BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS100D03

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                               427   2e-138   Ipomoea nil [qian niu]
emb|CDP11443.1|  unnamed protein product                                384   9e-122   Coffea canephora [robusta coffee]
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   380   1e-120   Nicotiana tomentosiformis
emb|CBI22760.3|  unnamed protein product                                361   3e-119   Vitis vinifera
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   375   1e-118   Nicotiana sylvestris
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   373   5e-118   Nicotiana sylvestris
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        367   8e-116   Solanum lycopersicum
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        366   3e-115   Solanum tuberosum [potatoes]
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        366   3e-115   Solanum tuberosum [potatoes]
ref|XP_007019601.1|  Gigantea protein isoform 1                         366   4e-115   
ref|XP_007019603.1|  Gigantea protein isoform 3                         366   4e-115   
ref|XP_007019604.1|  Gigantea protein isoform 4                         365   4e-115   
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        365   6e-115   
gb|KHG25928.1|  Protein GIGANTEA                                        356   8e-115   Gossypium arboreum [tree cotton]
gb|AJC01622.1|  gigantea                                                365   9e-115   Prunus dulcis [sweet almond]
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        364   1e-114   Nicotiana tomentosiformis
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        364   1e-114   
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                364   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        363   4e-114   Fragaria vesca subsp. vesca
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                362   5e-114   Erythranthe guttata [common monkey flower]
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             361   7e-114   
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         361   2e-113   Jatropha curcas
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        360   2e-113   
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        361   2e-113   Sesamum indicum [beniseed]
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   361   3e-113   Pyrus x bretschneideri [bai li]
gb|KJB28963.1|  hypothetical protein B456_005G077100                    357   3e-113   Gossypium raimondii
gb|KJB59493.1|  hypothetical protein B456_009G258800                    357   4e-113   Gossypium raimondii
gb|KJB28960.1|  hypothetical protein B456_005G077100                    357   4e-113   Gossypium raimondii
gb|KJB59491.1|  hypothetical protein B456_009G258800                    357   5e-113   Gossypium raimondii
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   360   6e-113   Sesamum indicum [beniseed]
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   359   1e-112   
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        359   1e-112   Nicotiana tomentosiformis
gb|KJB59492.1|  hypothetical protein B456_009G258800                    357   2e-112   Gossypium raimondii
gb|KJB28964.1|  hypothetical protein B456_005G077100                    357   2e-112   Gossypium raimondii
gb|KJB28962.1|  hypothetical protein B456_005G077100                    357   6e-112   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                    357   9e-112   Gossypium raimondii
gb|KJB59494.1|  hypothetical protein B456_009G258800                    357   9e-112   Gossypium raimondii
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        355   4e-111   Nicotiana tomentosiformis
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   353   2e-110   Populus euphratica
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   353   2e-110   Pyrus x bretschneideri [bai li]
gb|EPS65289.1|  hypothetical protein M569_09488                         328   1e-109   Genlisea aurea
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             351   1e-109   
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   350   2e-109   
ref|XP_002300901.2|  GIGANTEA family protein                            351   2e-109   
gb|KHN17039.1|  Protein GIGANTEA                                        350   3e-109   Glycine soja [wild soybean]
gb|KHN46389.1|  Protein GIGANTEA                                        349   4e-109   Glycine soja [wild soybean]
dbj|BAN82581.1|  gigantea                                               350   4e-109   Glycine max [soybeans]
ref|NP_001239995.1|  uncharacterized protein LOC100800578               350   4e-109   
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    349   6e-109   Glycine max [soybeans]
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        349   6e-109   Nicotiana tomentosiformis
dbj|BAN82586.1|  gigantea                                               349   6e-109   Glycine max [soybeans]
dbj|BAN82589.1|  gigantea                                               349   6e-109   Glycine max [soybeans]
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        349   7e-109   
gb|ACA24490.1|  gigantea-like protein 2                                 346   7e-109   Glycine max [soybeans]
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   349   7e-109   Populus euphratica
gb|AII99806.1|  gigantea                                                348   9e-109   Dimocarpus longan [longan]
