  + ++    +  +
Sbjct  761  GERLTLRVRERMFAAILRNEIGWFDDTSHTSSMLSSRLETDATLVRTIVVDRSTILLQNV  820

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  821  GMIVTSLIIAFIINWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  880

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  881  VSNIRTVAAF  890



>ref|XP_002452712.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
 gb|EES05688.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
Length=1260

 Score =   345 bits (884),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL +VILF
Sbjct  48   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGVVILF  107

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR AYLR+ML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  108  SSWTEVACWMHTGERQAAKMRQAYLRAMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  167

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG YA+V  GL+ARVRKS
Sbjct  168  SEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGTYAYVTIGLMARVRKS  227

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  228  YVKAGEIAEEVIGNVRTVQAF  248


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  ++T  ++S+ +  D  +V+  + ++    +  I
Sbjct  759  GERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSSRLEADATLVRTIVVDRSTILLQNI  818

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  819  GMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGNLSKSYLKANMLAAEA  878

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  879  VSNIRTVAAF  888



>ref|XP_008676453.1| PREDICTED: uncharacterized protein LOC100191944 isoform X1 [Zea 
mays]
 gb|ACN33264.1| unknown [Zea mays]
 gb|AFW63454.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=1262

 Score =   344 bits (883),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL IVI F
Sbjct  45   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGIVIFF  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR+AYLR+ML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  105  SSWTEVACWMHTGERQAAKMRLAYLRAMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  164

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGF ++WQISLVTL+IVPLIA+AGG YA+V  GL+ARVRKS
Sbjct  165  SEKVGNFMHYISRFLAGFAIGFSQVWQISLVTLAIVPLIAIAGGTYAYVTIGLMARVRKS  224

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  225  YVKAGEIAEEVIGNVRTVQAF  245


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD  ++T  ++S+ +  D  +V+  + ++    +  +
Sbjct  757  GERLTLRVREKMFSAILRNEIGWFDDTSNTSAMLSSRLEADATLVRTIVVDRSTILLQNV  816

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  817  GMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  876

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  877  VSNIRTVAAF  886



>ref|XP_009137566.1| PREDICTED: ABC transporter B family member 2-like [Brassica rapa]
Length=1241

 Score =   343 bits (879),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVAKYSLDFVYLS+ ILF
Sbjct  38   LMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVAKYSLDFVYLSVAILF  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW E ACWMHTGERQAAKMR AYLRS+L+QDISLFDTEAS+GEVISAIT+DI+VVQDA+
Sbjct  98   SSWLEAACWMHTGERQAAKMRRAYLRSILSQDISLFDTEASSGEVISAITSDILVVQDAL  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFIAGF IGF  +WQISLVTL+IVPLIALAGG YAFVA GLI+RVRKS
Sbjct  158  SEKVGNFLHYISRFIAGFAIGFTSVWQISLVTLAIVPLIALAGGFYAFVAIGLISRVRKS  217

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AG++A+EV+GNVRTVQAFT
Sbjct  218  YIKAGQVAEEVIGNVRTVQAFT  239


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 77/160 (48%), Gaps = 1/160 (1%)
 Frame = +2

Query  131  KVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAST  310
            +V K ++ F + S + L     E  C+   GER   ++R     ++L  ++  FD   +T
Sbjct  709  EVKKIAILFCFASAITLIVYTIEHLCFGIMGERLTRRVREKMFLAILKNEMGWFDEVDNT  768

Query  311  GEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIAL  487
              ++ S + +D  +++  + ++    +  +   +  F I F+  W+++LV L+  PL+  
Sbjct  769  SSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFVISFMLNWRLTLVVLATYPLVIS  828

Query  488  AGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                      G    + K+Y++A  +A E V N+RTV AF
Sbjct  829  GHISEKLFMQGYGGNLSKAYLKANMLAGESVSNIRTVAAF  868



>ref|XP_011018529.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1249

 Score =   341 bits (874),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAKYSLDF+YLS+ +LF
Sbjct  49   LMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAKYSLDFLYLSVAMLF  108

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL SML+QDIS+FDTE ST EVI++IT+DI+VVQDAI
Sbjct  109  SSWTEVACWMHTGERQAAKMRMAYLDSMLSQDISVFDTETSTAEVITSITSDILVVQDAI  168

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVG  MHYISRF+ GF IGFIR+WQISLVTLS++PLIALAGG+YA++ATGLI  VRKS
Sbjct  169  SEKVGKLMHYISRFLVGFIIGFIRVWQISLVTLSMLPLIALAGGIYAYIATGLIINVRKS  228

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV A +IAQEV+GN+RTVQ+FT
Sbjct  229  YVEASQIAQEVIGNIRTVQSFT  250


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 100/201 (50%), Gaps = 6/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG + A V GA +P+F +   + +     A+     A+  ++ K S+ F   +++ +F+ 
Sbjct  690  VGTISAFVAGALLPLFALGMAQSL----VAYYMDWHATCQEIRKISILFCCGAVISIFAY  745

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
                 C+   GER A ++R     ++L  +I  FD   +T  +++  + +D I++Q  + 
Sbjct  746  AIMHLCFGIMGERLALRVRETMFSAILRNEIGWFDDLNNTSPMLTGRLQSDAILLQTIVV  805

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +H +   +  F I F+  W+I+LV ++  PL+            G    + K+Y
Sbjct  806  DRTTILLHNVGLVVTSFIIAFVLNWRITLVVIATYPLLISGHISEKLFMQGFGGNLSKAY  865

Query  548  VRAGEIAQEVVGNVRTVQAFT  610
            ++A  +A E V N+RTV AF+
Sbjct  866  LKANMLAGEAVSNIRTVAAFS  886



>gb|AAF17668.1|AC009398_17 F20B24.12 [Arabidopsis thaliana]
Length=1316

 Score =   338 bits (867),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 189/230 (82%), Gaps = 28/230 (12%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS+VILF
Sbjct  40   LMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVAKYSLDFVYLSVVILF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAK+R AYLRSML+QDISLFDTE STGEVISAIT++I+VVQDAI
Sbjct  100  SSWLEVACWMHTGERQAAKIRKAYLRSMLSQDISLFDTEISTGEVISAITSEILVVQDAI  159

Query  365  SEK----------------------------VGNFMHYISRFIAGFTIGFIRLWQISLVT  460
            SEK                            VGNFMH+ISRFIAGF IGF  +WQISLVT
Sbjct  160  SEKVRYTKIKPVLVLNFGCWIFNFPIASMHLVGNFMHFISRFIAGFAIGFASVWQISLVT  219

Query  461  LSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAFT  610
            LSIVP IALAGG+YAFV++GLI RVRKSYV+A EIA+EV+GNVRTVQAFT
Sbjct  220  LSIVPFIALAGGIYAFVSSGLIVRVRKSYVKANEIAEEVIGNVRTVQAFT  269


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/217 (22%), Positives = 97/217 (45%), Gaps = 22/217 (10%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
              G +G+ + G+ +P+F +    I   +   ++      ++V + S+ F   S++ +   
Sbjct  727  LCGTLGSFIAGSQMPLFAL---GIAQALVSYYMDWETTQNEVKRISILFCCGSVITVIVH  783

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  784  TIEHTTFGIMGERLTLRVRQKMFSAILRNEIGWFDKVDNTSSMLASRLESDATLLRTIVV  843

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAG-----------------G  496
            ++    +  +   +  F I FI  W+++LV L+  PLI ++G                 G
Sbjct  844  DRSTILLENLGLVVTAFIISFILNWRLTLVVLATYPLI-ISGHISEVKRSFLRFYILFFG  902

Query  497  VYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                   G    + K+Y++A  +A E + N+RTV AF
Sbjct  903  RQKIFMQGYGGNLSKAYLKANMLAGESISNIRTVVAF  939



>ref|XP_004509740.1| PREDICTED: ABC transporter B family member 2-like isoform X3 
[Cicer arietinum]
Length=1047

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAKYSLDF+YLSI+ILF
Sbjct  29   LMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAKYSLDFLYLSILILF  88

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTE STGEVIS+IT+DI++VQ+A+
Sbjct  89   SSWAEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEVSTGEVISSITSDILIVQEAL  148

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGFIR+WQISLVTL+IVPLIA+AGG+YA+V  GL+A+VRKS
Sbjct  149  SEKVGNFMHYISRFLAGFIIGFIRVWQISLVTLAIVPLIAIAGGLYAYVTIGLVAKVRKS  208

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAG+IA+EV+GNVRTVQAF
Sbjct  209  YVRAGQIAKEVIGNVRTVQAF  229


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    I   +   ++      H+V K +  F   +I+ + +   
Sbjct  664  GTLSAFITGALMPLFAL---GISHALVSYYMDWHNTQHEVKKIAFLFCGAAIIAITAYSI  720

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +IS FD   +T  ++S+ + TD  +++  + ++
Sbjct  721  EHLSFGIMGERLTLRVREIMFSAILKNEISWFDDTRNTSSMLSSRLETDATLLKTIVVDR  780

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                M  +   +  F I FI  W+I+LV L+  PLI            G    + K+Y++
Sbjct  781  STILMQNVGLVVTSFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  840

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  841  ANMLAGEAISNIRTVAAF  858



>ref|XP_004509738.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Cicer arietinum]
Length=1229

 Score =   334 bits (857),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAKYSLDF+YLSI+ILF
Sbjct  29   LMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAKYSLDFLYLSILILF  88

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTE STGEVIS+IT+DI++VQ+A+
Sbjct  89   SSWAEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEVSTGEVISSITSDILIVQEAL  148

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNFMHYISRF+AGF IGFIR+WQISLVTL+IVPLIA+AGG+YA+V  GL+A+VRKS
Sbjct  149  SEKVGNFMHYISRFLAGFIIGFIRVWQISLVTLAIVPLIAIAGGLYAYVTIGLVAKVRKS  208

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YVRAG+IA+EV+GNVRTVQAF
Sbjct  209  YVRAGQIAKEVIGNVRTVQAF  229


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    I   +   ++      H+V K +  F   +I+ + +   
Sbjct  664  GTLSAFITGALMPLFAL---GISHALVSYYMDWHNTQHEVKKIAFLFCGAAIIAITAYSI  720

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +IS FD   +T  ++S+ + TD  +++  + ++
Sbjct  721  EHLSFGIMGERLTLRVREIMFSAILKNEISWFDDTRNTSSMLSSRLETDATLLKTIVVDR  780

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                M  +   +  F I FI  W+I+LV L+  PLI            G    + K+Y++
Sbjct  781  STILMQNVGLVVTSFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  840

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  841  ANMLAGEAISNIRTVAAF  858



>ref|XP_004136398.1| PREDICTED: ABC transporter B family member 2-like [Cucumis sativus]
Length=1232

 Score =   327 bits (838),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 182/201 (91%), Gaps = 7/201 (3%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF+FFGK+I+++    +FP        +YSLDF+YLS+ ILF
Sbjct  36   LMSIGSIGACIHGASVPVFFIFFGKLINILC-INIFP------FVQYSLDFLYLSVAILF  88

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMH+GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  89   SSWAEVACWMHSGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIAAITSDIVVVQDAI  148

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HYISRFI+GF IGF+R+WQISLVTLSIVPLIALAGG+YAFV  GLIA+VRKS
Sbjct  149  SEKVGNFLHYISRFISGFIIGFVRVWQISLVTLSIVPLIALAGGLYAFVTIGLIAKVRKS  208

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+E++GNVRTVQAF
Sbjct  209  YVKAGEIAEEILGNVRTVQAF  229


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H++ K SL F   +++ +   
Sbjct  670  VGVIGAFVTGSQMPLFALGVSQAL----VAFYMDWDTTQHEIKKISLLFCGGAVLTVIFH  725

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + 
Sbjct  726  AVEHLCFGIMGERLTLRVREMMFHAILRNEIGWFDDMNNTSAMLSSRLETDATLLRTIVV  785

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  ++  +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  786  DRSTILLQNLALVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  845

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E VGN+RTV AF
Sbjct  846  LKANTLAGEAVGNIRTVAAF  865



>gb|EMT33461.1| ABC transporter B family member 2 [Aegilops tauschii]
Length=1322

 Score =   327 bits (837),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 186/244 (76%), Gaps = 42/244 (17%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAKYSLDFVYL +VIL
Sbjct  51   LLMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAKYSLDFVYLGVVIL  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWMHTGERQAAKMR+AYLRSML+QDI++FDTEASTGEVI+AIT+D++VVQDA
Sbjct  111  FSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIAVFDTEASTGEVINAITSDVLVVQDA  170

Query  362  ISEK------------------------------------------VGNFMHYISRFIAG  415
            ISEK                                          VGNFMHYISRF+AG
Sbjct  171  ISEKARVRDTAAMHIQAHASLPLQKQVVDERFSKSNATGLSLKFASVGNFMHYISRFLAG  230

Query  416  FTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRT  595
            F IGF R+WQISLVTL+IVPLIA+AGG YA+V  GL+ARVRKSYV+AGEIA+EV+GNVRT
Sbjct  231  FAIGFSRVWQISLVTLAIVPLIAIAGGTYAYVTIGLMARVRKSYVKAGEIAEEVIGNVRT  290

Query  596  VQAF  607
            VQAF
Sbjct  291  VQAF  294


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISEKVGNFMHYI  397
            GER   ++R     ++L  +I  FD+ + T  ++ S + TD  +V+  + ++    +  +
Sbjct  821  GERLTLRVREKMFAAILRNEIGWFDSTSHTSSMLASRLETDATLVRTIVVDRSTILLQNV  880

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
               +    I FI  W+I+LV L+  PL+            G    + KSY++A  +A E 
Sbjct  881  GMIVTSLIIAFILNWRITLVVLATYPLMVSGHISEKMFMKGYGGNLGKSYLKANMLAAEA  940

Query  578  VGNVRTVQAF  607
            V N+RTV AF
Sbjct  941  VSNMRTVAAF  950



>ref|XP_002299180.2| P-glycoprotein [Populus trichocarpa]
 gb|EEE83985.2| P-glycoprotein [Populus trichocarpa]
Length=1285

 Score =   320 bits (820),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 183/221 (83%), Gaps = 19/221 (9%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS VIL
Sbjct  42   LLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSAVIL  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITT--------  337
            F+SW EVACWMHTGERQAAKMRMAYL+SML+QD+SLFDTEASTGEVI+AITT        
Sbjct  102  FASWIEVACWMHTGERQAAKMRMAYLKSMLSQDVSLFDTEASTGEVIAAITTFPCFWLTF  161

Query  338  --DIIVVQDAISE---------KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIA  484
                +    A+ +          VGNFMHY+SRF+ GF IGF+R+WQISLVTLSIVPLIA
Sbjct  162  LSAFLCCAYALQQVALVLLKCILVGNFMHYVSRFLGGFIIGFVRIWQISLVTLSIVPLIA  221

Query  485  LAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            LAGG+YA++  GLIA+VRKSYV+AG+IA+EV+GNVRTVQAF
Sbjct  222  LAGGIYAYITIGLIAKVRKSYVKAGQIAEEVIGNVRTVQAF  262


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 97/200 (49%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H+V K ++ F   +++ +   
Sbjct  714  VGTIGAFVAGSLMPLFALGVTQAL----VAFYMDWDTTRHEVKKIAILFCCGAVISVIFY  769

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  770  GIEHLSFGIMGERLTLRVREMMFSAILRNEIGWFDDFNNTSSMLTSRLESDATLLRTIVV  829

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +H +   +  F I FI  W+I+LV ++  PLI            G    + K+Y
Sbjct  830  DRSTVLLHNVGLVVTSFVIAFILNWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAY  889

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  890  LKANMLAGEAVSNIRTVAAF  909



>ref|XP_010436379.1| PREDICTED: ABC transporter B family member 2 [Camelina sativa]
Length=1222

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 172/202 (85%), Gaps = 9/202 (4%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VAKYSLDFVYLS+ ILF
Sbjct  34   LMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILF  93

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EVACWMHTGERQAAKMR AYLRSML+QDISLFDTE           T+ +     I
Sbjct  94   SSWLEVACWMHTGERQAAKMRRAYLRSMLSQDISLFDTE---------FMTNCLDYYRYI  144

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              +VGNF+HYISRFIAGF IGF  +WQISLVTLSIVPLIALAGG+YAFVA GLIARVRKS
Sbjct  145  WLQVGNFLHYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKS  204

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            Y++AGEIA+EV+GNVRTVQAFT
Sbjct  205  YIKAGEIAEEVIGNVRTVQAFT  226


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 79/164 (48%), Gaps = 1/164 (1%)
 Frame = +2

Query  119  EASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT  298
            E   ++ K ++ F   S++ L     E  C+   GER   ++R    R++L  +I  FD 
Sbjct  693  ETQKEIKKIAILFCCASVITLIVYTIEHVCFGTMGERLTLRVRENMFRAILKNEIGWFDE  752

Query  299  EASTGEVI-SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP  475
              +T  ++ S + +D  +++  + ++    +  +   +  F I FI  W+++LV L+  P
Sbjct  753  VDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNWRLTLVVLATFP  812

Query  476  LIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            L+            G    + K+Y++A  +A E V N+RTV AF
Sbjct  813  LVISGHISEKLFMQGYGGDLSKAYLKANMLAGESVSNIRTVAAF  856



>gb|ABG75919.1| MDR-like ABC transporter [Ginkgo biloba]
Length=1279

 Score =   310 bits (795),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM VG +GAC HGASVPVFF+FFGK+I+ IG A+L P   +H VA YSLDFVYL +V+L
Sbjct  72   LLMAVGSIGACAHGASVPVFFIFFGKLINCIGLAYLDPPAVTHTVAMYSLDFVYLGVVVL  131

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSSWTEVACWM+TGERQA +MR+ YLR+MLNQD+S FDT+A+ GEV++AIT+D IVVQDA
Sbjct  132  FSSWTEVACWMYTGERQATRMRLTYLRAMLNQDVSFFDTDATGGEVVAAITSDTIVVQDA  191

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY+ RF+AGF +GF  +WQ+SLVTL+IVPLIALAGG+YAFV TGL +R R 
Sbjct  192  IGEKVGNFLHYMGRFVAGFAVGFSAVWQLSLVTLAIVPLIALAGGLYAFVVTGLTSRSRN  251

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y++AG IA+EV+GNVRTV AF
Sbjct  252  AYIKAGGIAEEVIGNVRTVYAF  273


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 83/162 (51%), Gaps = 1/162 (1%)
 Frame = +2

Query  125  SHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TE  301
              +V K SL F   +I+ + +   E   +   GER   ++R     ++L  ++  FD  +
Sbjct  753  KREVRKISLWFCSGAILTVVAHVIEHLNFGMMGERLTLRVREMMFGAILRNEVGWFDDND  812

Query  302  ASTGEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLI  481
             ++G V S + +D  +V+  + ++V   +  I+  +  FTI FI  W+I+LV L+  PL+
Sbjct  813  NNSGLVSSRLASDATLVRTLVVDRVTILIQNIALIVTSFTIAFIEQWRITLVILATYPLL  872

Query  482  ALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
              +     F   G    + K+Y++A  +A E V N+RTV AF
Sbjct  873  IASHMSERFFMHGYGGNLSKAYLKANMLATEAVSNIRTVAAF  914



>ref|XP_010906448.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1235

 Score =   303 bits (777),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGACVHGAS+PVFF+FFGK+++V   A L+PA  SHKVA+Y+LDF+YL    L 
Sbjct  36   LMALGSVGACVHGASLPVFFLFFGKLVNVAAVASLYPASVSHKVAEYALDFLYLGFATLV  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W EV+CWMHTGERQ +K+R+AYLR+MLNQDI +FDTEAST EVI++IT DIIV+QDAI
Sbjct  96   SAWIEVSCWMHTGERQVSKIRLAYLRAMLNQDIGVFDTEASTAEVIASITNDIIVIQDAI  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGN MH+++RFI GF +GF  +WQ+SLVTLS+VPLIA+  G Y +  T LIARVRKS
Sbjct  156  SEKVGNTMHFMARFIVGFAMGFSNVWQVSLVTLSVVPLIAITAGTYVYFETSLIARVRKS  215

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  216  YVKAGEIAEEVIGNVRTVQAF  236


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 91/198 (46%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A V G  +P+F +    +   +   ++       ++ K  + F   +++ +FS   
Sbjct  678  GTISAFVVGVQIPLFGL---GVTQALVAYYMDWETTKREIRKLVILFCCAAVLSIFSHSA  734

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   G+R   ++R      ML  +I  FD   +T  ++S+ + TD  ++Q  + ++
Sbjct  735  EHLSFGVLGQRLTLRVRERMFAVMLRNEIGWFDDMRNTCSMLSSRLETDATLLQTIVVDR  794

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  I   ++   I F+  W+I+LV L+  PL+  A    A    G    + K Y++
Sbjct  795  SLILIQSIGMIVSSVAIAFVLNWRITLVVLATYPLMITAQISEALFLRGFGLNLSKVYLK  854

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E   N+RTV AF
Sbjct  855  ANTLAAEAASNIRTVAAF  872