ref|XP_010097648.1|  hypothetical protein L484_023788                   348   1e-108   
gb|AES62297.2|  gigantea protein 1B                                     345   2e-108   Medicago truncatula
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        348   2e-108   Cicer arietinum [garbanzo]
dbj|BAJ22595.1|  GIGANTEA                                               347   2e-108   Glycine max [soybeans]
ref|XP_002307516.1|  GIGANTEA family protein                            347   3e-108   
gb|ABP81863.1|  LATE BLOOMER 1                                          347   4e-108   Pisum sativum [garden pea]
dbj|BAM67030.1|  gigantea-like                                          346   8e-108   Chrysanthemum seticuspe f. boreale
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              346   9e-108   
gb|AGL61504.1|  gigantea-like protein                                   345   9e-108   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACJ65312.1|  GI1 protein                                             346   9e-108   Glycine max [soybeans]
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             346   9e-108   Phaseolus vulgaris [French bean]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   345   1e-107   
gb|AFK65758.1|  GIGANTEA                                                345   2e-107   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003592046.1|  Protein GIGANTEA                                   344   3e-107   
gb|AES62299.2|  gigantea protein 1B                                     344   4e-107   Medicago truncatula
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        344   4e-107   Solanum tuberosum [potatoes]
ref|XP_003592048.1|  Protein GIGANTEA                                   345   4e-107   
gb|KHN41309.1|  Protein GIGANTEA                                        340   8e-106   Glycine soja [wild soybean]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         340   8e-106   
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        340   2e-105   Solanum lycopersicum
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        340   2e-105   Solanum tuberosum [potatoes]
gb|AIR93790.1|  gigantea                                                339   2e-105   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AGW52153.1|  GI                                                      340   4e-105   Populus tomentosa [Chinese white poplar]
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   338   6e-105   Cucumis melo [Oriental melon]
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230          337   1e-104   
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                   334   2e-104   
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1        335   2e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   336   3e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2        335   3e-104   Nelumbo nucifera [Indian lotus]
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             336   4e-104   Arabidopsis lyrata subsp. lyrata
gb|AGU91438.1|  GIGANTEA-like protein                                   332   4e-104   Chrysanthemum boreale
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        335   1e-103   
gb|ABP96481.1|  GIGANTEA                                                335   1e-103   Arabidopsis lyrata subsp. petraea
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   334   2e-103   Citrus sinensis [apfelsine]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg             332   2e-103   
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   334   2e-103   Cucumis sativus [cucumbers]
gb|KFK44368.1|  gigantea                                                334   2e-103   Arabis alpina [alpine rockcress]
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        334   3e-103   Citrus sinensis [apfelsine]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   333   5e-103   
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             332   1e-102   
gb|AAF00023.1|  GIGANTEA                                                332   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      332   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                                332   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                331   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                331   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                                331   3e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                331   3e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                331   3e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96496.1|  GIGANTEA                                                331   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             330   5e-102   Phaseolus vulgaris [French bean]
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             329   6e-102   
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        330   8e-102   Nicotiana tomentosiformis
gb|ABP96488.1|  GIGANTEA                                                330   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                329   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   329   1e-101   Elaeis guineensis
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     329   2e-101   Eucalyptus grandis [rose gum]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             329   2e-101   Eucalyptus grandis [rose gum]