>ref|XP_008777170.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1237

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G V ACVHGASVPVF +FFGK+IDV       PA  SHKV +Y+LDFVYL   IL 
Sbjct  39   LMALGSVSACVHGASVPVFLIFFGKLIDVAAVGSSNPASVSHKVGEYALDFVYLGFGILV  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W EVACWMHTGERQ +K+R+AYLR+MLNQ+I +FDTEAST EVI++IT DIIV+Q+AI
Sbjct  99   SAWIEVACWMHTGERQVSKIRLAYLRAMLNQEIGVFDTEASTAEVIASITNDIIVIQEAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEK GNF+H+++RFI G  IGF  +WQ+SLVTLS+VPLIA+ GG Y +VATGLIA+VRKS
Sbjct  159  SEKAGNFLHFMTRFIVGTAIGFSYVWQVSLVTLSVVPLIAIFGGTYVYVATGLIAKVRKS  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            YV+AGEIA+EV+GNVRTVQAF
Sbjct  219  YVKAGEIAEEVIGNVRTVQAF  239


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 92/204 (45%), Gaps = 7/204 (3%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK-VAKYSLDFVYLSIVI  178
            F +F G + A + G  VP+F +   + +     AF    E + + + K  + F   +I+ 
Sbjct  675  FALF-GTISAFIVGIQVPLFALGITQAL----VAFYMDWETTQREIRKLVILFCGGAILA  729

Query  179  LFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQ  355
            +FS   E   +   G+R   ++R     +ML  ++  FD   +T  ++S+ +  D  ++Q
Sbjct  730  IFSHSAEHLSFGVLGQRLTLRVRERMFAAMLRNEMGWFDNMRNTCSMLSSRLEADATLLQ  789

Query  356  DAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARV  535
              + ++    +      +A   I FI  W+I+LV L+  P              G    +
Sbjct  790  TIVVDRSSILLQNAGMSVASIVIAFILNWRITLVVLATYPFTVTGYMSEKLFLRGFGLNL  849

Query  536  RKSYVRAGEIAQEVVGNVRTVQAF  607
             ++Y++A  +A E   N+RTV AF
Sbjct  850  SEAYLKANTLAAEAASNIRTVAAF  873



>ref|XP_006368377.1| P-glycoprotein [Populus trichocarpa]
 gb|ERP64946.1| P-glycoprotein [Populus trichocarpa]
Length=1230

 Score =   292 bits (748),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 166/202 (82%), Gaps = 19/202 (9%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGA+VPVFF++FGK+I++IG A+LFP + SHKVAK              
Sbjct  49   LMGLGSIGACIHGAAVPVFFIYFGKLINIIGLAYLFPQQTSHKVAK--------------  94

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
                 VACWMHTGERQAAKMRMAYL SML+QDIS+FDTE ST EVI++IT+DI+VVQDAI
Sbjct  95   -----VACWMHTGERQAAKMRMAYLDSMLSQDISVFDTETSTAEVITSITSDILVVQDAI  149

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVG  MHYISRF+ GF IGFIR+WQISLVTLS++PLIALAGG YA++ATGLI  VRKS
Sbjct  150  SEKVGKLMHYISRFLVGFIIGFIRVWQISLVTLSVLPLIALAGGFYAYIATGLIINVRKS  209

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            YV A +IAQEV+GN+RTVQ+FT
Sbjct  210  YVEASQIAQEVIGNIRTVQSFT  231


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 98/200 (49%), Gaps = 4/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            VG + A V GA +P+F +   + +      ++       ++ K S+ F   +++ +F+  
Sbjct  671  VGTISAFVAGALLPLFALGMAQSLVAY---YMDWHTTCQEIRKISILFCCGAVISIFAYA  727

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
                C+   GER A ++R     ++L  +I  FD   +T  +++  + +D I++Q  + +
Sbjct  728  IMHLCFGIMGERLAFRVREIMFSAILRNEIGWFDDLNNTSPMLTGRLQSDAILLQTIVVD  787

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            +    +H +   +  F I FI  W+I+LV ++  PL+            G    + K+Y+
Sbjct  788  RTTILLHNVGLVVTSFIIAFILNWRITLVVIATYPLLISGHISEKLFMQGFGGNLSKAYL  847

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +A  +A E V N+RTV AF+
Sbjct  848  KANMLAGEAVSNIRTVAAFS  867



>ref|XP_004165322.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
2-like, partial [Cucumis sativus]
Length=1158

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  143  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI  322
            YSLDF+YLS+ ILFSSW EVACWMH+GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI
Sbjct  1    YSLDFLYLSVAILFSSWAEVACWMHSGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI  60

Query  323  SAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVY  502
            +AIT+DI+VVQDAISEKVGNF+HYISRFI+GF IGF+R+WQISLVTLSIVPLIALAGG+Y
Sbjct  61   AAITSDIVVVQDAISEKVGNFLHYISRFISGFIIGFVRVWQISLVTLSIVPLIALAGGLY  120

Query  503  AFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            AFV  GLIA+VRKSYV+AGEIA+E++GNVRTVQAF
Sbjct  121  AFVTIGLIAKVRKSYVKAGEIAEEILGNVRTVQAF  155


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H++ K SL F   +++ +   
Sbjct  596  VGVIGAFVTGSQMPLFALGVSQAL----VAFYMDWDTTQHEIKKISLLFCGGAVLTVIFH  651

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
              E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + 
Sbjct  652  AVEHLCFGIMGERLTLRVREMMFHAILRNEIGWFDDMNNTSAMLSSRLETDATLLRTIVV  711

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +  ++  +A F I FI  W+I+LV L+  PLI            G    + K+Y
Sbjct  712  DRSTILLQNLALVVASFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGYGGNLSKAY  771

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E VGN+RTV AF
Sbjct  772  LKANTLAGEAVGNIRTVAAF  791



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FL+F+G +GACVHG ++PVFF+FFG++I+  GE    P   S +V+K +L F++L+IV+L
Sbjct  29   FLIFLGTLGACVHGVAIPVFFIFFGRLINAFGEYADDPETMSTEVSKNALYFLFLAIVVL  88

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             ++W EVACWMHTGERQ+A+MR+AYL++ML QD+  FDT+A+TGE +S I++D ++VQDA
Sbjct  89   IAAWLEVACWMHTGERQSARMRVAYLKAMLAQDVGFFDTDATTGETVSRISSDTLLVQDA  148

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK GN++HY++RFI+GF +GF  +WQ++LVT+++VPLIA+AGG YA V  GL +R +K
Sbjct  149  ISEKAGNYVHYMARFISGFAVGFTSVWQLTLVTVAVVPLIAIAGGSYAVVMIGLTSRSQK  208

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +AGEIA+E +  +RTV +F
Sbjct  209  AYSKAGEIAEEAISQIRTVYSF  230


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 94/201 (47%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAE--ASHKVAKYSLDFVYLSIVILFS  187
            +G +GA + G   P+F +   +++      F  P      H+V K  L F   ++  +  
Sbjct  679  LGSLGAIMTGCETPLFALAISEML----VTFYNPDRDYVEHEVRKICLIFSAATVGTVVI  734

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R     S+L Q++  FD E++   ++SA +++D  +V+ A+
Sbjct  735  YVLQHYYYGLMGEILTMRVRKMLFSSILTQEVGWFDEESNNSNLVSARLSSDATLVKAAV  794

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +++   +   S  +  F I F   W+++ V L   PL+  A         G    + K+
Sbjct  795  GDRMSTIVQNFSLVVTAFCISFYLQWKVAGVVLLTFPLLVGAAVGEQLFLKGFGGDLGKA  854

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A E VGN+RTV AF
Sbjct  855  YGRASMVAGEAVGNIRTVAAF  875



>ref|XP_002973102.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ25476.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1214

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+L FVYL + IL 
Sbjct  5    LIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYALYFVYLGLAILV  64

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            ++W EVACW +TGERQ+A+MR+AYL++ML+QD+  FDT+ +TGE+++ I++D  +VQ+AI
Sbjct  65   AAWLEVACWTYTGERQSARMRVAYLKAMLSQDVGFFDTDTTTGEIVNGISSDTALVQEAI  124

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              K GN++HY++RF+AGF +GF  +WQ++LVTL++VP IALAGG+YA    GL  + +K+
Sbjct  125  GAKAGNYLHYMARFVAGFAVGFSSVWQLTLVTLAVVPGIALAGGLYAHTMIGLTTKNQKA  184

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +AG +A++ +  VRTV +F
Sbjct  185  YAKAGNVAEQSISQVRTVYSF  205


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 95/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK--VAKYSLDFVYLSIVILF  184
              G +GA + GA  P    FF   I      F  P ++  K  V K S  F   ++V + 
Sbjct  642  LAGALGAILAGAETP----FFAYGITQALVTFYSPDQSHQKREVEKISTIFAIATVVTVG  697

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITT-DIIVVQDA  361
                E   +   GER   ++R     ++L  +I  FD E +   ++++  + D  +++ A
Sbjct  698  IYVLEHYFFGVMGERLTMRVRKMMFSNILRNEIGWFDREENNSSLLASRLSSDATMLRAA  757

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            + +++      ++  + GF + F+  W+++LV +++ PL+  A         G    + K
Sbjct  758  VGDRLCTLTQNLALIVTGFVMAFVLQWKLTLVIIALFPLMIGAHITEHLFLKGFGVNLSK  817

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A E VGN+RTV AF
Sbjct  818  AYHRATMVAGEAVGNIRTVAAF  839



>ref|XP_002976764.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
 gb|EFJ22433.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
Length=1290

 Score =   250 bits (639),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+L FVYL + IL 
Sbjct  80   LIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYALYFVYLGLAILV  139

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            ++W EVACW +TGERQ+A+MR+AYL++ML+QD+  FDT+ +TGE+++ I++D  +VQ+AI
Sbjct  140  AAWLEVACWTYTGERQSARMRVAYLKAMLSQDVGFFDTDTTTGEIVNGISSDTALVQEAI  199

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              K GN++HY++RF+AGF +GF  +WQ++LVTL++VP IALAGG+YA    GL  + +K+
Sbjct  200  GAKAGNYLHYMARFVAGFAVGFSSVWQLTLVTLAVVPGIALAGGLYAHTMIGLTTKNQKA  259

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +AG +A++ +  VRTV +F
Sbjct  260  YAKAGNVAEQSISQVRTVYSF  280


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 95/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK--VAKYSLDFVYLSIVILF  184
              G +GA + GA  P    FF   I      F  P ++  K  V K S  F   ++V + 
Sbjct  718  LAGALGAILAGAETP----FFAYGITQALVTFYSPDQSHQKREVEKISTIFAIATVVTVG  773

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITT-DIIVVQDA  361
                E   +   GER   ++R     ++L  +I  FD E +   ++++  + D  +++ A
Sbjct  774  IYVLEHYFFGVMGERLTMRVRKMMFSNILRNEIGWFDREENNSSLLASRLSSDATMLRAA  833

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            + +++      ++  + GF + F+  W+++LV +++ PL+  A         G    + K
Sbjct  834  VGDRLCTLTQNLALIVTGFVMAFVLQWKLTLVIIALFPLMIGAHITEHLFLKGFGVNLSK  893

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A E VGN+RTV AF
Sbjct  894  AYHRATMVAGEAVGNIRTVAAF  915



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            L+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+KYSL FVYL +VIL 
Sbjct  40   LIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVSKYSLYFVYLGLVILV  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            ++W EV+CW +TGERQ+++MR  YL++ML+QD+  FDT+A+TGE++  I++D  +VQ+AI
Sbjct  100  AAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFDTDATTGEIVIGISSDTALVQEAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              K GN++HY++RF AGF +GF  +WQ++L+TL++VP IA+AGG YA+   GL  + +K+
Sbjct  160  GPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAVAGGAYAYTMVGLTTKNQKA  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RAGEIA+E +  VRTV +F
Sbjct  220  YARAGEIAEETISQVRTVYSF  240


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 100/202 (50%), Gaps = 9/202 (4%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAE--ASHKVAKYSLDFVYLSIVILFS  187
            +G  GA + G  +P F     +++      +  P +     +V KY   F  L+I+ + +
Sbjct  667  LGAFGAILAGVEMPFFAFGLTQVL----VTYYNPDKHYVKKEVEKYVFFFTGLTILAVLA  722

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
            +  E   + + GE    ++R     ++L  ++  F+   +   ++S+ + +D  +V+ A+
Sbjct  723  NTLEHYFFGYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAV  782

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAG-GVYAFVATGLIARVRK  541
             +++   +   +  + GF I F+  W+++L+ L++ PL+  A  G + F+  G    + K
Sbjct  783  GDRLSILLQNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFM-KGFGVNLSK  841

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
             Y RA  +A E V N+RTV AF
Sbjct  842  VYARASVVAGEAVSNIRTVAAF  863



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            L+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+KYSL FVYL +VIL 
Sbjct  40   LIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVSKYSLYFVYLGLVILV  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            ++W EV+CW +TGERQ+++MR  YL++ML+QD+  FDT+A+TGE++  I++D  +VQ+AI
Sbjct  100  AAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFDTDATTGEIVIGISSDTALVQEAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              K GN++HY++RF AGF +GF  +WQ++L+TL++VP IA+AGG YA+   GL  + +K+
Sbjct  160  GPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAVAGGAYAYTMVGLTTKNQKA  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RAGEIA+E +  VRTV +F
Sbjct  220  YARAGEIAEETISQVRTVYSF  240


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 100/202 (50%), Gaps = 9/202 (4%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAE--ASHKVAKYSLDFVYLSIVILFS  187
            +G  GA + G  +P F     +++      +  P +     +V KY   F  L+I+ + +
Sbjct  678  LGAFGAILAGVEMPFFAFGLTQVL----VTYYNPDKHYVKKEVEKYVFFFTGLTILAVLA  733

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
            +  E   + + GE    ++R     ++L  ++  F+   +   ++S+ + +D  +V+ A+
Sbjct  734  NTLEHYFFGYMGECLTMRVRNMMFSAILKNELGWFEKADNYSSLVSSQLASDATLVRAAV  793

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAG-GVYAFVATGLIARVRK  541
             +++   +   +  + GF I F+  W+++L+ L++ PL+  A  G + F+  G    + K
Sbjct  794  GDRLSILLQNSALILGGFIIAFVLQWKLTLIVLALFPLLISAHVGEHLFM-KGFGVNLSK  852

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
             Y RA  +A E V N+RTV AF
Sbjct  853  VYARASVVAGEAVSNIRTVAAF  874



>ref|XP_011018527.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1193

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYSLDFVYLS VIL
Sbjct  42   LLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYSLDFVYLSAVIL  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVACWMHTGERQAAKMRMAYL+SML+QDISLFDTEASTGEVI+AIT+DIIVVQDA
Sbjct  102  FASWIEVACWMHTGERQAAKMRMAYLKSMLSQDISLFDTEASTGEVIAAITSDIIVVQDA  161

Query  362  ISEKVGNFMHYI  397
            ISEKVGNFMHY+
Sbjct  162  ISEKVGNFMHYV  173


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 97/200 (49%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG +GA V G+ +P+F +   + +     AF    + + H+V K ++ F   +++ +   
Sbjct  622  VGTIGAFVAGSLMPLFALGVTQAL----VAFYMDWDMTRHEVKKIAILFCCGAVISVIFY  677

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAIS  367
              E   +   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  + 
Sbjct  678  GIEHLSFGIMGERLTLRVREMMFSAILRNEIGWFDDFNNTSSMLTSRLESDATLLRTIVV  737

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +H +   +  F I FI  W+I+LV ++  PLI            G    + K+Y
Sbjct  738  DRSTVLLHNVGLVVTSFVIAFILSWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKAY  797

Query  548  VRAGEIAQEVVGNVRTVQAF  607
            ++A  +A E V N+RTV AF
Sbjct  798  LKANMLAGEAVSNIRTVAAF  817



>ref|XP_006432794.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
 gb|ESR46034.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
Length=179

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVAKYSLDFVYLS+ ILF
Sbjct  57   LMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVAKYSLDFVYLSVAILF  116

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV+CWM+TGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  117  SSWIEVSCWMYTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  176

Query  365  SEK  373
            SEK
Sbjct  177  SEK  179



>gb|KDO53158.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53159.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53160.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
Length=179

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVAKYSLDFVYLS+ ILF
Sbjct  57   LMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVAKYSLDFVYLSVAILF  116

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW EV+CWM+TGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAIT+DIIVVQDA+
Sbjct  117  SSWIEVSCWMYTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITSDIIVVQDAL  176

Query  365  SEK  373
            SEK
Sbjct  177  SEK  179



>ref|XP_004509739.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Cicer arietinum]
Length=1132

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  MHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAISEKVGNFMH  391
            MHTGERQAAKMRMAYLRSMLNQDISLFDTE STGEVIS+IT+DI++VQ+A+SEKVGNFMH
Sbjct  1    MHTGERQAAKMRMAYLRSMLNQDISLFDTEVSTGEVISSITSDILIVQEALSEKVGNFMH  60

Query  392  YISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQ  571
            YISRF+AGF IGFIR+WQISLVTL+IVPLIA+AGG+YA+V  GL+A+VRKSYVRAG+IA+
Sbjct  61   YISRFLAGFIIGFIRVWQISLVTLAIVPLIAIAGGLYAYVTIGLVAKVRKSYVRAGQIAK  120

Query  572  EVVGNVRTVQAF  607
            EV+GNVRTVQAF
Sbjct  121  EVIGNVRTVQAF  132


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    I   +   ++      H+V K +  F   +I+ + +   
Sbjct  567  GTLSAFITGALMPLFAL---GISHALVSYYMDWHNTQHEVKKIAFLFCGAAIIAITAYSI  623

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E   +   GER   ++R     ++L  +IS FD   +T  ++S+ + TD  +++  + ++
Sbjct  624  EHLSFGIMGERLTLRVREIMFSAILKNEISWFDDTRNTSSMLSSRLETDATLLKTIVVDR  683

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                M  +   +  F I FI  W+I+LV L+  PLI            G    + K+Y++
Sbjct  684  STILMQNVGLVVTSFIIAFILNWRITLVVLATYPLIISGHISEKLFMQGFGGNLSKAYLK  743

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E + N+RTV AF
Sbjct  744  ANMLAGEAISNIRTVAAF  761



>ref|XP_010055295.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Eucalyptus grandis]
Length=1134

 Score =   238 bits (606),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +2

Query  212  MHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAISEKVGNFMH  391
            MHTGERQAAKMRMAYLRSML+QDIS+FDTEASTGEVISAIT+DII+VQDA+SEKVGNF+H
Sbjct  1    MHTGERQAAKMRMAYLRSMLSQDISIFDTEASTGEVISAITSDIILVQDALSEKVGNFIH  60

Query  392  YISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQ  571
            YISRF+ GF IGF+R+WQI+LVTLSIVPLIA+AGG+YA+VATGLIAR RKSYV+AGEIA+
Sbjct  61   YISRFLGGFIIGFVRVWQITLVTLSIVPLIAIAGGLYAYVATGLIARARKSYVKAGEIAE  120

Query  572  EVVGNVRTVQAF  607
            EV+GNVRTV AF
Sbjct  121  EVIGNVRTVHAF  132


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWT  196
            G + A + GA +P+F +    +   +   ++      H+V K SL F   ++V +     
Sbjct  575  GTICALIAGAQMPLFAL---GVSQALVSYYMGWETTKHEVKKISLLFCGAAVVTVIVHAI  631

Query  197  EVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEK  373
            E  C+   GER   ++R     ++L  +I  FD   +T  ++S+ + TD  +++  + ++
Sbjct  632  EHCCFGIMGERLTLRVRERMFAAILKNEIGWFDDVNNTSAMLSSRLETDATLLRTVVVDR  691

Query  374  VGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVR  553
                +  +   +  F I FI  W+I+LV ++  PLI            G    + K+Y+R
Sbjct  692  ATILLQNMGLVLGSFVIAFILNWRITLVVIATYPLIISGHISEKMFMRGYGGNLSKAYLR  751

Query  554  AGEIAQEVVGNVRTVQAF  607
            A  +A E V N+RT+ AF
Sbjct  752  ANMLAGEAVSNIRTIAAF  769



>ref|XP_001779184.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
 gb|EDQ56030.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
Length=1284

 Score =   233 bits (594),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             L+ +G VGA  HG ++PVFF+FFGK++D  G     P + +  V +YSL  +YL IV+ 
Sbjct  80   LLISIGLVGAAAHGCALPVFFLFFGKLLDGFGANANNPVKMADIVGQYSLYMLYLGIVVC  139

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVA WM +GERQAA++R+ YL++M+ QD++ FDT+A TGE++++I++D +++QDA
Sbjct  140  FASWAEVAAWMQSGERQAARIRVRYLQAMMKQDVAFFDTDARTGEIVNSISSDTLLIQDA  199

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK+GNF+HY+  FI+GF IGF  LW+++LVTL++VP IA+AGG+YA+  TGL ++  +
Sbjct  200  ISEKMGNFIHYLVTFISGFAIGFTLLWKLALVTLAVVPAIAMAGGLYAYSLTGLTSKSNE  259

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG IA++ +  VRTV +F
Sbjct  260  AYAEAGGIAEQSIAQVRTVYSF  281