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana       327   3e-101
gb|ACY30446.1|  gigantea-like protein                                   328   6e-101   Liriodendron tulipifera
gb|ABP96482.1|  GIGANTEA                                                327   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   326   2e-100   Phoenix dactylifera
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             326   2e-100   Capsella rubella
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3        324   4e-100   Nelumbo nucifera [Indian lotus]
gb|ACJ65314.1|  GI3 protein                                             325   5e-100   Glycine max [soybeans]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   325   5e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        325   7e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        324   9e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        324   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        324   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   324   1e-99    Elaeis guineensis
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        323   2e-99    Brassica rapa
emb|CDY21388.1|  BnaA09g30390D                                          323   3e-99    Brassica napus [oilseed rape]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        322   8e-99    Tarenaya hassleriana [spider flower]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        321   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        321   2e-98    Camelina sativa [gold-of-pleasure]
emb|CDY04787.1|  BnaC05g18020D                                          321   2e-98    
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2        320   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        320   3e-98    Cucumis melo [Oriental melon]
ref|NP_001288824.1|  protein GIGANTEA                                   319   8e-98    Brassica rapa
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        319   1e-97    
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    317   3e-97    Zea mays [maize]
emb|CAA72908.1|  hypothetical protein                                   316   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               315   1e-96    
gb|ABR18021.1|  unknown                                                 315   2e-96    Picea sitchensis
gb|AFW80279.1|  gigantea1A isoform 1                                    312   3e-96    
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        314   5e-96    
gb|ADP92454.1|  GIGANTEA 1                                              314   6e-96    x Doritaenopsis hybrid cultivar
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        313   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW80281.1|  gigantea1A                                              312   9e-96    
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        313   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW80282.1|  gigantea1A                                              312   1e-95    
ref|NP_001288586.1|  gigantea like1a                                    312   2e-95    Zea mays [maize]
gb|ABZ81992.1|  gigantea                                                312   2e-95    Zea mays [maize]
ref|NP_001042220.1|  Os01g0182600                                       311   3e-95    
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   311   4e-95    Setaria italica
gb|AGH20049.1|  GI                                                      311   4e-95    Picea abies
gb|EEE54000.1|  hypothetical protein OsJ_00641                          311   5e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70061.1|  hypothetical protein OsI_00663                          311   5e-95    Oryza sativa Indica Group [Indian rice]
dbj|BAD97864.1|  GI homologue 1                                         310   8e-95    Lemna aequinoctialis
gb|ACT22764.1|  GIGANTEA                                                310   1e-94    Allium cepa
gb|ACT22765.1|  GIGANTEA                                                310   1e-94    Allium cepa
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        306   2e-93    Oryza brachyantha
gb|AGM20686.1|  GI1-2                                                   302   9e-92    Populus tomentosa [Chinese white poplar]
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        301   1e-91    
gb|AAW66945.1|  gigantea-like protein                                   300   8e-91    Hordeum vulgare [barley]
emb|CDM81775.1|  unnamed protein product                                298   2e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAT79486.1|  gigantea 2                                              297   5e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAT79487.1|  gigantea 3                                              297   6e-90    Triticum aestivum [Canadian hard winter wheat]
dbj|BAD97869.1|  GI homologue                                           296   6e-90    Lemna gibba
gb|AIC83986.1|  gigantea-like protein                                   295   2e-89    Festuca pratensis [meadow ryegrass]
emb|CAY26028.1|  GIGANTEA                                               295   4e-89    Lolium perenne [perennial ryegrass]
gb|AEK05801.1|  gigantea 2                                              290   2e-87    Populus balsamifera [balsam poplar]
gb|AEK05803.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                              289   3e-87    Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                              289   4e-87    Populus balsamifera [balsam poplar]
gb|ADR51711.1|  GI                                                      287   2e-86    Secale cereale
gb|AAQ11738.1|  gigantea                                                285   9e-86    Triticum aestivum [Canadian hard winter wheat]
emb|CAN81809.1|  hypothetical protein VITISV_032939                     275   4e-84    Vitis vinifera
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066             277   6e-83    
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553             276   8e-83    
dbj|BAO74110.1|  GIGANTEA                                               275   2e-82    Lotus japonicus
dbj|BAO74118.1|  GIGANTEA                                               274   4e-82    Lotus japonicus
dbj|BAP76055.1|  putative GI                                            272   4e-81    Cryptomeria japonica
dbj|BAO66507.1|  GIGANTEA                                               261   5e-77    Marchantia polymorpha
gb|EMT06342.1|  hypothetical protein F775_28583                         226   1e-64    
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                       226   2e-64    Triticum urartu
gb|KJB59490.1|  hypothetical protein B456_009G258800                    219   2e-62    Gossypium raimondii
gb|ACJ09481.1|  putative gigantea                                       184   3e-54    Oryza sativa Indica Group [Indian rice]
gb|ACJ09482.1|  putative gigantea                                       184   3e-54    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09478.1|  putative gigantea                                       184   3e-54    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09480.1|  putative gigantea                                       183   4e-54    Oryza sativa Indica Group [Indian rice]
gb|ACJ09479.1|  putative gigantea                                       183   4e-54    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09488.1|  putative gigantea                                       182   1e-53    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09483.1|  putative gigantea                                       180   6e-53    Oryza sativa Japonica Group [Japonica rice]
dbj|BAI40156.1|  gigantea-like protein                                  173   1e-51    Diospyros kaki [Japanese persimmon]
gb|AEK05888.1|  gigantea-5                                              169   2e-49    Populus balsamifera [balsam poplar]
gb|AEK05878.1|  gigantea-5                                              168   3e-49    Populus balsamifera [balsam poplar]
gb|AEK05858.1|  gigantea-5                                              167   1e-48    Populus balsamifera [balsam poplar]
gb|AEK26574.1|  gigantea 5                                              165   5e-48    Populus tremula [European aspen]
emb|CAB56058.1|  gigantea homologue                                     175   1e-46    Oryza sativa [red rice]
gb|AEK05813.1|  gigantea-5                                              159   1e-45    Populus balsamifera [balsam poplar]
gb|AEK05848.1|  gigantea-5                                              159   1e-45    Populus balsamifera [balsam poplar]
gb|KGN44454.1|  LATE BLOOMER 1                                          137   2e-37    Cucumis sativus [cucumbers]
gb|KGN44455.1|  hypothetical protein Csa_7G293730                       133   4e-34    Cucumis sativus [cucumbers]
ref|XP_004163795.1|  PREDICTED: protein GIGANTEA-like                   131   3e-31    
ref|XP_010062090.1|  PREDICTED: protein GIGANTEA isoform X2             126   2e-29    Eucalyptus grandis [rose gum]
ref|XP_008461913.1|  PREDICTED: protein GIGANTEA-like isoform X2      97.8    3e-27    
ref|XP_009631436.1|  PREDICTED: protein GIGANTEA-like isoform X7        118   8e-27    Nicotiana tomentosiformis
dbj|BAD68053.1|  putative gigantea                                      112   2e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631435.1|  PREDICTED: protein GIGANTEA-like isoform X6        112   8e-25    Nicotiana tomentosiformis
ref|XP_008461914.1|  PREDICTED: protein GIGANTEA-like isoform X3      97.8    1e-19    
gb|ABV55998.1|  gigantea1A                                            93.2    4e-19    Zea mays [maize]
gb|ADX35837.1|  gigantea                                              85.1    2e-17    Brachypodium rupestre
gb|ADX35845.1|  gigantea                                              84.7    3e-17    Brachypodium mexicanum
ref|XP_004173872.1|  PREDICTED: protein GIGANTEA-like                 84.0    3e-17    
gb|ADX35848.1|  gigantea                                              84.3    3e-17    Brachypodium distachyon [annual false brome]
gb|ADX35839.1|  gigantea                                              84.0    4e-17    Brachypodium retusum
gb|ADX35844.1|  gigantea                                              83.2    9e-17    Brachypodium mexicanum
gb|ADX35846.1|  gigantea                                              82.8    1e-16    Brachypodium distachyon [annual false brome]
gb|AFB78142.1|  gigantea                                              81.6    3e-16    Brachypodium boissieri
gb|AEK26575.1|  gigantea 5                                            75.5    5e-14    Populus tremula [European aspen]
gb|AEK05815.1|  gigantea-5                                            61.6    3e-09    Populus balsamifera [balsam poplar]
gb|AEK05860.1|  gigantea-5                                            56.2    2e-07    Populus balsamifera [balsam poplar]