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 97/203 (48%), Gaps = 7/203 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILF  184
             +G  G+ V G   P F +    ++     A+ +   ++   +VAKY++ FV LS   L 
Sbjct  721  LLGCFGSIVSGLMNPAFALIISNVL----YAYYYTDYSKMRKEVAKYAIIFVGLSGAALA  776

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDA  361
              + +   +   GE    ++R      +L  +IS FD  E S+G+V + ++ D   V+ A
Sbjct  777  GYFVQHFFFGVMGENLIKRVREMMFSRILTYEISWFDKDENSSGQVSARLSADATTVRGA  836

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +++   +   S  IA   I FI  WQ++LV L+  PL   A  V      G    VR 
Sbjct  837  IGDRISLVVQNSSLLIATGIIAFILQWQMALVVLATFPLQVFAAMVEQMFLKGFSGDVRG  896

Query  542  SYVRAGEIAQEVVGNVRTVQAFT  610
            +  RA  +A E +GNVRTV AF 
Sbjct  897  AQARATMVASEAIGNVRTVAAFN  919



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V+KYSL FVYL +V+ 
Sbjct  39   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSKYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  756  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  815

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  816  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  875

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  876  VSNIRTVAAFN  886



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL FVYL +V+ 
Sbjct  39   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  756  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  815

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  816  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  875

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  876  VSNIRTVAAFN  886



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL FVYL +V+ 
Sbjct  39   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  756  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  815

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  816  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  875

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  876  VSNIRTVAAFN  886



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL FVYL +V+ 
Sbjct  39   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  756  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  815

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  816  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  875

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  876  VSNIRTVAAFN  886



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL F+YL +V+ 
Sbjct  39   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFIYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSIAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  756  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  815

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  816  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  875

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  876  VSNIRTVAAFN  886



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL F+YL +V+ 
Sbjct  42   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFIYLGLVVC  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  102  FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  161

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  162  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  221

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  222  SYANAGVIAEQAIAQVRTVYSY  243


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  759  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  818

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  819  TSLLTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  878

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  879  VSNIRTVAAFN  889



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL F+YL +V+ 
Sbjct  41   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFIYLGLVVC  100

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  101  FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  160

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  161  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  220

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  221  SYANAGVIAEQAIAQVRTVYSY  242


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  758  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  817

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  818  TSLLTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  877

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  878  VSNIRTVAAFN  888



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YSL F+YL +V+ 
Sbjct  41   LLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYSLYFIYLGLVVC  100

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  101  FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  160

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  161  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  220

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  221  SYANAGVIAEQAIAQVRTVYSY  242


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  758  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  817

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  818  TSLLTSFIVAFIVEWKVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  877

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  878  VSNIRTVAAFN  888



>gb|AFW63453.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=208

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKYSLDFVYL IVI F
Sbjct  45   LMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKYSLDFVYLGIVIFF  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR+AYLR+ML+QDI++FDTEASTGEVI+AIT+DI+VVQDAI
Sbjct  105  SSWTEVACWMHTGERQAAKMRLAYLRAMLDQDIAVFDTEASTGEVINAITSDILVVQDAI  164

Query  365  SEKV  376
            SEKV
Sbjct  165  SEKV  168



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   228 bits (580),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+      +  H+VAKY+L F+YL +++ 
Sbjct  37   LLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQTDLHKMIHEVAKYALYFIYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWMH+GERQA  +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   FSSYAEIACWMHSGERQAGALRRKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +  G +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAVGSILSGFIGPTFAIVMGNMIEVF--YYTNPASMERKTKEYVFIYIGAGLYAVVAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSNLLAARLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KYSL FVYL +V+ 
Sbjct  39   LLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  689  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYDSMERKTKEYVFIYIGAGIYAVIA  744

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI
Sbjct  745  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAI  804

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  805  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  864

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  865  HAKTSMIAGEGVSNIRTVAAFN  886



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KYSL FVYL +V+ 
Sbjct  39   LLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYSLYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  674  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYDSMERKTKEYVFIYIGAGIYAVIA  729

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI
Sbjct  730  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAI  789

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  790  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  849

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  850  HAKTSMIAGEGVSNIRTVAAFN  871



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +V+ 
Sbjct  38   LLMSIGTLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHQVSKYALYFVYLGLVVC  97

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  98   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  157

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  158  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  217

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  218  SYANAGVIAEQAIAQVRTVYSY  239


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI+E++   +  +
Sbjct  755  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAIAERISVILQNM  814

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  815  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  874

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  875  VSNIRTVAAFN  885



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+L FVYL +++ 
Sbjct  36   FLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVIAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +V+ 
Sbjct  42   LLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLQQMTHEVSKYALYFVYLGLVVC  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  102  FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  161

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  162  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  221

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  222  SYANAGVIAEQAIAQVRTVYSY  243


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 65/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD +     +++A + TD   V+ AI+E++   +  +
Sbjct  759  GENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAIAERISVILQNM  818

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L   PL+ LA         G      K++ +   IA E 
Sbjct  819  TSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  878

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  879  VSNIRTVAAFN  889



>ref|XP_007032498.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
 gb|EOY03424.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
Length=1216

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+L FVYL +++ 
Sbjct  36   FLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVIAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +++ 
Sbjct  39   LLMITGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYALYFVYLGLIVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   FSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  690  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYDSMERKTKEYVFIYIGAGIYAVIA  745

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI
Sbjct  746  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAI  805

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  806  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  865

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  866  HAKTSMIAGEGVSNIRTVAAFN  887



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 154/201 (77%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+L FVYL +V+ F
Sbjct  37   LMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYALYFVYLGLVVCF  96

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  97   SSYAEIACWMYTGERQVGALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  156

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  157  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  216

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  217  YANAGIIAEQSIAQVRTVYSY  237


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAIGSILSGFIGPTFAIVMSNMIEVF--YYRNPAAMERKTKEYVFIYIGAGLYAVVAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score =   225 bits (573),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L FVYL IV+ 
Sbjct  38   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYALYFVYLGIVVC  97

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  98   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  157

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  158  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  217

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY +AG IA++ +  VRTV +F
Sbjct  218  SYAQAGIIAEQAIAQVRTVYSF  239


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  688  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  745

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  746  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  805

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  806  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  865

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  866  KTSMIAGEGVSNIRTVAAFN  885



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score =   225 bits (573),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L FVYL IV+ 
Sbjct  38   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYALYFVYLGIVVC  97

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  98   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  157

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  158  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  217

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY +AG IA++ +  VRTV +F
Sbjct  218  SYAQAGIIAEQAIAQVRTVYSF  239


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  688  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  745

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  746  IQHYFFSIMGENLTTRVRRMMLAAILKNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  805

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  806  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  865

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  866  KTSMIAGEGVSNIRTVAAFN  885



>gb|KJB33609.1| hypothetical protein B456_006G021600 [Gossypium raimondii]
Length=1249

 Score =   225 bits (573),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+L FVYL +++ 
Sbjct  36   LLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+L FVYL +V+ 
Sbjct  37   LLMISGSIGAVIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYALYFVYLGLVVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   LSSYAEIACWMYTGERQVGALRRKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYASAGIIAEQSIAQVRTVYSY  238


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAIGSVLSGFIGPTFALVMSNMIEVF--YYTNPAAMERKTKEYVFIYIGAGLYAVVAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_004173028.1| PREDICTED: ABC transporter B family member 19-like, partial [Cucumis 
sativus]
Length=848

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +++ 
Sbjct  37   FLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  97   FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDVVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 77/163 (47%), Gaps = 7/163 (4%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   ++ +       F+Y+ I +     
Sbjct  687  MGAVGSVLSGFISPTFAIVMSNMIEV----FYYRNSSAMERKIKEFVFIYIGIGVYAVVA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  T  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAG  493
            +E++   +  ++     F + FI  W++SL+ L+  PL+ LA 
Sbjct  803  AERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAFPLLVLAN  845



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   224 bits (572),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+L FVYL +++ 
Sbjct  36   LLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRTKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_001759716.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
 gb|EDQ75628.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
Length=1301

 Score =   224 bits (572),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FL+  G + A VHG S+P+F +F G +ID  G     P   +  V KY++  VYL IV+ 
Sbjct  98   FLIATGALAAVVHGLSMPIFLLFLGDLIDGFGANINNPKRTAEDVDKYAVYMVYLGIVVW  157

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVA WM TGERQAA++R+ YL+SML +DIS FD +A TGEV+ +I+TD +++QDA
Sbjct  158  FASWAEVAAWMQTGERQAARIRVLYLQSMLKKDISYFDVDARTGEVVDSISTDTLLIQDA  217

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK+G F+HYIS  I GF +GF  LW++ LVTL++ P IA+ GG YA++ T   AR RK
Sbjct  218  ISEKMGQFLHYISTCIGGFAVGFSMLWKLGLVTLAVAPAIAIVGGSYAYIITNFTARNRK  277

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG I ++ + NVRTV +F
Sbjct  278  AYEEAGNIVEQNLANVRTVYSF  299


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 89/205 (43%), Gaps = 11/205 (5%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASH----KVAKYSLDFVYLSIVI  178
            F+  VG+ + G   P F +    ++      +++   ++H    ++ K+ L  + L +  
Sbjct  736  FLAIVGSVIMGLVNPGFSLVISNVV------YIYYGTSNHHMKQEIDKFILIVISLGVAA  789

Query  179  LFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQ  355
            L  S+ +   +   GE    ++R      +L  ++  FD + +    +SA +  D   V+
Sbjct  790  LIGSFLQHTFFGVMGENLVKRIREMMFARILTNEVGWFDADENNSSQVSARLAADATTVK  849

Query  356  DAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARV  535
             AI +++   +   +  +A   I F   W+++ V L  +PL   A  V      G    V
Sbjct  850  GAIGDRISIIVQNFTLMVAICIIAFSLQWKMAFVVLCTLPLQVFATFVEHLFLKGFSGDV  909

Query  536  RKSYVRAGEIAQEVVGNVRTVQAFT  610
              +  RA  +A E V N+RT+ AF 
Sbjct  910  ASAQARASMVAGEGVINIRTIAAFN  934



>emb|CBI22189.3| unnamed protein product [Vitis vinifera]
Length=1088

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+L FVYL +V+  
Sbjct  38   LMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYALYFVYLGVVVCI  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  98   SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  158  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  217

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  218  YANAGIIAEQAIAQVRTVYSY  238


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E++   +  +
Sbjct  637  GENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAERISVILQNM  696

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L+  PL+ LA         G      K++ +   IA E 
Sbjct  697  TSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  756

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  757  VSNIRTVAAFN  767



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +++V+KY+L FVYL +V+ 
Sbjct  43   LLMITGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTNEVSKYALYFVYLGLVVC  102

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  103  FSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  162

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  163  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  222

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  223  SYANAGVIAEQAIAQVRTVYSY  244


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD E     +++A + TD   V+ A++E++   +  +
Sbjct  760  GENLTTRVRRMMLSAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAMAERISVILQNM  819

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L+  PL+ LA         G      K++ +   IA E 
Sbjct  820  TSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  879

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  880  VSNIRTVAAFN  890



>ref|XP_006482578.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1252

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V KY+L FVYL +++ F
Sbjct  40   LMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCKYALYFVYLGLIVCF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  100  SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  160  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRES  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  220  YANAGIIAEQAIAQVRTVYSY  240


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  ++   ++   +  + +  
Sbjct  689  MGAIGSVLSGFIGPTFAIVMACMIEVF--YYRNPASMERKTKEFVFIYIGAGLYAVVAYL  746

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI++
Sbjct  747  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAD  806

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  807  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHA  866

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  867  KTSMIAGEGVSNIRTVAAFN  886



>gb|KDP36504.1| hypothetical protein JCGZ_09330 [Jatropha curcas]
Length=1126

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  248  MAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIG  427
            MAYLRSMLNQDISLFDTEASTGEVISAIT+DIIVVQDAISEKVGNFMHYISRF+AGFTIG
Sbjct  1    MAYLRSMLNQDISLFDTEASTGEVISAITSDIIVVQDAISEKVGNFMHYISRFLAGFTIG  60

Query  428  FIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            F+R+WQISLVTLSIVPLIALAGG YA+V  GLI+RVRKSYV+AGEIA+EV+GNVRTVQAF
Sbjct  61   FVRVWQISLVTLSIVPLIALAGGCYAYVTIGLISRVRKSYVKAGEIAEEVIGNVRTVQAF  120


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 94/201 (47%), Gaps = 6/201 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFS  187
             VG   A + G+ +P+F +   + +     A+    + + H+V K S+ F   S++ +  
Sbjct  561  LVGTTCAFIAGSQMPLFALGVSQAL----VAYYMDWDTTRHEVKKISILFCAGSVITVIV  616

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAI  364
               E  C+   GER   ++R     ++L  +I  FD   +T  ++ S + +D  +++  +
Sbjct  617  YAIEHLCFGIMGERLTFRVREKMFSAILKNEIGWFDDLNNTSSMLASRLESDATLLRTIV  676

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             ++    +  +   +  F I F   W+I+LV ++  PLI            G    + K+
Sbjct  677  VDRSTILLQNVGLVVTSFVIAFTLNWRITLVVIATYPLIISGHISEKLFMKGYGGNLSKA  736

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y++A  +A E V N+RTV AF
Sbjct  737  YLKANMLAGEAVSNIRTVAAF  757



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +V+ 
Sbjct  39   LLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYALYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   VSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 92/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  682  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYVSMERKTKEYVFIYIGAGIYAVIA  737

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +I+A + TD   V+ AI
Sbjct  738  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLIAARLATDAADVKSAI  797

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K+
Sbjct  798  AERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKA  857

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  858  HAKTSMIAGEGVSNIRTVAAFN  879



>gb|KDO72551.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=1252

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V KY+L FVYL +++ F
Sbjct  40   LMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCKYALYFVYLGLIVCF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  100  SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  160  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRES  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  220  YANAGIIAEQAIAQVRTVYSY  240


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  ++   ++   +  + +  
Sbjct  689  MGAIGSVLSGFIGPTFAIVMACMIEVF--YYRNPASMERKTKEFVFIYIGAGLYAVVAYL  746

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI++
Sbjct  747  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAD  806

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  807  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHA  866

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  867  KTSMIAGEGVSNIRTVAAFN  886



>ref|XP_006431131.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
 gb|ESR44371.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
Length=1252

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V KY+L FVYL +++ F
Sbjct  40   LMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCKYALYFVYLGLIVCF  99

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  100  SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  159

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  160  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRES  219

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  220  YANAGIIAEQAIAQVRTVYSY  240


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  ++   ++   +  + +  
Sbjct  689  MGAIGSVLSGFIGPTFAIVMACMIEVF--YYRNPASMERKTKEFVFIYIGAGLYAVVAYL  746

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI++
Sbjct  747  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAD  806

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  807  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHA  866

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  867  KTSMIAGEGVSNIRTVAAFN  886



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G VGA VHG+++PVFF+ FG +++  G+     +  +H+V+KY+L FVYL +V+ 
Sbjct  41   LLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQTHLSVMTHEVSKYALYFVYLGLVVC  100

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQA+ +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  101  LSSYAEIGCWMYTGERQASALRRRYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  160

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GFI  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  161  ISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  220

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV +F
Sbjct  221  SYANAGIVAEQTIAQVRTVYSF  242


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  693  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFIYIGTGLYAVVAYL  750

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  751  VQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLVAARLANDAADVKSAIAE  810

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GF+  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  811  RISVILQNMTSLLTSFIVGFVVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  870

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  871  KTSMIAGEGVSNIRTVAAFN  890



>gb|KJB11390.1| hypothetical protein B456_001G256100 [Gossypium raimondii]
Length=1249

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+L FVYL +++ 
Sbjct  36   MLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 90/200 (45%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEA-STGEVISAITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E  ++  + + +  D   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLAADAADVKPAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+L FVYL +++ 
Sbjct  36   MLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 90/200 (45%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEA-STGEVISAITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E  ++  + + +  D   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAAKLAADAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G VGA VHG+++PVFF+ FG +++  G+        +H+V+KY+L FVYL +V+ 
Sbjct  40   LLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQHHLMVMTHEVSKYALYFVYLGLVVC  99

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQA+ +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  100  LSSYAEIACWMYTGERQASALRRKYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  159

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  160  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  219

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV +F
Sbjct  220  SYANAGIVAEQAIAQVRTVYSF  241


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  692  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFVYIGTGLYAVVAYL  749

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  750  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLANDAADVKSAIAE  809

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  810  RISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  869

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  870  KTSMIAGEGVSNIRTVAAFN  889



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F+M +G VGA VHG+S+PVFF+FFG +++  G+  +   + + +V+KY+L FVYL +++ 
Sbjct  36   FVMTIGTVGAVVHGSSMPVFFLFFGDLVNGFGKNQMDLRKMTEEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIACWMYTGERQVSALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ ++
Sbjct  156  ISEKVGNFIHYMSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSQQ  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA+E +  +RTV ++
Sbjct  216  SYASAGIIAEEAIAQIRTVYSY  237


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 94/201 (47%), Gaps = 3/201 (1%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G VG+ + G   P F +    +I+V    +  PA    K  ++   ++   +  + + 
Sbjct  686  LLGAVGSVLSGFIGPTFAIIMSNMIEVF--YYRDPAAMESKTREFVFMYIGAGLYAVIAY  743

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS-TGEVISAITTDIIVVQDAIS  367
              +   +   GE    ++R   L ++L  ++  FD E + + +V S + TD   V+ AI+
Sbjct  744  LVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSQVASRLATDATTVKSAIA  803

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            E++   +  ++  +  F + FI  W++SL+ L+  PL+  A         G      K++
Sbjct  804  ERMSVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLLVFANFAQQLSLKGFAGDTAKAH  863

Query  548  VRAGEIAQEVVGNVRTVQAFT  610
             +A  +A E V N+RTV AF 
Sbjct  864  AKASMVAGEGVSNIRTVAAFN  884



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GA +HG+S+PVFF+ FG++++  G+        +H+V+KY+L FVYL +++ 
Sbjct  37   FLMSLGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQSDLQTMTHEVSKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM++GERQA  +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   VSSYAEIACWMYSGERQAGALREKYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRQ  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 93/206 (45%), Gaps = 15/206 (7%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   AS +       F+Y+   I    +
Sbjct  687  MGAVGSILSGFIGPTFAIVMSNMIEV----FYYQNYASMEKKTKEYVFIYIGAGI----Y  738

Query  194  TEVACWMH------TGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVV  352
              VA  +        GE    ++R   L +++  ++  FD E     +++A + TD   V
Sbjct  739  AVVAYLIQHYFFSIMGENLTTRVRRMMLAAIMRNEVGWFDEEEHNSSLLAARLATDAADV  798

Query  353  QDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIAR  532
            + AI+E++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G    
Sbjct  799  KSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGD  858

Query  533  VRKSYVRAGEIAQEVVGNVRTVQAFT  610
              K++ +   IA E V N+RTV AF 
Sbjct  859  TAKAHAKTSMIAGEGVSNIRTVAAFN  884



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L FVYL +V+ 
Sbjct  46   LLMISGSTGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLTKMTHEVSKYALYFVYLGLVVC  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  106  LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  166  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY +AG IA++ +  VRTV ++
Sbjct  226  SYAQAGIIAEQAIAQVRTVYSY  247


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  696  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  753

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  754  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  813

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  814  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  873

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  874  KTSMIAGEGVSNIRTVAAFN  893



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++Y+L FVYL +V+ 
Sbjct  39   LLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSRYALYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   VSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 92/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  689  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYVSMERKTKEYVFIYIGAGIYAVIA  744

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +++A + TD   V+ AI
Sbjct  745  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAI  804

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K+
Sbjct  805  AERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKA  864

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  865  HAKTSMIAGEGVSNIRTVAAFN  886



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++Y+L FVYL +V+ 
Sbjct  39   LLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSRYALYFVYLGLVVC  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM++GERQ A +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  99   VSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  159  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  219  SYANAGVIAEQAIAQVRTVYSY  240


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 92/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS--HKVAKYSLDFVYLSIVILFS  187
            +G VG+ + G   P F +    +I+V    F +    S   K  +Y   ++   I  + +
Sbjct  690  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYTDYVSMERKTKEYVFIYIGAGIYAVIA  745

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
               +   +   GE    ++R   L ++L  ++  FD +     +++A + TD   V+ AI
Sbjct  746  YLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDEHNSSLVAARLATDAADVKSAI  805

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K+
Sbjct  806  AERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLLVLANFAQQLSLKGFAGDTAKA  865

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  866  HAKTSMIAGEGVSNIRTVAAFN  887



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+ 
Sbjct  41   LLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTSEVSKYALYFVYLGLVVC  100

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ   +R  YL+++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  101  FSSYAEIACWMYTGERQVGALRKRYLQAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  160

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  161  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRE  220

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  221  SYANAGVIAEQAIAQVRTVYSY  242



>ref|XP_007032499.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
 gb|EOY03425.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
Length=1213

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 153/200 (77%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            M  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+L FVYL +++  S
Sbjct  1    MISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYALYFVYLGLIVCLS  60

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAIS  367
            S+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAIS
Sbjct  61   SYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAIS  120

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            EKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+SY
Sbjct  121  EKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESY  180

Query  548  VRAGEIAQEVVGNVRTVQAF  607
              AG IA++ +  VRTV ++
Sbjct  181  ANAGIIAEQAIAQVRTVYSY  200


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 91/201 (45%), Gaps = 4/201 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  649  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPTSMERKTKEYVFIYIGAGLYAVIAYL  706

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  707  IQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEEHNSSLLAARLATDAADVKSAIAE  766

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAG-GVYAFVATGLIARVRKSY  547
            ++   +  ++  +  F + FI  W++SL+ L   PL+ LA          G      K++
Sbjct  767  RISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQQLSLKGFAGDTAKAH  826

Query  548  VRAGEIAQEVVGNVRTVQAFT  610
             +   IA E V N+RTV AF 
Sbjct  827  AKTSMIAGEGVSNIRTVAAFN  847



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+L FVYL +V+  
Sbjct  38   LMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYALYFVYLGVVVCI  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  98   SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  158  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  217

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  218  YANAGIIAEQAIAQVRTVYSY  238


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVIAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+L FVYL +++ 
Sbjct  36   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV ++
Sbjct  216  SYANAGIMAEQAIAQVRTVYSY  237


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYSNPASMERKTKEYVFIYIGAGLYAVAAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLLAARLATDASDVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>gb|KHN45492.1| ABC transporter B family member 19 [Glycine soja]
Length=1214

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+ 
Sbjct  1    MLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMNLKKMTEEVSKYALYFVYLGLVVC  60

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  61   ISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  120

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  121  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  180

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  181  SYANAGIIAEQAIAQVRTVYSY  202


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F F   AS +       F+Y+   +     
Sbjct  651  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYFSNYASMERKTKEYVFIYIGAGLYAVGA  706

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  707  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  766

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  767  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  826

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  827  HAKTSMIAGEGVSNIRTVAAFN  848



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+L FVYL +++ 
Sbjct  36   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV ++
Sbjct  216  SYANAGIMAEQAIAQVRTVYSY  237


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVAAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLLAARLATDASDVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  GE  +   + + +VAKY+L FVYL +++ 
Sbjct  37   LLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQMNLQKMTAEVAKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             +S+ E+ACWM+TGERQ +++R  YL ++L QD+  FDT+A TG+++ +I+TD ++VQDA
Sbjct  97   VTSYAEIACWMYTGERQVSRLRKKYLEAVLKQDVGFFDTDARTGDIVFSISTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRQ  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A + +  VRTV ++
Sbjct  217  SYANAGIMADQAIAQVRTVYSY  238


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 92/197 (47%), Gaps = 3/197 (2%)
 Frame = +2

Query  23   VGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWTEV  202
            +G+ + G   P F +  G +I+V    +  PA    K  +Y   ++ + +  + +   + 
Sbjct  690  IGSVLSGFIGPTFAILMGNMIEVF--YYKNPASMERKTKEYVFMYIGVGLYAVVAYLIQH  747

Query  203  ACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVG  379
              +   GE    ++R   L ++L  ++  FD E     +++  + TD   V+ AISE++ 
Sbjct  748  YFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSNLLTTKLATDAADVKSAISERIS  807

Query  380  NFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAG  559
              +  ++  +  F + FI  W++SL+ L+  PL+ L+         G      K++ +  
Sbjct  808  VILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLSNYAQQLSLKGFAGDTAKAHAKTS  867

Query  560  EIAQEVVGNVRTVQAFT  610
             IA E V N+RTV AF 
Sbjct  868  MIAGEGVSNIRTVAAFN  884



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+ 
Sbjct  36   MLMISGSIGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYALYFVYLGLVVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F F   AS +       F+Y+   +     
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYFRNYASMERKTKEYVFIYIGAGLYAVGA  741

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  742  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  801

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  802  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  861

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  862  HAKTSMIAGEGVSNIRTVAAFN  883



>ref|XP_006415715.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
 gb|ESQ34068.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
Length=1246

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V++ +L  VYL +V L
Sbjct  46   FLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVSQNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  106  VSAWMGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNLIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  166  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+E +  VRTV AF
Sbjct  226  AYSDAGKVAEEAMSQVRTVYAF  247


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/202 (24%), Positives = 97/202 (48%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA   +F +    ++      F  P     +V K ++  +Y+ + IL + 
Sbjct  683  LLGSIGAVLAGAQTSLFSMGIAYVLTAFYSPF--PNVIKREVEKVAI--IYVVVGILTAP  738

Query  191  WTEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
               +  + +T  GER  +++R++    +L  +I  FD  E +TG + + +  D  +V+ A
Sbjct  739  VYLLQHYFYTLMGERLTSRVRLSLFSVILTNEIGWFDLDENNTGSLTTILAADATLVRSA  798

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  I    I F   W+++ V  +  PL+  A         G      +
Sbjct  799  LADRLSTIVQNLSLTITALAIAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTR  858

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +A  +A+E + N+RTV AF
Sbjct  859  AYSKATSVAREAIANIRTVAAF  880



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score =   222 bits (565),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +++ 
Sbjct  37   FLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  97   FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDVVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   ++ +       F+Y+ I +     
Sbjct  687  MGAVGSVLSGFISPTFAIVMSNMIEV----FYYRNSSAMERKIKEFVFIYIGIGVYAVVA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  T  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++     F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  803  AERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKA  862

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  863  HAKTSMIAGEGVSNIRTVAAFN  884



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score =   222 bits (565),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+ 
Sbjct  37   MLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMNLKKMTEEVSKYALYFVYLGLVVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   ISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F F   AS +       F+Y+   +     
Sbjct  687  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYFSNYASMERKTKEYVFIYIGAGLYAVGA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  803  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  862

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  863  HAKTSMIAGEGVSNIRTVAAFN  884



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score =   222 bits (565),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +++ 
Sbjct  37   FLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  97   FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDVVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGIIAEQAIAQVRTVYSY  238


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   ++ +       F+Y+ I +     
Sbjct  687  MGAVGSVLSGFISPTFAIVMSNMIEV----FYYRNSSAMERKIKEFVFIYIGIGVYAVVA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  T  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++     F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  803  AERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKA  862

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  863  HAKTSMIAGEGVSNIRTVAAFN  884



>ref|XP_002510564.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF52751.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1252

 Score =   222 bits (565),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF G +GAC+HGAS+PVFF+FFG++ID +G     P + S +V+K++L  VYL +V+ 
Sbjct  47   FLMFFGSLGACIHGASLPVFFIFFGRMIDSLGNLASDPQKMSTQVSKHALYLVYLGLVVF  106

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VA WM TGERQ A++R+ YL+S+L +D++ FDTEA    ++  I++D I++QDA
Sbjct  107  VSAWIGVALWMQTGERQTARLRLKYLQSVLRKDMNFFDTEARDSNIMFHISSDAILIQDA  166

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ M Y+S+FI GF IGF+ +WQ++L+TL++VPLIA+AGG Y  + + L  +   
Sbjct  167  IGDKTGHAMRYLSQFIVGFAIGFVYVWQLTLLTLAVVPLIAVAGGAYTVIMSTLSEKGEA  226

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  +RTV +F
Sbjct  227  AYAEAGKVAEEVISQIRTVYSF  248


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 102/202 (50%), Gaps = 8/202 (4%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILF  184
             +G +GA + G   P+F +    ++     AF +P  +E  H++ +  L FV L+++ + 
Sbjct  685  LLGSLGAVLAGMEAPMFALGITHVL----TAFYYPDASEMRHEIQRVVLIFVGLAVITIP  740

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  741  IYLLQHYFYTLMGERLTARVRLSMFSAILSNEIGWFDLDENNTGSLTSTLAADATLVRSA  800

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  ++  +    I F   W+++ V ++ +PL+  A         G       
Sbjct  801  LADRLSTVVQNVALTVTACVIAFTLSWRVASVVVASLPLLVGASIAEQLFLKGFGGDYH-  859

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV AF
Sbjct  860  AYSRATSVAREALTNIRTVAAF  881



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score =   222 bits (565),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +++ 
Sbjct  148  FLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYALYFVYLGLIVC  207

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  208  FSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDVVFSVSTDTLLVQDA  267

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  268  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRE  327

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  328  SYANAGIIAEQAIAQVRTVYSY  349


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   ++ +       F+Y+ I +     
Sbjct  798  MGAVGSVLSGFISPTFAIVMSNMIEV----FYYRNSSAMERKIKEFVFIYIGIGVYAVVA  853

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  T  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  854  YLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  913

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++     F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  914  AERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAFPLLVLANMAQQLSLKGFAGDTAKA  973

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  974  HAKTSMIAGEGVSNIRTVAAFN  995



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+  
Sbjct  38   LMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSKYALYFVYLGLVVCI  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  98   SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  158  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  217

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  218  YANAGIIAEQAIAQVRTVYSY  238


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F +   AS +       F+Y+   I     
Sbjct  687  MGAVGSILSGFIGPTFAIVMSNMIEV----FYYRNYASMERKTKEYVFIYIGAGIYAVGA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  803  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  862

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  863  HAKTSMIAGEGVSNIRTVAAFN  884



>emb|CDX84896.1| BnaC05g21590D [Brassica napus]
Length=1051

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC  GA++P+FFVFFGK++D IG     P   S +V+K +LD VYL +V  
Sbjct  39   FLMILGGLGACTLGATLPLFFVFFGKMLDSIGNLSTDPKALSSRVSKNALDLVYLGLVTF  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACW  TGERQ A++R+ YL+++L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  99   LSAWIGVACWTQTGERQTARLRINYLKAVLAKDITFFDTEARDSNLIFHISSDAILVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F+AGF +GF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  159  IGDKTGHVLRYLSQFVAGFVVGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  219  AYADAGKVAEEVISQVRTVYAF  240


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 99/202 (49%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + GA  P+F +    ++     AF  P+ +     V K ++ FV +++V   
Sbjct  676  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPSPSVIKRDVEKVAIVFVGIAVVTAP  731

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  732  IYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  791

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    I F   W+++ V  S  PL+  A         G      +
Sbjct  792  LADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGFGGDYTR  851

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV +F
Sbjct  852  AYSRATSVAREAIENIRTVASF  873



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V++ +L  VYL +  L
Sbjct  46   FLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVSQNALYLVYLGLANL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  106  VSAWIGVACWMQTGERQTAQLRINYLKSILAKDITFFDTEARDSNLIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+F+AGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  166  IGDKTDHVLRYLSQFVAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 100/202 (50%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA  P+F +    ++     AF  P+ +  K     +  V++   IL + 
Sbjct  683  LLGSIGAVLAGAQTPMFSMGIAYVL----TAFYSPSPSLIKRDVEKVAIVFVGAGILTAP  738

Query  191  WTEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
               +  + +T  GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  739  IYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  798

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    + F   W+++ V  +  PL+  A         G      K
Sbjct  799  LADRLSTIVQNLSLTVTALVLAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTK  858

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +A  +A+E +GN+RTV AF
Sbjct  859  AYSKATSVAREAIGNIRTVAAF  880



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +++ 
Sbjct  36   LLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPATMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_001774240.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
 gb|EDQ61016.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
Length=1236

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 145/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +GAC HG +VP+FFVFFG++I+  G     P +   +V K +L   YL +V++
Sbjct  31   FLMFLGSLGACAHGGAVPIFFVFFGRLINAFGFNQHHPNKLGQEVGKEALSMFYLGLVVM  90

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            F+SW EVACW+ TGERQ+A++R+ YL+S+L+QD+  FDT  +T +V+  +  DI +VQDA
Sbjct  91   FASWLEVACWIQTGERQSARIRVRYLQSILSQDVGYFDTSITTADVVGHVAQDISLVQDA  150

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK GNF+H++++FI GF +GF  +WQ+SL TL++VP I LAG  YA   TG   + ++
Sbjct  151  ISEKTGNFIHFMAKFIVGFAVGFSSVWQLSLTTLAVVPAIVLAGCAYAMTMTGHATKSQQ  210

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG+ A++ +  VRTV A+
Sbjct  211  AYEDAGKKAEQAITQVRTVYAY  232


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 91/204 (45%), Gaps = 11/204 (5%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAE--ASHKVAKYSLDFVYLSIVILF  184
             +G  GA + G   P+     G+++      F  P +     +V KYS  F   +IV+L 
Sbjct  665  LLGSFGAVIAGCEFPLAAFVIGQVL----VTFYSPDKHFMKKEVEKYSTIFAGAAIVVLL  720

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVIS-AITTDIIVVQDA  361
                +       GE    ++R   L+ +L  +I+ F+ E +   V+   ++TD   V+ A
Sbjct  721  GHTMQHYFMASMGESLTKRVREVLLQRILQNEIAFFENEENNSNVLGMRLSTDAASVRAA  780

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLI--ALAGGVYAFVATGLIARV  535
            + +++   +  ++  +    I F   W+++ V ++  PL+  AL G        G    +
Sbjct  781  VGDRLSTIVQNLALIVTALAIVFALEWRVAWVMIACFPLLIGALVG--ENLFLKGFSGDL  838

Query  536  RKSYVRAGEIAQEVVGNVRTVQAF  607
             KSY R   I  + V N+RTV AF
Sbjct  839  DKSYQRTSMIIGDAVSNIRTVAAF  862



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +++ 
Sbjct  36   LLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPATMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+  
Sbjct  38   LMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSKYALYFVYLGLVVCI  97

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  98   SSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  157

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  158  SEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  217

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  218  YANAGIIAEQAIAQVRTVYSY  238


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 91/202 (45%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG  + G   P F +    +I+V    F +   AS +       F+Y+   I     
Sbjct  687  MGAVGYVLSGFIGPTFAIVMSNMIEV----FYYRNYASMEKKTKEYVFIYIGAGIYAVGA  742

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  743  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L   PL+ LA         G      K+
Sbjct  803  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLLVLANFAQQLSLKGFAGDTAKA  862

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  863  HAKTSMIAGEGVSNIRTVAAFN  884



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+L FVYL +++ 
Sbjct  36   LLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIGCWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYTNPATMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +V+ 
Sbjct  36   LLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYALYFVYLGLVVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQA+ +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G  G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAAGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G VGA +HG+S+P FF+ FG++++  G+  +   + + +V+KYSL FVYL +V+ 
Sbjct  36   LLMISGSVGAVIHGSSMPFFFLLFGQMVNGFGKNQMDLRKMTDEVSKYSLYFVYLGLVVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   VSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRQ  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGVIAEQAIAQVRTVYSY  237


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDASDVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +V+ 
Sbjct  36   LLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYALYFVYLGLVVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQA+ +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G  G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAAGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19 [Fragaria vesca 
subsp. vesca]
Length=1250

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+L FVYL +++ 
Sbjct  37   LLMVSGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTAEVAKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   VSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV+++
Sbjct  217  SYANAGIMAEQAIAQVRTVKSY  238


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  687  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFVYIGAGLYAVVAYL  744

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVI-SAITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  +D E +   ++ S + TD   V+ AI+E
Sbjct  745  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWYDEEENNSSLLASKLATDAADVKSAIAE  804

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  805  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  864

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  865  KTSMIAGEGVSNIRTVAAFN  884



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 152/201 (76%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G VGA VHG+++PVFF+ FG +++  G+      + +++V+KY+L FVYL +++  
Sbjct  39   LMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKMTNEVSKYALYFVYLGLIVCL  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQA  +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  99   SSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  159  SEKVGNFIHYLSTFLAGLVVGFMSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  219  YANAGILAEQAIAQVRTVYSF  239


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  690  LGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFIYIGTGLYAVVAYL  747

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L +ML  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  748  VQHYFFSIMGENLTTRVRRMMLTAMLRNEVGWFDEEENNSSLVAARLATDAADVKSAIAE  807

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++ + L+  PL+ LA         G    + K++ 
Sbjct  808  RISVILQNMTSLLTSFIVGFIVEWRVAFLILATFPLLVLANFAQQLSLKGFAGDMAKAHA  867

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  868  KTSMIAGEGVSNIRTVAAFN  887



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+L FVYL +V+ 
Sbjct  36   MLMISGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYALYFVYLGLVVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   LSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +   RTV ++
Sbjct  216  SYANAGIIAEQAIAQARTVYSY  237


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    F F   AS +       F+Y+   +     
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYFRNYASMERKTKEYVFIYIGAGLYAVGA  741

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              +  +  +  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI
Sbjct  742  YLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAI  801

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  802  AERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  861

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  862  HAKTSMIAGEGVSNIRTVAAFN  883



>ref|XP_009113722.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Brassica 
rapa]
 ref|XP_009113723.1| PREDICTED: ABC transporter B family member 13 isoform X2 [Brassica 
rapa]
Length=1247

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+K +LD VYL +V  
Sbjct  39   FLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVSKNALDLVYLGLVTF  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACW  TGERQ A++R+ YL+++L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  99   LSAWIGVACWTQTGERQTARLRIKYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F+AGF +GF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  159  IGDKTGHVLRYLSQFVAGFVVGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  219  AYADAGKVAEEVISQVRTVYAF  240


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 99/202 (49%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + GA  P+F +    ++     AF  P+ +     V K ++ FV +++V   
Sbjct  676  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPSPSVIKRDVDKVAIVFVGIAVVTAP  731

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  732  IYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  791

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    I F   W+++ V  S  PL+  A         G      +
Sbjct  792  LADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGFGGDYTR  851

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV +F
Sbjct  852  AYSRATSVAREAIENIRTVASF  873



>ref|XP_009113724.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Brassica 
rapa]
Length=1218

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+K +LD VYL +V  
Sbjct  39   FLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVSKNALDLVYLGLVTF  98

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACW  TGERQ A++R+ YL+++L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  99   LSAWIGVACWTQTGERQTARLRIKYLKAILAKDITFFDTEARDSNLIFHISSDAILVQDA  158

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F+AGF +GF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  159  IGDKTGHVLRYLSQFVAGFVVGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  218

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  219  AYADAGKVAEEVISQVRTVYAF  240


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 99/202 (49%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + GA  P+F +    ++     AF  P+ +     V K ++ FV +++V   
Sbjct  647  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPSPSVIKRDVDKVAIVFVGIAVVTAP  702

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  703  IYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  762

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    I F   W+++ V  S  PL+  A         G      +
Sbjct  763  LADRLSTIVQNLSLTVTALAIAFYYSWRVAAVVTSCFPLLIAAALTEQLFLKGFGGDYTR  822

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV +F
Sbjct  823  AYSRATSVAREAIENIRTVASF  844



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V++ +L  VYL +V L
Sbjct  46   FLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVSQNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  V+CWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  106  VSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNLIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  166  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAVAGGGYAIIMSTISEKSET  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 95/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA  P+F +    ++      F  P      V K ++ FV + IV     
Sbjct  683  LLGSIGAVLAGAQTPLFSMGIAYVLTAFYSPF--PNAIMRDVEKVAIIFVGVGIVTAPIY  740

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A++
Sbjct  741  LLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSALA  800

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  +    + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  801  DRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAY  860

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E + N+RTV AF
Sbjct  861  SRATSVAREAIANIRTVAAF  880



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L FVYL +V+ 
Sbjct  46   LLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVSKYALYFVYLGLVVC  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  106  ISSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  166  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY +AG IA++ +  VR V ++
Sbjct  226  SYAQAGIIAEQAIAQVRAVYSY  247


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  696  MGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  753

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  754  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  813

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  814  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  873

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  874  KTSMIAGEGVSNIRTVAAFN  893



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+L FVYL +++ 
Sbjct  36   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+L FVYL +++ 
Sbjct  36   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYALYFVYLGLIVC  95

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  96   ASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  155

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  156  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  215

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  216  SYANAGIIAEQAIAQVRTVYSY  237


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVVAYL  743

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI+E
Sbjct  744  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLLAARLATDAADVKSAIAE  803

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  804  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  863

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  864  KTSMIAGEGVSNIRTVAAFN  883



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA VHG+++PVFF+ FG +++  G+      + +++V+KY+L FVYL +V+  
Sbjct  39   LMAAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKMTNEVSKYALYFVYLGLVVCL  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  99   SSYAEIACWMYTGERQVGTLRRRYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GFI  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  159  SEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKGRES  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV +F
Sbjct  219  YANAGIIAEQAIAQVRTVYSF  239


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  690  LGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFIYIGTGLYAVVAYL  747

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD + +   +++A + TD   V+ AI+E
Sbjct  748  VQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEDENNSSLLAARLATDAADVKSAIAE  807

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  808  RISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  867

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  868  KTSMIAGEGVSNIRTVAAFN  887



>ref|XP_010460561.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1248

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GACVHGA++P+FFVFFGK++D +G         S  V+K +L  VYL +V L
Sbjct  48   FLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVSKNALYLVYLGLVNL  107

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  108  VSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNLIYHISSDAILVQDA  167

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  168  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  227

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  228  AYADAGKVAEEVMSQVRTVYAF  249


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 95/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + GA  P+F +    ++     AF  P        + K ++ FV   IV   
Sbjct  685  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPHPNVIKRDIEKVAIIFVVAGIVTAP  740