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   427 bits (1099),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA
Sbjct  70   VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS
Sbjct  130  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   384 bits (985),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDG LEYDKN PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGLLEYDKNCPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRPVYKVE  DS+ADR+NSG H STSK ADG PSL S QH+RKPLR LS
Sbjct  130  CGEILRILTHYNRPVYKVENNDSDADRNNSGKHVSTSKYADGEPSLSSSQHDRKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPST SSRGSGKHPQL+PSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTVSSRGSGKHPQLMPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   380 bits (976),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  SEQWALA
Sbjct  73   VLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGYSEQWALA  132

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++Q++ ADRS SGSHASTSKSAD  P + S QHERKPLR LS
Sbjct  133  CGEILRILTHYNRPIFKVDRQENRADRSTSGSHASTSKSADSEPGVPSIQHERKPLRPLS  192

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS+A+SRGSGKHPQL+PSTPRWAV
Sbjct  193  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSSAASRGSGKHPQLLPSTPRWAV  252

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  253  ANGAGVILSVCDEEVARYETATLTA  277



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 189/209 (90%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG----GPSLLSPQHERKPL  349
            CGEILRILTHYNRP+YKVE Q SEADRS+SG HA+TS S DG    GP L   Q+ERKP 
Sbjct  130  CGEILRILTHYNRPIYKVEHQSSEADRSSSGRHATTSDSVDGKSSQGPLL---QNERKPS  186

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTP  529
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTAS+RGSGKHPQLIPSTP
Sbjct  187  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASTRGSGKHPQLIPSTP  246

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  247  RWAVANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   375 bits (963),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  SEQWALA
Sbjct  73   VLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGYSEQWALA  132

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++ ++ ADRS SGSHASTSKSAD  P + S QHERK LR LS
Sbjct  133  CGEILRILTHYNRPIFKVDRHENRADRSTSGSHASTSKSADSEPGVPSIQHERKTLRPLS  192

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS+A+SRGSGKHPQL+PSTPRWAV
Sbjct  193  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSSAASRGSGKHPQLLPSTPRWAV  252

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  253  ANGAGVILSVCDEEVARYETATLTA  277



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   373 bits (958),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHP+HGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCPNS+ E SEQWALA
Sbjct  70   VLATFVLHHPDHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPNSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q+  ADRS+ G+HASTSKSAD  PSL S  HERKPLR LS
Sbjct  130  CGEILRILTHYNRPIYKVVQQEGGADRSSGGNHASTSKSADSEPSLPSMHHERKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDIL+AAPLGIRSDYFRWC GVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILVAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   367 bits (943),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q  EADRS+ G  ASTSKSAD GPS+ S  HERK LR LS
Sbjct  130  CGEILRILTHYNRPIYKVVQQGGEADRSSQGIDASTSKSADSGPSMPSVHHERKTLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILL APLGIRSDYFRWC GVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILLTAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   366 bits (940),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF SFISLVCP+S+ E SEQWALA
Sbjct  93   VLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPFTSFISLVCPSSEKEYSEQWALA  152

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q  EADRS+ G HASTSKSAD  PS+ S  HERK LR LS
Sbjct  153  CGEILRILTHYNRPIYKVVQQGGEADRSSRGIHASTSKSADSEPSMPSVHHERKTLRPLS  212

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYA+GELKPPSTASSRGSGKHPQLIPSTPRWAV
Sbjct  213  PWITDILLAAPLGIRSDYFRWCGGVMGKYASGELKPPSTASSRGSGKHPQLIPSTPRWAV  272

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  273  ANGAGVILSVCDEEVARYETATLTA  297