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  741  IYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  800

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    + F   W+++ V  +  PL+  A         G      +
Sbjct  801  LADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTR  860

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +A  +A+E + N+RTV AF
Sbjct  861  AYSKATSVAREAIANIRTVAAF  882



>ref|NP_174115.1| ABC transporter B family member 13 [Arabidopsis thaliana]
 sp|Q9C7F8.1|AB13B_ARATH RecName: Full=ABC transporter B family member 13; Short=ABC transporter 
ABCB.13; Short=AtABCB13; AltName: Full=P-glycoprotein 
13; AltName: Full=Putative multidrug resistance protein 
15 [Arabidopsis thaliana]
 gb|AAG51482.1|AC069471_13 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30893.1| ABC transporter B family member 13 [Arabidopsis thaliana]
Length=1245

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V++ +L  VYL +V  
Sbjct  45   FLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVSQNALYLVYLGLVNF  104

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  V+CWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  105  VSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNLIFHISSDAILVQDA  164

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  165  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSET  224

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  225  AYADAGKVAEEVMSQVRTVYAF  246


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA  P+F +    ++      F  P      V K ++ F    IV     
Sbjct  682  LLGSIGAVLAGAQTPLFSMGIAYVLTAFYSPF--PNVIKRDVEKVAIIFAGAGIVTAPIY  739

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A++
Sbjct  740  LLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSALA  799

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  +    + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  800  DRLSTIVQNLSLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAY  859

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E + N+RTV A+
Sbjct  860  SRATSVAREAIANIRTVAAY  879



>ref|NP_001054045.1| Os04g0642000 [Oryza sativa Japonica Group]
 dbj|BAF15959.1| Os04g0642000 [Oryza sativa Japonica Group]
Length=612

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA  HGA++P+FF+ FG +I+  G+        + +V+KY+L FVYL +V+  
Sbjct  55   LMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCA  114

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  115  SSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  174

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  175  GEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  234

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  235  YANAGVVAEQAIAQVRTVYSF  255



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score =   219 bits (557),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+L FVYL +V+ 
Sbjct  40   LLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTDEVSKYALYFVYLGLVVC  99

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ CWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  100  LSSYAEIGCWMYTGERQVGTLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  159

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  160  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRE  219

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY +AG IA++ +  VRTV ++
Sbjct  220  SYAQAGIIAEQAIAQVRTVYSY  241


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G  G+ + G   P F +    +I+V    +  PA    K  +Y   ++   +  + +  
Sbjct  690  MGAAGSILSGFIGPTFAIVMSNMIEVF--YYRNPASMERKTKEYVFIYIGAGLYAVIAYL  747

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E
Sbjct  748  IQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAE  807

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ 
Sbjct  808  RISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  867

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  868  KTSMIAGEGVSNIRTVAAFN  887



>gb|AAP72956.1| putative MDR-like P-glycoprotein [Lactuca sativa]
Length=1251

 Score =   219 bits (557),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GA +HG+S+P FF+ FG++I+  G+        +H+V+KY+L FVYL +V+  
Sbjct  39   LMILGSIGAIIHGSSMPFFFLLFGQMINGFGKNQSDLNTMTHEVSKYALYFVYLGLVVCI  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ CWM+TGERQ + +R  YL ++L QD+  +DT+A TG+++ +++TD ++VQDAI
Sbjct  99   SSYAEIGCWMYTGERQVSTLRKRYLEAVLKQDVGFYDTDARTGDIVFSVSTDTLLVQDAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  159  SEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  219  YANAGIIAEQAIAQVRTVYSY  239



>ref|XP_010499285.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1245

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GACVHGA++P+FFVFFGK++D +G         S  V+K +L  VYL +V L
Sbjct  45   FLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVSKNALYLVYLGLVNL  104

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  V+CWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  105  VSAWIGVSCWMQTGERQTARLRINYLKSVLAKDITFFDTEARDSNLIYHISSDAILVQDA  164

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL++VPLIA++GG YA + + L  +   
Sbjct  165  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAISGGGYAIIMSTLSEKSEA  224

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  225  AYADAGKVAEEVMSQVRTVYAF  246


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 95/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G VGA + GA  P+F +    ++     AF  P        + K ++ FV   IV   
Sbjct  682  LLGSVGAVLAGAQTPLFSMGIAYVL----TAFYSPHPNVIKRDIEKVAIIFVVAGIVTAP  737

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  738  IYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSA  797

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  +    + F   W+++ V  +  PL+  A         G      +
Sbjct  798  LADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTR  857

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y ++  +A+E + N+RTV AF
Sbjct  858  TYSKSTSVAREAIANIRTVAAF  879



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
              M  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+L F+YL +V+ 
Sbjct  37   LFMITGSLGAIVHGSSMPVFFLIFGEMVNGFGKNQMDLHKLTDEVSKYALYFIYLGLVVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
            FSS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDA
Sbjct  97   FSSYAEIACWMYTGERQVGALRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG+ ++ R+
Sbjct  157  ISEKVGNFIHYQSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGITSKSRE  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  217  SYANAGVIAEQAIAQVRTVYSY  238


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVGNFMHYI  397
            GE    ++R   L ++L  ++  FD E     +++A + TD   V+ AI+E++   +  +
Sbjct  754  GENLTTRVRRMMLSAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIAERISVILQNM  813

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            +  +  F + FI  W++SL+ L+  PL+ LA         G      K++ +   IA E 
Sbjct  814  TSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEG  873

Query  578  VGNVRTVQAFT  610
            V N+RTV AF 
Sbjct  874  VSNIRTVAAFN  884



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 150/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA VHG+++PVFF+ FG +++  G+      + + +VAKY+L FVYL +V+  
Sbjct  37   LMIAGSIGAVVHGSAMPVFFLLFGDMVNGFGKNQSDLKKMTEEVAKYALYFVYLGLVVCL  96

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM++GERQ   +R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  97   SSYAEIACWMYSGERQVISLRKKYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  156

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  157  SEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  216

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV ++
Sbjct  217  YANAGIIAEQAIAQVRTVYSY  237


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 95/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLS--IVILFS  187
            +G VG+ + G   P F +    +I+V    F +    + +       F+Y+   +  + +
Sbjct  686  MGAVGSVLSGFIGPTFAIVMSNMIEV----FYYRDYTAMERKTKEFVFIYIGAGLYAVVA  741

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAI  364
              T+   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+ AI
Sbjct  742  YLTQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSLVAARLATDAADVKSAI  801

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            +E++   +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K+
Sbjct  802  AERISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKA  861

Query  545  YVRAGEIAQEVVGNVRTVQAFT  610
            + +   IA E V N+RTV AF 
Sbjct  862  HAKTSMIAGEGVSNIRTVAAFN  883



>gb|KFK33112.1| hypothetical protein AALP_AA6G332600 [Arabis alpina]
Length=1240

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P FFVFFGK++D +G   + P   S  V++ +L  VYL +V L
Sbjct  42   FLMFLGGLGTCIHGGTLPFFFVFFGKLLDSLGNLSMDPKATSSTVSQNALYLVYLGLVNL  101

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDT AS    +  I++D I+VQDA
Sbjct  102  VSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTIASDSNFVFHISSDAILVQDA  161

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + YI +FIAGF IGF+ +WQ++L+TL++VPLIA++GG YA V + +  +   
Sbjct  162  IGDKTGHVLRYICQFIAGFVIGFLSVWQLTLLTLAVVPLIAISGGGYAIVMSSISQKSEA  221

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  222  AYADAGKVAEEVMSQVRTVYAF  243


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 97/200 (49%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + G    +F +    ++ V    F  P+   H V + ++ FV + IV     
Sbjct  677  LLGSIGAVLAGTQPALFSMGLAYVLTVFYSPF--PSMIKHDVERIAIVFVGIGIVTTPIY  734

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
            + +   +   GER  +++R++   ++L+ +I  FD  E STG + S +  D  +V+ A++
Sbjct  735  FLQHYYYTLMGERLTSRVRLSLFSAVLSNEIGWFDLDENSTGSLTSILAADATLVRSALA  794

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  +    + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  795  DRLSTIVQNVSLTVTALALAFFYSWRVASVVTACFPLLIAASLTEQLFLRGFGGDYTRAY  854

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E + N+RTV AF
Sbjct  855  SRATSVAREAIVNIRTVAAF  874



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAKY+L FVYL +++ 
Sbjct  37   MLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             +S+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +I+TD ++VQDA
Sbjct  97   VTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSISTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P I  AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIVFAGGLYAYTLTGLTSKSRQ  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A + +  VRTV ++
Sbjct  217  SYANAGIVADQAIAQVRTVYSY  238


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 92/197 (47%), Gaps = 3/197 (2%)
 Frame = +2

Query  23   VGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWTEV  202
            +G+ + G   P F +  G +I+V    +  PA    K  +Y   +V + +  + +   + 
Sbjct  690  IGSLLSGFIGPTFAILMGNMIEVF--YYRNPASMERKTKEYVFMYVGVGLYAVVAYLIQH  747

Query  203  ACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVG  379
                  GE    ++R   L ++L  ++  FD E     +++A + TD   V+ A+SE++ 
Sbjct  748  YFXSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSNLLTAKLATDAADVKSAVSERIS  807

Query  380  NFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAG  559
              +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ +  
Sbjct  808  VILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTS  867

Query  560  EIAQEVVGNVRTVQAFT  610
             IA E V N+RTV AF 
Sbjct  868  MIAGEGVSNIRTVAAFN  884



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAKY+L FVYL +++ 
Sbjct  37   MLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAKYALYFVYLGLIVC  96

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             +S+ E+ACWM+TGERQ + +R  YL ++L QD+  FDT+A TG+++ +I+TD ++VQDA
Sbjct  97   VTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDTDARTGDIVFSISTDTLLVQDA  156

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEKVGNF+HY+S F+AG  +GF+  W+++L++++++P I  AGG+YA+  TGL ++ R+
Sbjct  157  ISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIVFAGGLYAYTLTGLTSKSRQ  216

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A + +  VRTV ++
Sbjct  217  SYANAGIVADQAIAQVRTVYSY  238


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 93/197 (47%), Gaps = 3/197 (2%)
 Frame = +2

Query  23   VGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSWTEV  202
            +G+ + G   P F +  G +I+V    +  PA    K  +Y   +V + +  + +   + 
Sbjct  690  IGSVLSGFIGPTFAILMGNMIEVF--YYRNPASMERKTKEYVFMYVGVGLYAVVAYLIQH  747

Query  203  ACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISEKVG  379
              +   GE    ++R   L ++L  ++  FD E     +++A + TD   V+ A+SE++ 
Sbjct  748  YFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSNLLTAKLATDAADVKSAVSERIS  807

Query  380  NFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAG  559
              +  ++  +  F + FI  W++SL+ L+  PL+ LA         G      K++ +  
Sbjct  808  VILQNMTSLLTSFIVAFIVEWRVSLLILATFPLLVLANFAQQLSLKGFAGDTAKAHAKTS  867

Query  560  EIAQEVVGNVRTVQAFT  610
             IA E V N+RTV AF 
Sbjct  868  MIAGEGVSNIRTVAAFN  884



>ref|XP_002890755.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67014.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
Length=1248

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 145/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V++ +L  VYL +V L
Sbjct  46   FLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNFSTDPNAISSRVSQNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DIS FDTEA     I  I++D I+VQDA
Sbjct  106  VSAWIGVACWMQTGERQTARLRINYLKSILAKDISFFDTEARDSNFIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  166  IGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 95/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + G+   +F +    ++      F  P+    +V K ++ FV   IV     
Sbjct  685  LLGSIGAVLAGSQPALFSMGLAYVLTTFYSPF--PSLIKREVDKVAIIFVGAGIVTAPIY  742

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ AI+
Sbjct  743  LLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSAIA  802

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  I    + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  803  DRLSTIVQNLSLTITALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAY  862

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E + N+RTV AF
Sbjct  863  ARATSLAREAITNIRTVAAF  882



>dbj|BAG91391.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA  HGA++P+FF+ FG +I+  G+        + +V+KY+L FVYL +V+  
Sbjct  55   LMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCA  114

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  115  SSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  174

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  175  GEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  234

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  235  YANAGVVAEQAIAQVRTVYSF  255



>ref|XP_008804465.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Phoenix dactylifera]
Length=1275

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 150/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA VHG+++PVFF+ FG +++  G+      + +++V+KY+L FVYL +++  
Sbjct  61   LMAAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQEDLGKMTNEVSKYALYFVYLGVIVCL  120

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQA  +R  YL ++L QD+  FDT+A TG+++ +++TD + VQDAI
Sbjct  121  SSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLSVQDAI  180

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEK GNF+HY+S F+AG  +GFI  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  181  SEKFGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRES  240

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  241  YANAGIVAEQAIAQVRTVYSF  261


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   +V   +  + S  
Sbjct  712  LGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTRQYVFMYVGTGLYAVVSYL  769

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A + TD   V+  I+E
Sbjct  770  VQHYFFSIMGENLTTRVRRMMLAAILRNELGWFDEEENNSSLVAAHLATDAADVKSVIAE  829

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ ++  PL+ LA         G    + K++ 
Sbjct  830  RISVILQNMTSLLTSFIVGFIVEWRVALLIIATFPLLVLANFAQQLSLKGFAGDMAKAHA  889

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            R   IA E V N+RTV AF 
Sbjct  890  RTSMIAGEGVSNIRTVAAFN  909



>ref|XP_006415706.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
 gb|ESQ34059.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
Length=1242

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMF+G +G+C+HG ++P+FFVFFGK++D +G     P   S +V++ +L  VYL +V L
Sbjct  46   LLMFLGSLGSCIHGGTLPLFFVFFGKLLDSLGSLSADPKAISSRVSQNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  V CWM TGERQ A++R+ YL+S+L +DI+ FDTEA     I  I++D I+VQDA
Sbjct  106  VSAWMGVTCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNFIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  166  IGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA   +F +    +++V    F  P     +V K ++ FV + I+     
Sbjct  679  LLGSIGAVLAGAQPALFSMGIAYVLNVFYSPF--PNVIKREVEKVAIIFVGVGILTAPIY  736

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A++
Sbjct  737  LLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSALA  796

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  I    I F   W+++ V  +  PL+  A         G       +Y
Sbjct  797  DRLSTIVQNLSLTITALAIAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTMAY  856

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E + N+RTV +F
Sbjct  857  SRATTVAREAIANIRTVASF  876



>ref|NP_174122.1| ABC transporter B family member 14 [Arabidopsis thaliana]
 sp|Q9C7F2.1|AB14B_ARATH RecName: Full=ABC transporter B family member 14; Short=ABC transporter 
ABCB.14; Short=AtABCB14; AltName: Full=Multidrug 
resistance protein 12; AltName: Full=P-glycoprotein 14 [Arabidopsis 
thaliana]
 gb|AAG51476.1|AC069471_7 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30902.1| ABC transporter B family member 14 [Arabidopsis thaliana]
Length=1247

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P+FFVFFG ++D +G+    P   S +V++ +L  VYL +V L
Sbjct  46   FLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGKLSTDPNAISSRVSQNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTEA     I  I++D I+VQDA
Sbjct  106  VSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNFIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  166  IGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 96/201 (48%), Gaps = 3/201 (1%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + G+   +F +    ++      F  P+    +V K ++ FV   IV     
Sbjct  684  LLGSIGAVLAGSQPALFSMGLAYVLTTFYSPF--PSLIKREVDKVAIIFVGAGIVTAPIY  741

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ AI+
Sbjct  742  ILQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSAIA  801

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S  I    + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  802  DRLSTIVQNLSLTITALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAY  861

Query  548  VRAGEIAQEVVGNVRTVQAFT  610
             RA  +A+E + N+RTV AF+
Sbjct  862  SRATSLAREAISNIRTVAAFS  882



>ref|XP_008668793.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 tpg|DAA35746.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=1266

 Score =   217 bits (553),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+ 
Sbjct  51   MLMAAGSMGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVC  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQD 
Sbjct  111  VSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDG  170

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNFMHYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  171  IGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRE  230

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +G VRTV +F
Sbjct  231  SYANAGVVAEQAIGQVRTVYSF  252


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  703  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEIEKKTKLYVFIYIGTGIYAVVAYL  760

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  761  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLGVDAADVKSAIAE  820

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L+  PL+ LA         G      K++ 
Sbjct  821  RISVILQNMTSLMTSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHA  880

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            R+  +A E V N+RTV AF 
Sbjct  881  RSSMVAGEAVSNIRTVAAFN  900



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYSL FVYL +V+ 
Sbjct  40   LLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYSLYFVYLGLVVC  99

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  100  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  159

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  160  IGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRE  219

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  220  SYANAGIIAEQAIAQVRTVYSY  241


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    F  P     K  +Y   ++   +  + +  
Sbjct  692  LGAIGSILSGFIGPTFAIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYL  749

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  D+  FD E +   +++A ++TD   V+ AI+E
Sbjct  750  VQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAE  809

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  810  RISVILQNMTSLLVSFVVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  869

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  870  KTSMIAGEGVSNIRTVAAFN  889



>ref|XP_011018530.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1182

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 117/127 (92%), Gaps = 1/127 (1%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAKYSLDF+YLS+ +LF
Sbjct  49   LMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAKYSLDFLYLSVAMLF  108

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMRMAYL SML+QDIS+FDTE ST EVI++IT+DI+VVQDAI
Sbjct  109  SSWTEVACWMHTGERQAAKMRMAYLDSMLSQDISVFDTETSTAEVITSITSDILVVQDAI  168

Query  365  SEKV-GN  382
            SEKV GN
Sbjct  169  SEKVIGN  175


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 100/201 (50%), Gaps = 6/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEAS-HKVAKYSLDFVYLSIVILFSS  190
            VG + A V GA +P+F +   + +     A+     A+  ++ K S+ F   +++ +F+ 
Sbjct  623  VGTISAFVAGALLPLFALGMAQSL----VAYYMDWHATCQEIRKISILFCCGAVISIFAY  678

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAIS  367
                 C+   GER A ++R     ++L  +I  FD   +T  +++  + +D I++Q  + 
Sbjct  679  AIMHLCFGIMGERLALRVRETMFSAILRNEIGWFDDLNNTSPMLTGRLQSDAILLQTIVV  738

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            ++    +H +   +  F I F+  W+I+LV ++  PL+            G    + K+Y
Sbjct  739  DRTTILLHNVGLVVTSFIIAFVLNWRITLVVIATYPLLISGHISEKLFMQGFGGNLSKAY  798

Query  548  VRAGEIAQEVVGNVRTVQAFT  610
            ++A  +A E V N+RTV AF+
Sbjct  799  LKANMLAGEAVSNIRTVAAFS  819



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   216 bits (551),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYSL FVYL +V+ 
Sbjct  44   LLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYSLYFVYLGLVVC  103

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  104  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  163

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  164  IGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  223

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  224  SYANAGIIAEQAIAQVRTVYSY  245


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    F  P     K  +Y   ++   +  + +  
Sbjct  696  LGAIGSILSGFIGPTFAIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYL  753

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  D+  FD E +   +++A ++TD   V+ AI+E
Sbjct  754  VQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAE  813

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  814  RISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  873

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  874  KTSMIAGEGVSNIRTVAAFN  893



>ref|XP_002448624.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
 gb|EES12952.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
Length=1266

 Score =   216 bits (551),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+ 
Sbjct  51   MLMAAGSLGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVC  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDA
Sbjct  111  VSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDA  170

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNFMHYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  171  IGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRE  230

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV +F
Sbjct  231  SYANAGVVAEQAIAQVRTVYSF  252


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  703  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGIYAVVAYL  760

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  761  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLAVDAADVKSAIAE  820

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L+  PL+ LA         G      K++ 
Sbjct  821  RISVILQNMTSLMTSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHA  880

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  881  KSSMVAGEGVSNIRTVAAFN  900



>ref|XP_010478144.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Camelina 
sativa]
 ref|XP_010478146.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Camelina 
sativa]
Length=1246

 Score =   216 bits (550),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLM +G +GACVHGA++P+FFV FGK++D +G         S  V+K +L  VYL +V L
Sbjct  46   FLMLLGGLGACVHGATLPLFFVLFGKMLDSLGNLSADSKAISSHVSKNALYLVYLGLVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  V+CWM TGERQ A++R+ YL+S+L +DI+ FDTEA    +I  I++D I+VQDA
Sbjct  106  VSAWIGVSCWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNLIYHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K  + + Y+S+FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   
Sbjct  166  IGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 95/205 (46%), Gaps = 13/205 (6%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA  P+F +    ++     AF  P      V K  +D V +  V+    
Sbjct  683  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPHP---NVIKRDIDKVAIVFVVAGIV  735

Query  191  WTEVACWMH-----TGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVV  352
               +    H      GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V
Sbjct  736  TAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLV  795

Query  353  QDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIAR  532
            + A+++++   +  +S  +    + F   W+++ V  +  PL+  A         G    
Sbjct  796  RSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGD  855

Query  533  VRKSYVRAGEIAQEVVGNVRTVQAF  607
              ++Y +A  +A+E + N+RTV AF
Sbjct  856  YTRAYSKATSVAREAIANIRTVAAF  880



>ref|XP_008663648.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 gb|AFW59637.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1266

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+ 
Sbjct  51   MLMAAGSLGALAHGAAMPFFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVC  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDA
Sbjct  111  VSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDA  170

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNFMHYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  171  IGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRE  230

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV +F
Sbjct  231  SYTNAGVVAEQAIAQVRTVYSF  252


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  703  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGIYAVVAYL  760

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  761  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAAHLAVDAADVKSAIAE  820

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L+  PL+ LA         G      K++ 
Sbjct  821  RISVILQNMTSLMTSFVVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHA  880

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  881  KSSMVAGEGVSNIRTVAAFN  900



>ref|XP_008784383.1| PREDICTED: ABC transporter B family member 19 [Phoenix dactylifera]
Length=1253

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 149/201 (74%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA VHG+++PVFF+ FG +++  G+        +++V+KY+L F+YL +V+  
Sbjct  39   LMGAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGTMTNEVSKYALYFIYLGLVVCV  98

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ    R  YL ++L QD+  FDT+A TG+++ +++TD ++VQDAI
Sbjct  99   SSYAEIACWMYTGERQVGTFRRRYLEAVLKQDVGFFDTDARTGDIVFSVSTDTLLVQDAI  158

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            SEKVGNF+HY+S F+AG  +GFI  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  159  SEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKGRES  218

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG IA++ +  VRTV +F
Sbjct  219  YANAGIIAEQAIAQVRTVYSF  239


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  690  LGAIGSVLSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFIYIGTGLYAVVAYL  747

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD + +   +++A + TD   V+ AI+E
Sbjct  748  VQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEDENNSSLLAARLATDAADVKSAIAE  807

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  808  RISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLLVLANFAQQLSLKGFAGDTAKAHA  867

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  868  KTSMIAGEGVSNIRTVAAFN  887



>ref|XP_007160658.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
 gb|ESW32652.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
Length=1247

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G VG+C+HGA++PVFF+ FG++ID +G     P + S +V++++L  VYL  V+L 
Sbjct  41   LMFLGSVGSCLHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRVSEHALYLVYLGGVVLV  100

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+++L +DI  FD EA    +I  I++D I+VQDAI
Sbjct  101  SAWMGVAFWMQTGERQTARLRLKYLQAVLRKDIDFFDNEARDSNIIFHISSDAILVQDAI  160

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF IGFI +WQ++L+TL++VPLIALAGG Y  + + L  +   +
Sbjct  161  GDKTGHTIRYLSQFIVGFAIGFISVWQLTLLTLAVVPLIALAGGAYTIIMSTLSEKGEAA  220

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  VRTV +F
Sbjct  221  YAEAGKVAEEVISQVRTVYSF  241


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/201 (24%), Positives = 99/201 (49%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    I+     AF  P  +  K     +  ++L + ++    
Sbjct  679  LGSVGAILAGMEAPLFALGITHIL----TAFYSPQSSKIKQEVDRVALIFLGVAVITIPI  734

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAI  364
              +  + +T  GE   A++R+    ++LN +++ FD  E +TG + + +  D  +V+ A+
Sbjct  735  YLLLHYFYTLMGEHLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSAL  794

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F IGF   W+++ V ++ +PL+  A         G       +
Sbjct  795  ADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYNHA  854

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +A  +A+E + N+RTV AF
Sbjct  855  YSKATSLAREAIANIRTVAAF  875



>gb|KDP36900.1| hypothetical protein JCGZ_08191 [Jatropha curcas]
Length=1221

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LMFVG +G+C+HGA++PVFF+FFG++ID +G   L P + S K+++++L  VYL + + 
Sbjct  49   LLMFVGSLGSCIHGAALPVFFIFFGRMIDSLGNLALDPHKMSSKISQHALYLVYLGLAVF  108

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VA WM TGERQ +++R+ YL+S+L +D++ FDTEA    +I  I++D I+VQDA
Sbjct  109  VSAWMGVAFWMQTGERQTSRLRLKYLQSVLKKDMNFFDTEAGDSNIIFHISSDAILVQDA  168

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F+ GF +GF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   
Sbjct  169  IGDKTGHAIRYLSQFVVGFAVGFASVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEA  228

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A EV+  +RTV +F
Sbjct  229  AYAEAGKVADEVISQIRTVYSF  250


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 100/202 (50%), Gaps = 8/202 (4%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILF  184
             +G VGA + G   P+F +    ++     AF  P  +E  H++ + +  FV L++V + 
Sbjct  655  LLGSVGAILGGMEAPLFALLISHVL----TAFYSPDVSEMKHEIRRVAFIFVGLAVVTIP  710

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V+ A
Sbjct  711  IYLLQHYFYTLMGERLTARVRLSMFTAILSNEIGWFDLDENNTGSLTSTLAADATLVRSA  770

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  ++       I F   W+I+ V ++  PL+  A         G      +
Sbjct  771  LADRLSTIVQNVALTATACVIAFTLSWRIAAVVVASFPLLIGASIAELLFLKGFGGDY-Q  829

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +A  +A+E + N+RTV AF
Sbjct  830  AYSKATSLAREALTNIRTVAAF  851



>ref|XP_004977001.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1264

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G +GA  HGA++P+FF+ FG +I+  G+        + +VAKY+L FVYL +V+ 
Sbjct  49   MLMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVC  108

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDA
Sbjct  109  VSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDA  168

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+
Sbjct  169  IGEKVGNFIHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRE  228

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG +A++ +  VRTV +F
Sbjct  229  SYANAGVVAEQAIAQVRTVYSF  250


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  701  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGIYAVVAYL  758

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  759  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARLAVDAADVKSAIAE  818

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  819  RISVILQNMTSLMTSFVVGFIIEWRVALLILATFPLLVLANFAQQISMKGFAGDTAKAHA  878

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  879  KSSMVAGEGVSNIRTVAAFN  898



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYSL FVYL +V+ 
Sbjct  48   LLMAAGTAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDEVSKYSLYFVYLGLVVC  107

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  108  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  167

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  168  IGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  227

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  228  SYANAGIIAEQAIAQVRTVYSY  249


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 92/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P     K  +Y   ++   +  + +  
Sbjct  700  LGAIGSIMSGFIGPTFAIVMSNMIEVF--YYRDPNAMERKTREYVFIYIGTGLYAVVAYL  757

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A + T+   V+ AI+E
Sbjct  758  VQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEENNSSLVAARLATEAADVKSAIAE  817

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  818  RISVILQNMTSLMVSFVVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  877

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  878  KTSMIAGEGVSNIRTVAAFN  897



>dbj|BAJ96840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1271

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G VGA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+  
Sbjct  57   LMSLGTVGALAHGAAMPCFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVCV  116

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +S+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  117  ASYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  176

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNFMHY++ F AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  177  GEKVGNFMHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  236

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  237  YANAGVVAEQAIAQVRTVYSF  257


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  708  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYKDPVEMEKKTKLYVFIYIGTGIYAVVAYL  765

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVV-QDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A         + AI+E
Sbjct  766  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARVAVDAADVKSAIAE  825

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  I+  +  F +GFI  W+++++ L+  PL+ LA         G      K++ 
Sbjct  826  RISVILQNITSLMTSFIVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHA  885

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  886  KSSMVAGEGVSNIRTVAAFN  905



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYSL FVYL +V+ 
Sbjct  45   LLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYSLYFVYLGLVVC  104

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  105  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  164

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  165  IGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  224

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  225  SYANAGIIAEQAIAQVRTVYSY  246


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P +   K  +Y   ++   +  + +  
Sbjct  695  LGAIGSILSGFIGPTFAIVMSNMIEVF--YYRNPNKMESKTREYVFIYIGTGLYAVVAYL  752

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A + TD   V+ AI+E
Sbjct  753  VQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSSLVAARLATDAADVKSAIAE  812

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L   PL+ LA         G      K++ 
Sbjct  813  RISVILQNMTSLLVSFVVGFIIEWRVALLILITFPLLVLANFAQQLSMKGFAGDTAKAHA  872

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  873  KTSMIAGEGVSNIRTVAAFN  892



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYSL FVYL +V+ 
Sbjct  49   LLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYSLYFVYLGLVVC  108

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  109  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  168

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  169  IGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  228

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  229  SYANAGIIAEQAIAQVRTVYSY  250


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    +  P +   K  +Y   ++   +  + +  
Sbjct  699  LGAIGSILSGFIGPTFAIVMSNMIEVF--YYRNPNKMESKTREYVFIYIGTGLYAVVAYL  756

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A ++TD   V+ AI+E
Sbjct  757  VQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSNLVTARLSTDAADVKSAIAE  816

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L   PL+ LA         G      K++ 
Sbjct  817  RISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  876

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  877  KTSMIAGEGVSNIRTVAAFN  896



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYSL FVYL +V+ 
Sbjct  51   LLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYSLYFVYLGLVVC  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  111  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  170

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  171  IGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  230

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  231  SYANAGIIAEQAIAQVRTVYSY  252


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 95/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +    +I+V    +  P++   K  +Y   ++   +  + +  
Sbjct  701  LGAVGSVLSGFIGPTFAIVMSNMIEVF--YYRNPSKMESKTREYVFIYIGTGLYAVVAYL  758

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A ++TD   V+ AI+E
Sbjct  759  VQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSNLVAARLSTDAADVKSAIAE  818

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L   PL+ LA         G      K++ 
Sbjct  819  RISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  878

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  879  KTSMIAGEGVSNIRTVAAFN  898



>ref|XP_008221400.1| PREDICTED: ABC transporter B family member 13-like [Prunus mume]
Length=1205

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V++++L  VYL +++  
Sbjct  50   LMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVSQHALYLVYLGLILFA  109

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+S+L QDI+ FDTEA    +I  I++D I+VQDAI
Sbjct  110  SAWIGVAFWMRTGERQTARLRLKYLQSVLKQDINFFDTEARDTNIIFHISSDAILVQDAI  169

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  170  GDKTGHALRYLSQFIVGFGIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  229

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  +RTV +F
Sbjct  230  YAEAGKVAEEVISQIRTVYSF  250


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILFS  187
            +G VGA + G   P+F +    I D++  AF  P  ++   +V K SL FV +++  +  
Sbjct  638  LGSVGAVLAGMEAPLFALL---ITDIL-TAFYAPTGSQIKQEVKKVSLIFVGVAVATVPI  693

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
               +   +   GER   ++R+    +ML+ ++  FD  E +TG + S +  +  +V+ A+
Sbjct  694  YLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLDENNTGALTSILAANATLVRSAL  753

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++     F I F   W+I+ V ++ +PL+  A         G      ++
Sbjct  754  ADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPLLIGASIAEQLFLKGFGGDYNRA  813

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +A  +A+E + N+RTV AF
Sbjct  814  YSKATAVAREAIANIRTVAAF  834



>ref|XP_010501626.1| PREDICTED: ABC transporter B family member 14-like [Camelina 
sativa]
Length=1233

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V++ +L  VYL +  L
Sbjct  27   FLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVSQNALYLVYLGLFNL  86

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTE      I  I++D I+VQDA
Sbjct  87   VSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTETRDSNFIFHISSDAILVQDA  146

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K+G+ + Y+ +FIAGF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  147  IGDKIGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAGGGYAIVMSTISEKSEA  206

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  207  AYADAGKVAEEVMSQVRTVYAF  228


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 98/212 (46%), Gaps = 27/212 (13%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFL-------FPAEASHKVAKYSLDFVYLS  169
             +G +GA + G S+P  F         +G A++       FP+    +V K  + FV   
Sbjct  664  LLGSIGAVLAG-SLPALFS--------MGIAYVLTTFYSPFPSLIKREVEKVIIIFVGTG  714

Query  170  IVILFSSWTEVACWMH-----TGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAI  331
            IV      T +    H      GER  +++R++   +++  +I  FD  E +TG + S +
Sbjct  715  IVT-----TPIYLLQHYFYTLMGERLTSRVRLSLFSAIILNEIGWFDLDENNTGSLTSIL  769

Query  332  TTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFV  511
            + D  +V+ AI++++   +  IS  +    + F   W+++ V  +  PL+  A       
Sbjct  770  SADATLVRSAIADRLSTIVQNISLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLF  829

Query  512  ATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
              G      ++Y RA  +A+E + N+RTV AF
Sbjct  830  LKGFGGDYTRAYSRATSLAREAIVNIRTVAAF  861



>ref|XP_011459839.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like, partial [Fragaria vesca subsp. vesca]
Length=1390

 Score =   214 bits (545),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 142/198 (72%), Gaps = 0/198 (0%)
 Frame = +2

Query  5     LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
             LM  G  G+C+HGA++PVFFV FG++ID +G   + P E S ++++Y+L  +YL IV+  
Sbjct  932   LMLFGSFGSCIHGAALPVFFVLFGRMIDSLGNMAMHPNEISSRISEYALYVIYLGIVLFI  991

Query  185   SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
             S+W  VA W  TGERQ A++R+ YL+S+L +DIS FDTEA    +I  I++D I+VQDAI
Sbjct  992   SAWIGVASWTRTGERQTARLRLKYLQSVLRKDISFFDTEARDANIIFHISSDTILVQDAI  1051

Query  365   SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
              +K G+ + Y+S+F+ GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  1052  GDKTGHTLRYLSQFVVGFAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  1111

Query  545   YVRAGEIAQEVVGNVRTV  598
             Y  AG++A+EV+  +RTV
Sbjct  1112  YAEAGKVAEEVISQIRTV  1129


 Score =   205 bits (522),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G  G+C+HGA+ PVFFV FG +ID +G   +   E S ++++Y+L  V L IV+  
Sbjct  52   LMLFGSFGSCIHGAAFPVFFVLFGGMIDSLGHMAMRSNEMSSRISEYALYVVCLGIVLFI  111

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA W  TGERQ A++R+ YL+S+L +DIS FDTEA    +I  I++D I+VQDAI
Sbjct  112  SAWIGVASWTRTGERQTARLRLKYLQSVLRKDISFFDTEARDANIIFHISSDTILVQDAI  171

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+F+ GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  172  GDKTGHTLRYLSQFVVGFVIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  231

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  +RTV +F
Sbjct  232  YAEAGKVAEEVISQIRTVYSF  252



>ref|XP_009113714.1| PREDICTED: ABC transporter B family member 14 [Brassica rapa]
Length=1232

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G  G CVHG ++P+FFVFFGK++D +G         S +V+K +L  VYL  V L 
Sbjct  36   LMFLGTFGTCVHGGTLPLFFVFFGKMLDSLGNLSTDSTAISSRVSKNALYLVYLGFVNLV  95

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTEA     I  I++D I+VQDAI
Sbjct  96   SAWMGVACWMQTGERQTARLRINYLKSILAKDITFFDTEARDSNFIFHISSDTILVQDAI  155

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL++VPLIA+AGG YA + + +  +   +
Sbjct  156  GDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAVIMSTISKKSEAA  215

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  VRTV A+
Sbjct  216  YADAGKVAEEVLSQVRTVYAY  236


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 95/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + GA   +F      ++++    F  P+     V K ++ FV + +V     
Sbjct  669  LLGSIGAVLAGAQPALFSTGIAYVLNLFYSPF--PSVIKRDVEKVAIVFVGVGVVTPLIY  726

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTE-ASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  +++R++   ++L+ ++  FD E  +TG + S +  D  +V+ A++
Sbjct  727  LLQHYFYTLMGERLTSRVRLSLFSAVLSNEVGWFDMEDNNTGSLTSILAADATLVRSALA  786

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  +S       + F   W+++ V  +  PL+  A         G      ++Y
Sbjct  787  DRLSTIVQNLSLTFTALAVAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFGGDYTRAY  846

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             +A  +A+E + N+RTV +F
Sbjct  847  SKATSVAREAIENIRTVASF  866



>emb|CDP07374.1| unnamed protein product [Coffea canephora]
Length=1259

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF G  GAC+HGA++P FFV FG++ID +G     P + +  V+KY++  VYL +VIL 
Sbjct  51   LMFFGSAGACLHGAALPAFFVLFGRMIDSLGHLSSNPHQMASVVSKYAVYLVYLGLVILM  110

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VACW  TGERQ  ++R+ YL+S+L ++IS FDTEA    +   I++D I+VQDAI
Sbjct  111  SAWIGVACWAQTGERQTTRLRLKYLQSILKKNISFFDTEAMDKNLTFHISSDAILVQDAI  170

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K+G+ + Y+S+F  GF IGFI +WQ++L+TL++VPLIA+AGG Y  + + +  +   +
Sbjct  171  GDKIGHSLRYLSQFFVGFAIGFISVWQLTLLTLAVVPLIAIAGGAYTLIMSTISQKGEAA  230

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG+IA+EV+  VRTV +F
Sbjct  231  YAEAGKIAEEVISQVRTVYSF  251


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 97/202 (48%), Gaps = 11/202 (5%)
 Frame = +2

Query  17   GFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK--YSLDFVYLSIVILFSS  190
            G +GA + G   P+F +    I+        F A+   ++ +  + +  ++L I +L   
Sbjct  690  GSIGAALAGMEAPLFALGITYILTA------FYAQDDTRITQEVHRVSLIFLGIALLNIP  743

Query  191  WTEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
               +  + +T  GER   ++R+    ++L+ +I  FD  E STG ++S +  D  +V+ A
Sbjct  744  IYLLQHYFYTLMGERLTTRVRLRMFSAILSNEIGWFDMDENSTGSLMSKLAADATLVRSA  803

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  ++  +  F I F   W+I+ V ++  PL+  A         G       
Sbjct  804  LADRLSTVVQNVALTVTSFVIAFTLSWRIAAVIIATFPLLIGASIAEQQFLKGFGGNYAA  863

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y R   +A+E + N+RTV AF
Sbjct  864  AYYRTTALAREAIVNIRTVAAF  885



>gb|EMS51604.1| ABC transporter B family member 2 [Triticum urartu]
Length=1214

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAKYSLDFVYL +VILF
Sbjct  214  LMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAKYSLDFVYLGVVILF  273

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSWTEVACWMHTGERQAAKMR+AYLRSML+QDI++FDTEASTGEVI+AIT+D++VVQDAI
Sbjct  274  SSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIAVFDTEASTGEVINAITSDVLVVQDAI  333

Query  365  SEKV  376
            SEK+
Sbjct  334  SEKI  337



>emb|CAC09461.2| H0423H10.7 [Oryza sativa Indica Group]
 gb|EAY95758.1| hypothetical protein OsI_17633 [Oryza sativa Indica Group]
Length=1269

 Score =   214 bits (544),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA  HGA++P+FF+ FG +I+  G+        + +V+KY+L FVYL +V+  
Sbjct  56   LMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCA  115

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  116  SSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  175

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  176  GEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  235

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  236  YANAGVVAEQAIAQVRTVYSF  256


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +  G+++DV    +  P E   K   Y   ++   +  + +  
Sbjct  707  LGAVGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGLYAVVAYL  764

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  765  VQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAE  824

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  825  RISVILQNMTSLMTSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHA  884

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  885  KSSMVAGEGVSNIRTVAAFN  904



>ref|XP_010480688.1| PREDICTED: ABC transporter B family member 14 [Camelina sativa]
Length=1247

 Score =   213 bits (543),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V++ +L  VYL +  L
Sbjct  47   FLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVSQNALYLVYLGLFNL  106

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ A++R+ YL+S+L +DI+ FDTE      I  I++D I+VQDA
Sbjct  107  VSAWIGVACWMQTGERQTARLRINYLKSILAKDITFFDTETRDSNFIYHISSDAILVQDA  166

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  167  IGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAGGGYAIVMSTISEKSET  226

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  227  AYADAGKVAEEVMSQVRTVYAF  248


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 82/167 (49%), Gaps = 1/167 (1%)
 Frame = +2

Query  110  FPAEASHKVAKYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISL  289
            FP+   H+V K  + FV   I+       +   +   GER  +++R++   ++L  +I  
Sbjct  709  FPSLIKHEVEKVIIIFVGTGILTTPIYLLQHYFYTLMGERLTSRVRLSLFSAILLNEIGW  768

Query  290  FD-TEASTGEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLS  466
            FD  E +TG + S ++ D  +V+ AI++++   +  IS  +    + F   W+++ V  +
Sbjct  769  FDLDENNTGSLTSILSADATLVRSAIADRLSTIVQNISLTVTALALAFFYSWRVAAVVTA  828

Query  467  IVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
              PL+  A         G      ++Y RA  +A+E + N+RTV AF
Sbjct  829  CFPLLIAASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAF  875



>ref|XP_003579371.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1266

 Score =   213 bits (543),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+  
Sbjct  52   LMAAGSLGALAHGAAMPCFFLLFGDLINGFGKNQTDLRTMTDEVAKYALYFVYLGLVVCV  111

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +S++E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  112  ASYSEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  171

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNF+HY++ F AG  +GF+  W+++L++++++P IA AGG+YA+  TGL +R R+S
Sbjct  172  GEKVGNFIHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSRSRES  231

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  232  YANAGVVAEQAIAQVRTVYSF  252


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  703  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYKDPNEMEKKTKLYVFIYIGTGIYAVVAYL  760