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   366 bits (939),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF SFISLVCP+S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPFTSFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q  EADRS+ G HASTSKSAD  PS+ S  HERK LR LS
Sbjct  130  CGEILRILTHYNRPIYKVVQQGGEADRSSRGIHASTSKSADSEPSMPSVHHERKTLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYA+GELKPPSTASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYASGELKPPSTASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   366 bits (939),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+  DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSEPVDGEPSFHIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPPSTASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPSTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   366 bits (939),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+  DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSEPVDGEPSFHIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPPSTASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPSTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   365 bits (937),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E+Q+SE DRSNS   A+TS+  DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEQQNSETDRSNSSGQATTSEPVDGEPSFHIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPPSTASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPSTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   365 bits (937),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLAYERISPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG  S +   Q ERKP+R L
Sbjct  130  CGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESSHIPLVQQERKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score =   356 bits (913),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHIPSVRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   365 bits (936),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG    +   Q ERKP+R L
Sbjct  130  CGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESRHIPLVQQERKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK AD  P L S  HERKPLR LS
Sbjct  130  CGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSKFADSEPRLPSMHHERKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTASS GSGKH QLIPSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASSHGSGKHHQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 189/209 (90%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG----GPSLLSPQHERKPL  349
            CGEILRILTHYNRP+YKVE Q SEADRS+SG HA+TS S DG    GP L   Q+ERKP 
Sbjct  130  CGEILRILTHYNRPIYKVEHQSSEADRSSSGRHATTSDSVDGKSSQGPLL---QNERKPS  186

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTP  529
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTAS+RGSGKHPQLIPSTP
Sbjct  187  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASTRGSGKHPQLIPSTP  246

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  247  RWAVANGAGVILSVCDEEVARYETATLTA  275



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   364 bits (934),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDG +EY ++ PPFASFISLVCPNS+NE SEQWALA
Sbjct  70   VLAKFVLHHPEHGHAVILPIISCIIDGLVEYKRSGPPFASFISLVCPNSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q++E DRS+SG+ ASTSKS DG PSL S Q ERK LR LS
Sbjct  130  CGEILRILTHYNRPIYKRERQENETDRSSSGTLASTSKSTDGEPSLPSTQLERKMLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTA SRGSGKHPQL+PSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTAFSRGSGKHPQLVPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVARYETATLTA
Sbjct  250  ANGAGVILSVCDDEVARYETATLTA  274



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   363 bits (932),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 190/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL Y++ SPPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVVLPIISCIIDGTLPYERTSPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLL-SPQHERKPLRLL  358
            CGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG  S + S Q ERKP+R L
Sbjct  130  CGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESSHVPSVQQERKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEV+RYETATLTA
Sbjct  250  VANGAGVILSVCDEEVSRYETATLTA  275



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   362 bits (930),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH+VIHPIISCIID TLEYDK+ PPFASFISLV P S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHSVIHPIISCIIDSTLEYDKSGPPFASFISLVSPKSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+E+Q++E DRS+SG+HASTS S DG PSL S Q ERK  R LS
Sbjct  130  CGEILRILTHYNRPIYKLERQENEGDRSSSGNHASTSMSTDGEPSLPSTQSERKTTRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST-ASSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLG+RSDYFRWC GVMGKYAAGELKPP T +SSRGSGKHPQL+PSTPRWA
Sbjct  190  PWITDILLAAPLGVRSDYFRWCGGVMGKYAAGELKPPLTVSSSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   361 bits (927),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 187/202 (93%), Gaps = 1/202 (0%)
 Frame = +2

Query  14   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  193
            F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALACGEI
Sbjct  2    FVLHHPEHGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSEQWALACGEI  61

Query  194  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLLSPWI  370
            LRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG  S +   Q ERKP+R LSPWI
Sbjct  62   LRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESSHIPLVQQERKPIRPLSPWI  121

Query  371  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANG  550
            TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAVANG
Sbjct  122  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWAVANG  181