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVV-QDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A         + AI+E
Sbjct  761  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARVAVDAADVKSAIAE  820

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  I+  +  F +GF+  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  821  RISVILQNITSLMTSFIVGFVIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHA  880

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  881  KSSMVAGEGVSNIRTVAAFN  900



>emb|CAD59582.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 emb|CAD41854.2| OSJNBb0079B02.13 [Oryza sativa Japonica Group]
 emb|CAE05967.2| OSJNBa0063C18.8 [Oryza sativa Japonica Group]
Length=1268

 Score =   213 bits (543),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GA  HGA++P+FF+ FG +I+  G+        + +V+KY+L FVYL +V+  
Sbjct  55   LMAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCA  114

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SS+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  115  SSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  174

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  175  GEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  234

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  235  YANAGVVAEQAIAQVRTVYSF  255


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +  G+++DV    +  P E   K   Y   ++   +  + +  
Sbjct  706  LGAVGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGLYAVVAYL  763

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  764  VQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAE  823

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  824  RISVILQNMTSLMTSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHA  883

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  884  KSSMVAGEGVSNIRTVAAFN  903



>ref|XP_003544389.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   213 bits (543),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G VG+CVHGA++PVFF+ FG++ID +G     P + S ++++++L  VYL  V+L 
Sbjct  45   LMFLGSVGSCVHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRISEHALYLVYLGGVVLV  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+++L +DI+ FD EA    +I  I++D I+VQDAI
Sbjct  105  SAWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAI  164

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  165  GDKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAA  224

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  VRTV +F
Sbjct  225  YAEAGKVAEEVISQVRTVYSF  245


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    I+     AF  P  +  K     + F++L + ++    
Sbjct  682  LGSVGAILAGMEAPLFALGITHIL----TAFYSPQGSKIKQEVDWVAFIFLGVAVITIPI  737

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
              +  + +T  GER  A++R+    ++LN +++ FD  E +TG + + +  D  +V+ A+
Sbjct  738  YLLLHYFYTLMGERLTARVRLLMFSAILNNEVAWFDMDEHNTGSLTAMLAADATLVRSAL  797

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F IGF   W+++ V ++ +PL+  A         G       +
Sbjct  798  ADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHA  857

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV AF
Sbjct  858  YSRATSLAREAIANIRTVAAF  878



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   213 bits (543),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYSL FVYL +V+ 
Sbjct  51   LLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDEVSKYSLYFVYLGLVVC  110

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  111  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  170

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TG  ++ R+
Sbjct  171  IGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGPTSKSRE  230

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  231  SYANAGIIAEQAIAQVRTVYSY  252


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    F  P     K  +Y   ++      + +  
Sbjct  703  LGAIGSIMSGFIGPTFAIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGFYAVVAYL  760

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A + T+   V+ AI+E
Sbjct  761  IQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEENNSSLVAARLNTEAADVKSAIAE  820

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  821  RISVILQNMTSLLVSFIVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  880

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  881  KTSMIAGEGVSNIRTVAAFN  900



>ref|XP_007017851.1| P-glycoprotein 13 [Theobroma cacao]
 gb|EOY15076.1| P-glycoprotein 13 [Theobroma cacao]
Length=1241

 Score =   213 bits (542),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF G +GAC+HGA++PVFF+ FG++ID +G     P + S +V++++L  VYL +V+  
Sbjct  43   LMFSGSLGACIHGAALPVFFILFGRMIDSLGHLSSNPQKLSARVSEHALYLVYLGLVVFA  102

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+S+L +DIS FDT+A    +I  I++D I+VQDAI
Sbjct  103  SAWIGVAFWMQTGERQTARLRLKYLQSVLRKDISFFDTKARDSNIIFHISSDAILVQDAI  162

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+F+ GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  163  GDKTGHAIRYLSQFVVGFAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  222

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  +RTV A+
Sbjct  223  YAEAGKVAEEVISQIRTVYAY  243


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 100/202 (50%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHK--VAKYSLDFVYLSIVILF  184
             +G +GA + G   P+F   FG  I  +  AF  P +   K  V + +L FV L+I+ + 
Sbjct  680  LLGSLGAILAGMEAPLFA--FG--ITHVLTAFYSPHDIQIKKEVERVALIFVGLAILTIP  735

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GE   A++R++   ++L+ +I  FD  E +TG +  A+  D  +V+ A
Sbjct  736  IYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGWFDMNENNTGSLTGALAADATLVRSA  795

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  ++  +  F I F   W+I+ V ++  PL+  A         G       
Sbjct  796  LADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGFGGNYSH  855

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV +F
Sbjct  856  AYSRATAVAREAIVNIRTVASF  877



>ref|XP_003549468.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G  G+CVHGA++PVFF+ FG++ID +G     P + S +V++++L  VYL  V+L 
Sbjct  45   LMFLGCFGSCVHGAALPVFFILFGRMIDSLGHLSNDPHKLSSRVSEHALYLVYLGGVVLV  104

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+++L +DI+ FD EA    +I  I++D I+VQDAI
Sbjct  105  SAWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAI  164

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  165  GDKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAA  224

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++AQEV+  VRTV +F
Sbjct  225  YAEAGKVAQEVISQVRTVYSF  245


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    I+     AF  P  +  K     + F++L + ++    
Sbjct  682  LGSVGAILAGMEAPLFALGITHIL----TAFYSPQGSKIKQEVDRVAFIFLGVAVITIPI  737

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAI  364
              +  + +T  GER  A++R+    ++LN +++ FD  E +TG + + +  D  +V+ A+
Sbjct  738  YLLLHYFYTLMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSAL  797

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F IGF   W+++ V ++ +PL+  A         G       +
Sbjct  798  ADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHA  857

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV AF
Sbjct  858  YSRATSLAREAIANIRTVAAF  878



>ref|XP_002962569.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ36032.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1329

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM +G +GA VHG +VPV+F FFG+++D  GE +  P+  + +V+ YSL  +YL++V+L
Sbjct  146  LLMAIGTLGAVVHGLAVPVYFYFFGRLVDAFGENYANPSSMASEVSTYSLYLLYLALVVL  205

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             ++W EV+CWMH+GERQ+AK+R+ YL+S+L QD+  FDT+   GE+++ I++DI+++QDA
Sbjct  206  GAAWLEVSCWMHSGERQSAKIRIKYLKSILVQDVGFFDTDMCVGEIVNQISSDILIIQDA  265

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK GN +H+++RFI G   GF+ +WQ++L+T+++VP IALAGG YA       A+ +K
Sbjct  266  ISEKAGNLIHFLARFIGGLVAGFVAVWQLALITVAVVPAIALAGGAYAVSLINTAAKSQK  325

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +   AG+IA++V+  VRTV +F
Sbjct  326  ANEEAGKIAEQVIAQVRTVYSF  347


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 100/204 (49%), Gaps = 15/204 (7%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + G   P+F +   +++      F  P +     +V+K+SL     +I ++F
Sbjct  763  LLGTIGAIISGCEFPLFALAITQVLIT----FYSPDKEFLKKEVSKFSLILTGSTICVVF  818

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS-TGEVISAITTDIIVVQDA  361
            S   +   +   GE    ++R      +LN +IS FD E +  G V S + +D  +V+  
Sbjct  819  SHMLQHYSFGAMGESLTKRVREMMFLGILNNEISWFDEEDNRCGLVASRLASDATMVRVV  878

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVP--LIALAGGVYAFVATGLIARV  535
            I++++   +  ++     F I ++  W++++V  +  P  LIAL G +           +
Sbjct  879  IADRMSTIVQNLALMFVAFFIAYVLEWRVAVVITATFPLLLIALVGELC------FSGDL  932

Query  536  RKSYVRAGEIAQEVVGNVRTVQAF  607
             K+Y RA  +A E VGN+RTV AF
Sbjct  933  SKAYSRASTVASEAVGNIRTVAAF  956



>ref|XP_007225446.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
 gb|EMJ26645.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
Length=1244

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V++++L  VYL +++  
Sbjct  50   LMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVSQHALYLVYLGLILFA  109

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+S+L QDI+ FDTEA    +I  I++D I+VQDAI
Sbjct  110  SAWIGVAFWMRTGERQTARLRLKYLQSVLKQDINFFDTEARDTNIIFHISSDAILVQDAI  169

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF IGF  +W+++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  170  GDKTGHALRYLSQFIVGFGIGFTSVWRLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  229

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  +RTV +F
Sbjct  230  YAEAGKVAEEVISQIRTVYSF  250


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILFS  187
            +G VGA + G   P+F +    I D++  AF  P  ++   +V K +L FV +++  +  
Sbjct  677  LGSVGAVLAGMEAPLFALL---ITDIL-TAFYAPTGSQIKQEVKKVALIFVGVAVATVPI  732

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
               +   +   GER   ++R+    +ML+ ++  FD  E +TG + S +  +  +V+ A+
Sbjct  733  YLLQHYFYTLMGERLTTRVRLLMFTAMLSNEVGWFDLDENNTGALTSILAANATLVRSAL  792

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++     F I F   W+I+ V ++ +PL+  A         G      ++
Sbjct  793  ADRLSTIVQNLALTATAFVIAFTLSWRIAAVVIASLPLLIGASIAEQLFLKGFGGDYNRA  852

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +A  +A+E + N+RTV AF
Sbjct  853  YSKATAVAREAIANIRTVAAF  873



>gb|EAZ32166.1| hypothetical protein OsJ_16371 [Oryza sativa Japonica Group]
Length=1213

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 146/200 (73%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            M  G +GA  HGA++P+FF+ FG +I+  G+        + +V+KY+L FVYL +V+  S
Sbjct  1    MAAGSLGALAHGAAMPLFFLLFGDLINGFGKNQTDLRTMTDEVSKYALYFVYLGLVVCAS  60

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAIS  367
            S+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI 
Sbjct  61   SYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAIG  120

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            EKVGNF+HYI+ F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+SY
Sbjct  121  EKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESY  180

Query  548  VRAGEIAQEVVGNVRTVQAF  607
              AG +A++ +  VRTV +F
Sbjct  181  ANAGVVAEQAIAQVRTVYSF  200


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 96/200 (48%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VG+ + G   P F +  G+++DV    +  P E   K   Y   ++   +  + +  
Sbjct  651  LGAVGSVLSGFIGPTFAIVMGEMLDVF--YYRDPNEMEKKTKLYVFIYIGTGLYAVVAYL  708

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A +  D   V+ AI+E
Sbjct  709  VQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFDEEENNSSLVAARLAVDAADVKSAIAE  768

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++L+ L+  PL+ LA         G      K++ 
Sbjct  769  RISVILQNMTSLMTSFIVGFIIEWRVALLILATFPLLVLANFAQQLSMKGFAGDTAKAHA  828

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  829  KSSMVAGEGVSNIRTVAAFN  848



>gb|KHN39417.1| ABC transporter B family member 13 [Glycine soja]
Length=1205

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 145/200 (73%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            MF+G VG+CVHGA++PVFF+ FG++ID +G     P + S ++++++L  VYL  V+L S
Sbjct  1    MFLGSVGSCVHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRISEHALYLVYLGGVVLVS  60

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAIS  367
            +W  VA WM TGERQ A++R+ YL+++L +DI+ FD EA    +I  I++D I+VQDAI 
Sbjct  61   AWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIG  120

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +K G+ + Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +Y
Sbjct  121  DKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAY  180

Query  548  VRAGEIAQEVVGNVRTVQAF  607
              AG++A+EV+  VRTV +F
Sbjct  181  AEAGKVAEEVISQVRTVYSF  200


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    I+     AF  P  +  K     + F++L + ++    
Sbjct  637  LGSVGAILAGMEAPLFALGITHIL----TAFYSPQGSKIKQEVDRVAFIFLGVAVITIPI  692

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
              +  + +T  GER  A++R+    ++LN +++ FD  E +TG + + +  D  +V+ A+
Sbjct  693  YLLLHYFYTLMGERLTARVRLLMFSAILNNEVAWFDMDEHNTGSLTAMLAADATLVRSAL  752

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F IGF   W+++ V ++ +PL+  A         G       +
Sbjct  753  ADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHA  812

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV AF
Sbjct  813  YSRATSLAREAIANIRTVAAF  833



>gb|KHN12634.1| ABC transporter B family member 13 [Glycine soja]
Length=1205

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 144/200 (72%), Gaps = 0/200 (0%)
 Frame = +2

Query  8    MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            MF+G  G+CVHGA++PVFF+ FG++ID +G     P + S +V++++L  VYL  V+L S
Sbjct  1    MFLGCFGSCVHGAALPVFFILFGRMIDSLGHLSNDPHKLSSRVSEHALYLVYLGGVVLVS  60

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAIS  367
            +W  VA WM TGERQ A++R+ YL+++L +DI+ FD EA    +I  I++D I+VQDAI 
Sbjct  61   AWMGVAFWMQTGERQTARLRLKYLQAVLKKDINFFDNEARDANIIFHISSDAILVQDAIG  120

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +K G+ + Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +Y
Sbjct  121  DKTGHAIRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAVAGGAYTIIMSTLSEKGEAAY  180

Query  548  VRAGEIAQEVVGNVRTVQAF  607
              AG++AQEV+  VRTV +F
Sbjct  181  AEAGKVAQEVISQVRTVYSF  200


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    I+     AF  P  +  K     + F++L + ++    
Sbjct  637  LGSVGAILAGMEAPLFALGITHIL----TAFYSPQGSKIKQEVDRVAFIFLGVAVITIPI  692

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAI  364
              +  + +T  GER  A++R+    ++LN +++ FD  E +TG + + +  D  +V+ A+
Sbjct  693  YLLLHYFYTLMGERLTARVRLLMFSAILNNEVAWFDKDENNTGSLTAMLAADATLVRSAL  752

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F IGF   W+++ V ++ +PL+  A         G       +
Sbjct  753  ADRLSTIVQNVALTVTAFVIGFTLSWKLTAVVVACLPLLIGASITEQLFLKGFGGDYGHA  812

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV AF
Sbjct  813  YSRATSLAREAIANIRTVAAF  833



>gb|EMT07148.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1237

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM +G +GA  HGA++P FF+ FG +I+  G+        + +VAKY+L FVYL +V+  
Sbjct  57   LMSLGTLGALAHGAAMPCFFLLFGDLINGFGKNQTDLRAMTDEVAKYALYFVYLGLVVCV  116

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            +S+ E+ACWM+TGERQ   +R AYL ++L QD+  FDT+A TG+++  ++TD ++VQDAI
Sbjct  117  ASYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFDTDARTGDIVFGVSTDTLLVQDAI  176

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             EK GNFMHY++ F AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R+S
Sbjct  177  GEKGGNFMHYLATFFAGLIVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRES  236

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG +A++ +  VRTV +F
Sbjct  237  YANAGVVAEQAIAQVRTVYSF  257


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 93/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +  G+++DV    +  P E   K   Y   ++   I  + +  
Sbjct  708  LGAIGSVLSGFIGPTFAIVMGEMLDVF--YYKDPVEMEKKTKLYVFIYIGTGIYAVVAYL  765

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVV-QDAISE  370
             +   +   GE    ++R   L ++L  ++  FD E +   +++A         + AI+E
Sbjct  766  VQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEENNSSLVAARVAVDAADVKSAIAE  825

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  I+  +  F +GFI  W+++++ L+  PL+ LA         G      K++ 
Sbjct  826  RISVILQNITSLMTSFIVGFIIEWRVAILILATFPLLVLANFAQQLSMKGFAGDTAKAHA  885

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            ++  +A E V N+RTV AF 
Sbjct  886  KSSMVAGEGVSNIRTVAAFN  905



>gb|KJB63497.1| hypothetical protein B456_010G002700 [Gossypium raimondii]
Length=1242

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LM  G +GAC+HGA++PVFFV FG++ID +G     P + S +V+++++  VYL +V+  
Sbjct  44   LMVFGSLGACIHGAALPVFFVMFGRMIDSLGHLSSDPHKLSAQVSEHAIYLVYLGLVVFA  103

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+S+L +DIS FDTEA    +I  I++D I+VQDAI
Sbjct  104  SAWIGVAFWMQTGERQTARLRLKYLQSVLRKDISFFDTEARASNIIFHISSDAILVQDAI  163

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+   Y+S+FI GF IGF  +WQ++L+TL++VPLIA+AGG Y  + + L  +   +
Sbjct  164  GDKTGHAFRYLSQFIVGFAIGFTSVWQLTLLTLAVVPLIAIAGGAYTIIMSTLSEKGEAA  223

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG+IA+EV+  +RTV AF
Sbjct  224  YSEAGKIAEEVISQIRTVYAF  244


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 101/202 (50%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G VGA + G   P+F   FG  I  +  AF  P +     +V + +L FV L+I+ + 
Sbjct  681  LLGSVGAILAGMEAPLFA--FG--ITHVLTAFYSPDDIQIKEEVKRVALIFVGLAILTIP  736

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GE   A++R++   ++L+ ++  FD  E +TG + +A+  D  +V+ A
Sbjct  737  IYMLQHYFYTLMGENLTARVRLSMFSAILSNEVGWFDLDENNTGSLTAALAADATLVRSA  796

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  ++  +  F I F   W+I+ V ++  PL+  A         G       
Sbjct  797  LADRLSTIVQNVALTVTAFVIAFALSWRIASVIIASFPLLIGASITEQLFLKGFGGNYSH  856

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV AF
Sbjct  857  TYSRATAVAREAIVNIRTVAAF  878



>ref|XP_006306603.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
 gb|EOA39501.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
Length=1247

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P+FFVFFG ++D +G     P   S  V++ +L  VYL  V L
Sbjct  46   FLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNLSTDPKAISSHVSQNALYLVYLGFVNL  105

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQAA++R+ YL+S+L +DI+ FDTE      I  I++D I+VQDA
Sbjct  106  VSAWIGVACWMQTGERQAARLRINYLKSILAKDITFFDTETRDSNFIFHISSDAILVQDA  165

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +F  GF IGF+ +WQ++L+TL +VPLIA+AGG YA V + +  +   
Sbjct  166  IGDKTGHVLRYLCQFTVGFVIGFLSVWQLTLLTLGVVPLIAVAGGGYAIVMSTISEKSEA  225

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+EV+  VRTV AF
Sbjct  226  AYADAGKVAEEVMSQVRTVYAF  247


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 98/207 (47%), Gaps = 17/207 (8%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFL-------FPAEASHKVAKYSLDFVYLS  169
             +G +GA + G S+P  F         +G A++       FP+    +V K  + FV  +
Sbjct  684  LLGSIGAVLAG-SLPALFS--------MGIAYVLTTFYSPFPSLIKREVEKVIIIFVGTA  734

Query  170  IVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDII  346
            IV       +   +   GER  +++R++   ++L  +I  FD  E +TG + S ++ D  
Sbjct  735  IVTTPIYLLQHYFYTLMGERLTSRVRLSLFSAILVNEIGWFDLDENNTGSLTSILSADAT  794

Query  347  VVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLI  526
            +V+ A+++++   +  IS  +    + F   W+++ V  +  PL+  A         G  
Sbjct  795  LVRSAVADRLSTIVQNISLTVTALALAFFYSWRVAAVVTACFPLLIAASLTEQLFLKGFG  854

Query  527  ARVRKSYVRAGEIAQEVVGNVRTVQAF  607
                ++Y RA  +A+E + N+RTV AF
Sbjct  855  GDYTRAYSRATSLAREAIVNIRTVAAF  881



>ref|XP_010527726.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Tarenaya hassleriana]
Length=1268

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF G +GA +HGA++PVFF+ FG+++D +G  +  P   S +V++ +L+ VYL +  L 
Sbjct  53   LMFFGSLGAAIHGATLPVFFILFGRMLDALGTLYANPGSMSSRVSQTALNAVYLGLANLV  112

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            SSW  VACWM TGERQ A++R+ YL S+L +DI+ FDTE     +I  I++D I+VQDAI
Sbjct  113  SSWVGVACWMQTGERQTARLRINYLNSILRRDIAFFDTEVRDSNLIFHISSDAILVQDAI  172

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+ +F+ GF IGF  +WQI+L+TL++VPLIA+AGG YA + + +  +   +
Sbjct  173  GDKTGHALRYLFQFLVGFAIGFFSVWQITLLTLAVVPLIAIAGGSYAIIMSTISEKSEAA  232

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y   G++A+EV+  VRTV AF
Sbjct  233  YADGGKVAEEVISQVRTVYAF  253


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA   GA  P+F +  G    +      FP    H V + +  F+ +  + +   
Sbjct  694  LLGSIGAVFTGAQTPLFSM--GITYALTAFYSPFPHVIKHDVERVAFIFIGMGFLAVPIY  751

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAIS  367
                  +   GER  A++R++   ++L+ +I  FD  E +TG + S +  D  +V+  ++
Sbjct  752  LLHHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSCLA  811

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            E++   +  +S  I  F + FI  W+++ V  +  PLI L+         G       +Y
Sbjct  812  ERLSTIVQNLSLTITAFVLAFIYNWRVAAVVTACFPLIILSFVAEQMFLKGFGGDYTTAY  871

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA  +A+E V N+RTV AF
Sbjct  872  SRATTVAREAVTNIRTVAAF  891



>ref|XP_010439790.1| PREDICTED: ABC transporter B family member 14-like isoform X1 
[Camelina sativa]
Length=1250

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G +G C+HG ++P FFVFFG ++D +G  +  P   S  V++ +L  VYL +V L
Sbjct  49   FLMFLGGLGNCIHGGTLPFFFVFFGGMLDSLGNLYKDPKAISSHVSQNALYLVYLGLVNL  108

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VACWM TGERQ  ++R++YL+S+L +DI+ FDTE      I  I++D I+VQDA
Sbjct  109  VSAWIGVACWMQTGERQTRRLRISYLKSILAKDITFFDTETRDSNFIFHISSDAILVQDA  168

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+ +FIAGF IGF+ +WQ++L+TL +VPLIA+A G YA V + +  +   
Sbjct  169  IGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVAVGGYAIVMSTISEKSEA  228

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG+IA+EV+  VRTV AF
Sbjct  229  AYADAGKIAEEVMSQVRTVYAF  250


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAISEKVGNFMHYI  397
            GER  +++R++   ++L+ +I  FD  E +TG + S ++ D  +V+ AI++++   +  I
Sbjct  755  GERLTSRVRLSLFSAILSNEIGWFDLEENNTGSLTSILSADATLVRSAIADRLSTIVQNI  814

Query  398  SRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEV  577
            S  +    + F   W+++ V  +  PLI  A         G      ++Y RA  +A+E 
Sbjct  815  SLTVTSLGLAFFYCWRVAAVVTACFPLIITASLTEQLFLKGFGGDYTRAYSRATSLAREA  874

Query  578  VGNVRTVQAF  607
            + N+RTV AF
Sbjct  875  IVNIRTVAAF  884



>ref|XP_011083466.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Sesamum indicum]
Length=1247

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G +GAC+ GA++PVFFV FG++I+ +G   L P   S +V+KY+L  VYL +V+  
Sbjct  50   LMFIGSIGACLQGAALPVFFVLFGRMINTLGNLSLDPHRFSSEVSKYALYLVYLGLVVWL  109

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+WT VACW  TGERQ A +R  YL S+L ++I  FDTEA    ++  I++D I+VQDAI
Sbjct  110  SAWTGVACWTQTGERQTALLRQKYLESVLKKNIQFFDTEAGQHNILFHISSDAILVQDAI  169

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K+ + + Y+S+F+ GF++GF  +WQ++L+TL+IVPLIA+AGG Y  + + L  R   +
Sbjct  170  GDKICHAICYLSQFVIGFSLGFSMVWQLTLLTLAIVPLIAVAGGAYTIIMSTLSKRGENA  229

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++ +EV+  VRTV +F
Sbjct  230  YAEAGKLTEEVISQVRTVYSF  250


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 99/200 (50%), Gaps = 3/200 (2%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSS  190
             +G +GA + G   P+F +    I+ V        +    +V + S  F+  ++V +   
Sbjct  677  LLGSLGAILAGMEAPLFALAITHILTVFYSHN--DSRIKQEVRQMSFIFIGAAMVTVLVY  734

Query  191  WTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDT-EASTGEVISAITTDIIVVQDAIS  367
              +   +   GER  A++R+   ++ML+ +++ FD  E STG + S + TD  +V+ A++
Sbjct  735  LLQHYFYTLMGERLIARVRLLMFKAMLSNEVAWFDKDENSTGSLASKLATDATLVRSALA  794

Query  368  EKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSY  547
            +++   +  I+  +  F I F+  W+I+   ++  PL+  A         G       +Y
Sbjct  795  DRISTVIQNIALAVTAFVIAFVLSWRIAAGVVATFPLLIGANIAEQLFLKGFGGDYVTAY  854

Query  548  VRAGEIAQEVVGNVRTVQAF  607
             RA E+A+E + N+RTV AF
Sbjct  855  YRATEVAREAIANIRTVAAF  874



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V++++L  VYL + +L
Sbjct  47   FFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVSRHALYLVYLGLGVL  106

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VA WM TGERQ A++R+ YL+S+L QDI+ FDTEA    +   I+ D I++QDA
Sbjct  107  ASAWIGVAFWMQTGERQTARLRLKYLQSVLRQDINFFDTEARDKNITFHISNDAILLQDA  166

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K+G+ + Y+S+F  GF IGF  +WQ++L+T+++VPL+A+AGG Y  + T L  +   
Sbjct  167  IGDKIGHGLRYLSQFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEA  226

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+E +  VRTV +F
Sbjct  227  AYAEAGKVAEEAISQVRTVYSF  248


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 97/201 (48%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVI--GEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            +G VGA + G   P+F +    ++     G+ F    E  H     SL FV  +I+ +F 
Sbjct  687  LGSVGAILAGMEAPLFALGITHVLTAFYSGKDFQIKREVDH----ISLIFVGAAILTIFI  742

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
               +   +   GER   ++R+    ++L+ +I  FD  E STG + S +  D  +V+ A+
Sbjct  743  YLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLDENSTGSLTSKLAADATLVRSAL  802

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F I F   W+I+ V ++  PL+  A         G      ++
Sbjct  803  ADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGFGGDYTRA  862

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +A  +A+E + N+RTV AF
Sbjct  863  YAQATAVAREAIANIRTVAAF  883



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            F MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V++++L  VYL + +L
Sbjct  137  FFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVSRHALYLVYLGLGVL  196

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             S+W  VA WM TGERQ A++R+ YL+S+L QDI+ FDTEA    +   I+ D I++QDA
Sbjct  197  ASAWIGVAFWMQTGERQTARLRLKYLQSVLRQDINFFDTEARDKNITFHISNDAILLQDA  256

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K+G+ + Y+S+F  GF IGF  +WQ++L+T+++VPL+A+AGG Y  + T L  +   
Sbjct  257  IGDKIGHGLRYLSQFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEA  316

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A+E +  VRTV +F
Sbjct  317  AYAEAGKVAEEAISQVRTVYSF  338


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 96/201 (48%), Gaps = 7/201 (3%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVI--GEAFLFPAEASHKVAKYSLDFVYLSIVILFS  187
            +G VGA + G   P+F +    ++     G+ F    E  H     SL FV  +I+ +F 
Sbjct  777  LGSVGAILAGMEAPLFALGITHVLTAFYSGKDFQIKREVDH----ISLIFVGAAILTIFI  832

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
               +   +   GER   ++R+    ++L+ +I  FD  E STG + S +  D  + + A+
Sbjct  833  YLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWFDLDENSTGSLTSKLAADATLXRSAL  892

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  ++  +  F I F   W+I+ V ++  PL+  A         G      ++
Sbjct  893  ADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIASFPLLIGASITEQLFLKGFGGDYTRA  952

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y +A  +A+E + N+RTV AF
Sbjct  953  YAQATAVAREAIANIRTVAAF  973



>ref|XP_010069803.1| PREDICTED: ABC transporter B family member 13-like [Eucalyptus 
grandis]
 gb|KCW58265.1| hypothetical protein EUGRSUZ_H00958 [Eucalyptus grandis]
Length=1253

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF G  GAC+HGA++PVFFV FG++ID +G+    P   S +V++ +L  VYL +++  
Sbjct  55   LMFFGSAGACIHGAALPVFFVLFGRMIDSLGKLSSDPHGLSSRVSEDALYLVYLGVIVFA  114

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA W  TGERQ A++R+ YL+++L +DI+ FDTEA    ++  IT+D I+VQDAI
Sbjct  115  SAWIGVALWTQTGERQTARLRLKYLQAVLRKDINFFDTEAKDCNILHHITSDAILVQDAI  174

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+FI GF +GF  +WQ++L+TL++VPLIA AGG Y  + + L  +   +
Sbjct  175  GDKTGHALRYLSQFIVGFAVGFTSVWQLTLLTLAVVPLIAFAGGAYTIIMSSLSEKGEAA  234

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+EV+  +RTV +F
Sbjct  235  YAEAGKVAEEVISQIRTVYSF  255


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 94/202 (47%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPA--EASHKVAKYSLDFVYLSIVILF  184
             +G VGA + G   P+F +    I+     AF  P    A  +V + +L FV ++ + + 
Sbjct  683  LLGSVGAVLAGMEAPLFAIGITHIL----SAFYSPDAHRAKQEVDRIALLFVGVAAITIP  738

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER   ++R     ++L  +I  FD  E STG + + +  D  +V+ A
Sbjct  739  IYLIQHFFYTLMGERLTTRVRSLMFSAILTNEIGWFDLDENSTGSLTTILAADATLVRSA  798

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++      ++  +  F I F   W+I+ V ++  PL+  A         G       
Sbjct  799  LADRLSTITQNVALTVTAFVIAFKLSWRIAAVVIASFPLLVGASITEQLFLKGFGGDYST  858

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y RA  +A+E + N+RTV AF
Sbjct  859  AYSRATSLAREAIANIRTVAAF  880



>emb|CAD59581.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1256

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM  G  GA VHGA++PVFF+ FG++I+  G+             +YSL FVYL +V+ 
Sbjct  44   LLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKN---QHSLRRMTDEYSLYFVYLGLVVC  100

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +++TD ++VQDA
Sbjct  101  ASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFSVSTDTLLVQDA  160

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I EKVGNF+HY+S F+AG  +GF+  W+++L++++++P IA AGG+YA+  TGL ++ R 
Sbjct  161  IGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRD  220

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            SY  AG IA++ +  VRTV ++
Sbjct  221  SYANAGIIAEQAIAQVRTVYSY  242


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 94/200 (47%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    F  P     K  +Y   ++   +  + +  
Sbjct  693  LGAIGSILSGFIGPTFAIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGLYAVVAYL  750

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L ++L  D+  FD E +   +++A ++TD   V+ AI+E
Sbjct  751  VQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEENNSSLVAARLSTDAADVKSAIAE  810

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  811  RISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  870

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  871  KTSMIAGEGVSNIRTVAAFN  890



>ref|XP_006306598.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
 gb|EOA39496.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
Length=1277

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 151/233 (65%), Gaps = 31/233 (13%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL----------  151
            FLM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V++ SL          
Sbjct  46   FLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKTISSRVSQVSLKPAINGNILF  105

Query  152  ---DF------------------VYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSM  268
               DF                  VYL +V L S+W  V+CWM TGERQ A++R+ YL+S+
Sbjct  106  LSIDFVVITFHGVLSFFKNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSI  165

Query  269  LNQDISLFDTEASTGEVISAITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQI  448
            L +DI+ FDTEA    +I  I++D I+VQDAI +K  + + Y+S+FIAGF IGF+ +WQ+
Sbjct  166  LAKDITFFDTEARDSNLIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQL  225

Query  449  SLVTLSIVPLIALAGGVYAFVATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
            +L+TL++VPLIA+AGG YA + + +  +   +Y  AG++A+EV+  VRTV AF
Sbjct  226  TLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAF  278


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 97/202 (48%), Gaps = 7/202 (3%)
 Frame = +2

Query  11   FVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEA--SHKVAKYSLDFVYLSIVILF  184
             +G +GA + GA  P+F +    ++     AF  P+ +   H V K +L FV   I    
Sbjct  714  LLGSIGAVLAGAQTPLFSMGIAYVL----TAFYSPSPSLIKHDVEKVALIFVGAGIATAP  769

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDA  361
                +   +   GER  +++R++   ++L+ +I  FD  E +TG + S +  D  +V+ +
Sbjct  770  IYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNTGSLTSILAADATLVRSS  829

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            +++++   +  +S  I    + F   W+++ +  +  PL+  A         G      +
Sbjct  830  LADRLSTIVQNLSLTITALALAFYYSWRVAAIVTACFPLLIAASLTEQLFLKGFGGDYTR  889

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y +A  +A+E + N+RTV AF
Sbjct  890  AYSKATSVAREAIANIRTVAAF  911



>ref|XP_011034997.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Populus euphratica]
Length=1246

 Score =   207 bits (528),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 139/202 (69%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+KYSLD VYL + + 
Sbjct  47   FLMFLGLVGSCAHGAVYPMFFVLFGHLIDSLGHVGSDPHQMSSQVSKYSLDLVYLGLGVF  106

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             + W  VA WM TGERQ A++R+ YL+S+L +D++ FD EA    ++  I++D I+VQDA
Sbjct  107  VAGWIGVASWMQTGERQTARLRLKYLQSVLRKDMNFFDIEARDSNILFHISSDAILVQDA  166

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F  GF +GF  +WQ++L+TL++VPL+A+AGG Y  + + L  +   
Sbjct  167  IGDKTGHAVRYLSQFFIGFVVGFKSVWQLTLLTLAVVPLMAVAGGAYTIIMSTLSEKGEA  226

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A E +  +RTV +F
Sbjct  227  AYAEAGKVADEAISQIRTVYSF  248


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 98/201 (49%), Gaps = 8/201 (4%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFP--AEASHKVAKYSLDFVYLSIVILFS  187
            +G  GA + G   P+F +    ++     AF  P  ++   +V   +L FV  ++V +  
Sbjct  680  LGSAGAMMAGMEAPLFALGITHML----TAFYSPDISQMKKEVHLVALIFVGAAVVTVPI  735

Query  188  SWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
               +   +   GER  A++R++   ++L  +I  FD  E STG + S +  D  +V+  +
Sbjct  736  YILQHYFYTLMGERLIARVRLSMFSAILCNEIGWFDLDENSTGSLTSTLAADATLVRSTL  795

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  +S  +  F IGF   W++S V ++  PL+  A         G     R S
Sbjct  796  ADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPLLIGAAITEQLFLKGFGGDYR-S  854

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV +F
Sbjct  855  YTRANAVAREAIANIRTVASF  875



>ref|XP_009395305.1| PREDICTED: ABC transporter B family member 1-like [Musa acuminata 
subsp. malaccensis]
Length=1377

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
             LM VG  GA VHG+S+P+F  FF  +++  G     P     +V KY+  F+ +   I 
Sbjct  138  LLMAVGTAGAIVHGSSLPIFLRFFANLVNSFGSNAGDPDTMVREVVKYAFYFLVVGAAIW  197

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             SSW E++CWM TGERQ+ +MR+ YL + LNQD+  FDTE  T +V+ AI  D ++VQDA
Sbjct  198  ASSWAEISCWMWTGERQSTQMRIKYLEAALNQDVRYFDTEVRTSDVVYAINADAVIVQDA  257

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            ISEK+GNF+HY++ F++GF +GF   WQ++LVTL++VPLIA+ GG++ F  T L ++ + 
Sbjct  258  ISEKLGNFIHYMATFVSGFVVGFTAAWQLALVTLAVVPLIAIIGGIHTFTLTKLSSKSQD  317

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            + VRA  IA++ +  +RTVQ+F
Sbjct  318  ALVRASNIAEQALAQIRTVQSF  339


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 2/149 (1%)
 Frame = +2

Query  167  SIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEAS-TGEVISAITTDI  343
            S  +LF++   +  W   GE    ++R   L S+L  +I+ FD E + +  +   +T D 
Sbjct  844  SAALLFNTMQHL-FWDVVGENLTKRVREKMLTSVLRNEIAWFDREENGSARIAGRLTADA  902

Query  344  IVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGL  523
              V+ AI +++   +   S  +  FT GF+  W+++LV +++ P++  A  +      G 
Sbjct  903  HNVRSAIGDRISVIVQNTSLMLVAFTAGFVLEWRLALVLIAVFPVVVAATVLQKMFMKGF  962

Query  524  IARVRKSYVRAGEIAQEVVGNVRTVQAFT  610
               +  ++ +A +IA E V NVRTV AF 
Sbjct  963  SGDLEVAHAKATQIAGEAVANVRTVAAFN  991



>gb|EMT32511.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1274

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 145/213 (68%), Gaps = 11/213 (5%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIG-----------EAFLFPAEASHKVAKYS  148
             LM  G  GA VHGA++PVFF+ FG++++  G           E       AS    +YS
Sbjct  48   LLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDELLTLNLTASLCALQYS  107

Query  149  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA  328
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L QD+  FDT+A TG+V+ +
Sbjct  108  LYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFDTDARTGDVVFS  167

Query  329  ITTDIIVVQDAISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAF  508
            ++TD ++VQDAI EKVGNF+HY++ F+AG  +GF+  W+++L++++++P IA AGG+YA+
Sbjct  168  VSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAY  227

Query  509  VATGLIARVRKSYVRAGEIAQEVVGNVRTVQAF  607
              TGL ++ R SY  AG IA++ +  VRTV ++
Sbjct  228  TLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSY  260


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 91/200 (46%), Gaps = 3/200 (2%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G +G+ + G   P F +    +I+V    F  P     K  +Y   ++      + +  
Sbjct  711  LGAIGSIMSGFIGPTFAIVMSNMIEVF--YFRDPNAMERKTREYVFIYIGTGFYAVVAYL  768

Query  194  TEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISA-ITTDIIVVQDAISE  370
             +   +   GE    ++R   L  +L  D+  FD E +   +++A + T+   V+ AI+E
Sbjct  769  IQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEENNSSLVAARLNTEAADVKSAIAE  828

Query  371  KVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKSYV  550
            ++   +  ++  +  F +GFI  W+++++ L   PL+ LA         G      K++ 
Sbjct  829  RISVILQNMTSLLVSFIVGFIIEWRVAILILVTFPLLVLANFAQQLSMKGFAGDTAKAHA  888

Query  551  RAGEIAQEVVGNVRTVQAFT  610
            +   IA E V N+RTV AF 
Sbjct  889  KTSMIAGEGVSNIRTVAAFN  908



>gb|KDO84910.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=782

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    LMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILF  184
            LMF+G +GA +HGA++PVFF+ FG++ID +G     P   + ++++++L  VYL +V L 
Sbjct  51   LMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRISEHALYLVYLGLVALV  110

Query  185  SSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDAI  364
            S+W  VA WM TGERQ A++R+ YL+S+L +D+S FDTEA    +I  I++D I+VQDAI
Sbjct  111  SAWIGVAFWMQTGERQTARLRLKYLQSVLKKDMSFFDTEARDSNIIFHISSDAILVQDAI  170

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
             +K G+ + Y+S+F  GF +GF  +WQ++L+TL++VPLIA+AGG Y    + L  +   +
Sbjct  171  GDKTGHALRYLSQFFVGFAVGFTSVWQLTLLTLAVVPLIAVAGGAYTITMSTLSEKGEAA  230

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y  AG++A+E++  VR V AF
Sbjct  231  YGEAGKVAEEIISQVRAVYAF  251



>ref|XP_002301961.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEE81234.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1219

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    FLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVIL  181
            FLMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+KYSLD VYL + + 
Sbjct  28   FLMFLGLVGSCAHGAVFPLFFVLFGHLIDSLGHVRSDPHQMSSQVSKYSLDLVYLGLGVF  87

Query  182  FSSWTEVACWMHTGERQAAKMRMAYLRSMLNQDISLFDTEASTGEVISAITTDIIVVQDA  361
             + W  VA WM TGERQ A++R+ YL+S+L +D++ FD EA    ++  I++D I+VQDA
Sbjct  88   VAGWIGVASWMQTGERQTARLRLKYLQSVLRKDMNFFDIEARDSNILFHISSDAILVQDA  147

Query  362  ISEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRK  541
            I +K G+ + Y+S+F  GF  GF  +WQ++L+TL++VPL+A+AGG Y  + + L  +   
Sbjct  148  IGDKTGHAVRYLSQFFIGFVFGFKSVWQLTLLTLAVVPLMAVAGGAYTIIMSTLSEKGEA  207

Query  542  SYVRAGEIAQEVVGNVRTVQAF  607
            +Y  AG++A E +  +RTV +F
Sbjct  208  AYAEAGKVADEAISQIRTVYSF  229


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/201 (24%), Positives = 97/201 (48%), Gaps = 16/201 (8%)
 Frame = +2

Query  14   VGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFSSW  193
            +G VGA + G   P+F +    ++     AF  P  +  K   + +  +++   ++    
Sbjct  661  LGSVGAMMAGMEAPLFALGITHML----TAFYSPDNSQMKKEVHLVALIFVGAAVVTVPI  716

Query  194  TEVACWMHT--GERQAAKMRMAYLRSMLNQDISLFD-TEASTGEVISAITTDIIVVQDAI  364
              +  + +T  GER   ++R++   ++L  +I  FD  E STG + S +  D  +V+  +
Sbjct  717  YILQHYFYTLMGERLITRVRLSMFSAILCNEIGWFDLDENSTGSLTSTLAADATLVRSTL  776

Query  365  SEKVGNFMHYISRFIAGFTIGFIRLWQISLVTLSIVPLIALAGGVYAFVATGLIARVRKS  544
            ++++   +  +S  +  F IGF   W++S V ++  PL+         +   +     +S
Sbjct  777  ADRLSTMVQNVSLTVTAFVIGFSLSWRVSAVIIACFPLL---------IGAAITEANYRS  827

Query  545  YVRAGEIAQEVVGNVRTVQAF  607
            Y RA  +A+E + N+RTV +F
Sbjct  828  YTRANAVAREAIANIRTVASF  848



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230