Query  551  AGVILSVCDEEVARYETATLTA  616
            AGVILSVCDEEVARYETATLTA
Sbjct  182  AGVILSVCDEEVARYETATLTA  203



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   361 bits (927),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 191/209 (91%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISC+IDGTL YD++SPPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSSPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG----GPSLLSPQHERKPL  349
            CGEILRILTHYNRPVYKVE+Q+SE +R N G++A++S S DG     PS+   Q ERKPL
Sbjct  130  CGEILRILTHYNRPVYKVEQQNSEMERKNDGNYATSSGSVDGEACHAPSV---QQERKPL  186

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTP  529
            R LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+TASSRGSGKHPQL+PSTP
Sbjct  187  RPLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTASSRGSGKHPQLMPSTP  246

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCD+EVARYETATLTA
Sbjct  247  RWAVANGAGVILSVCDDEVARYETATLTA  275



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ E +EQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEMEYTEQWALA  129

Query  182  CGEILRILTHYNRPVYK---VEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLR  352
            CGEILRILTHYNRP+Y+   +E  + EADRS+SG+HASTS+S DG PSL   Q ERKPLR
Sbjct  130  CGEILRILTHYNRPIYRRELLEPSEKEADRSSSGTHASTSRSKDGEPSLPPTQLERKPLR  189

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPR  532
             LSPWITDILLAAPL IRSDYFRWC GVMGKYAAG+LKPPSTA+SRGSGKHPQL+PSTPR
Sbjct  190  PLSPWITDILLAAPLAIRSDYFRWCGGVMGKYAAGQLKPPSTATSRGSGKHPQLMPSTPR  249

Query  533  WAVANGAGVILSVCDEEVARYETATLTA  616
            WAVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  WAVANGAGVILSVCDEEVARYETATLTA  277



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   361 bits (926),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ E +EQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEMEYTEQWALA  129

Query  182  CGEILRILTHYNRPVYK---VEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLR  352
            CGEILRILTHYNRP+Y+   +E  + EADRS+SG+HASTS+S DG PSL   Q ERKPLR
Sbjct  130  CGEILRILTHYNRPIYRRELLEPSEKEADRSSSGTHASTSRSKDGEPSLPPTQLERKPLR  189

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPR  532
             LSPWITDILLAAPL IRSDYFRWC GVMGKYAAG+LKPPSTA+SRGSGKHPQL+PSTPR
Sbjct  190  PLSPWITDILLAAPLAIRSDYFRWCGGVMGKYAAGQLKPPSTATSRGSGKHPQLMPSTPR  249

Query  533  WAVANGAGVILSVCDEEVARYETATLTA  616
            WAVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  WAVANGAGVILSVCDEEVARYETATLTA  277



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   361 bits (926),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YKVE+Q+SE +RS+SGSHA+TS S DG  S +   Q E+KP+R L
Sbjct  130  CGEILRILTHYNRPIYKVEQQNSETERSSSGSHATTSDSVDGESSRIPLVQQEKKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score =   357 bits (916),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHMPSMRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA+LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETASLTA  276



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score =   357 bits (917),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHMPSMRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score =   357 bits (915),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA+LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETASLTA  276



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   360 bits (924),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIID +LEYD++SPPFASFISLV PNS+NE  EQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDCSLEYDRSSPPFASFISLVYPNSENEYLEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+E+QDS+ D+ +SG HASTS S DG       Q ERKPLR LS
Sbjct  130  CGEILRILTHYNRPIYKLEQQDSDTDKRSSGDHASTSNSTDGEADFPPTQPERKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP+TASSRGSGKHPQL+PSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPTTASSRGSGKHPQLMPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   359 bits (922),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLXYKSSSPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YKVE+Q+ E +RS+SGSHA+TS S DG  S +   Q E+KP+R L
Sbjct  130  CGEILRILTHYNRPIYKVEQQNCETERSSSGSHATTSDSVDGESSRIPLVQQEKKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   359 bits (921),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 186/209 (89%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK AD  P L S  HERKPLR LS
Sbjct  130  CGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSKFADSEPRLPSMHHERKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST----ASSRGSGKHPQLIPSTP  529
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPST    ASS GSGKH QLIPSTP
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTDFIVASSHGSGKHHQLIPSTP  249

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  RWAVANGAGVILSVCDEEVARYETATLTA  278



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA+LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETASLTA  276



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHMPSMRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   357 bits (915),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHMPSMRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   357 bits (915),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+ K E  +SEADRSNS S A+TS+SADG  S   P  + ERKPLR 
Sbjct  130  CGEILRILTHYNRPICKTELPNSEADRSNSSSQATTSESADGESSFHMPSMRQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+L+PP TAS RGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLRPPMTASIRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVARYETATLTA  276



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   357 bits (915),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 189/207 (91%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRP  189

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRW
Sbjct  190  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA+LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETASLTA  276



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   355 bits (911),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 186/219 (85%), Gaps = 14/219 (6%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ----------  151
            VLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+          
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRILNYQFE  129

Query  152  ----NELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL  319
                 E SEQWALACGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK AD  P L
Sbjct  130  GLSHKEYSEQWALACGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSKFADSEPRL  189

Query  320  LSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSG  499
             S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTASS GSG
Sbjct  190  PSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASSHGSG  249

Query  500  KHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            KH QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  KHHQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  288



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   353 bits (906),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  H+++ +S     ++   QHERKP R LS
Sbjct  131  CGEILRILTHYNRPIYKLEKQNSETDRSSSDGHSTSIESEGKSSTIPLVQHERKPFRPLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+T SSRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTTSSRGSGKHPQLMPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEV RYETA LTA
Sbjct  251  ANGAGVILSVCDEEVTRYETAALTA  275



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   353 bits (906),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 187/206 (91%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSE-EYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q++E +RS+SGSHA+TS S DG  S L   Q E+KP+R L
Sbjct  129  CGEILRILTHYNRPIYKAEQQNNETERSSSGSHATTSDSGDGESSHLPLVQQEKKPIRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  189  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  249  VANGAGVILSVCDEEVARYETATLTA  274



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score =   328 bits (841),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 181/206 (88%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH VI PIISC+ID ++EYDK+  PF+SFISL   N++N+ SEQWALA
Sbjct  70   VLATFVLHHPEHGHDVILPIISCVIDSSVEYDKDGAPFSSFISLFSLNTENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQ-HERKPLRLL  358
            CGEILRILTHYNRP+YK E  D+EADRS SG+HAS+SKSA G P  L+P   ERKP+R L
Sbjct  130  CGEILRILTHYNRPIYKTESLDNEADRSGSGNHASSSKSASGRP--LAPTLTERKPMRPL  187

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILL+APLGIRSDYFRWC GVMGKYAAGELKPPSTAS   +GKHPQL+P+TPRWA
Sbjct  188  SPWITDILLSAPLGIRSDYFRWCGGVMGKYAAGELKPPSTAS---AGKHPQLMPATPRWA  244

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLT+
Sbjct  245  VANGAGVILSVCDEEVARYETATLTS  270



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   351 bits (900),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  71   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  131  CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+T SSRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTTSSRGSGKHPQLVPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  251  ANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 186/206 (90%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISCIIDGTL Y  + PPFASFISLVCP+S+ E SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSGPPFASFISLVCPSSE-EYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q++E +RS+SGSHA+TS + DG  S L   Q E+KP+R L
Sbjct  129  CGEILRILTHYNRPIYKAEQQNNETERSSSGSHATTSDNVDGESSHLPLVQQEKKPIRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  189  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLMPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  249  VANGAGVILSVCDEEVARYETATLTA  274



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  71   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  131  CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+T SSRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTTSSRGSGKHPQLVPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  251  ANGAGVILSVCDEEVARYETATLTA  275



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   350 bits (897),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  137  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  195

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  196  PWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  255

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  256  ANGAGVILSVCDDEVARNETATLTA  280



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   349 bits (896),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  41   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALA  100

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ Q E+KP+R LS
Sbjct  101  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QQEKKPIRPLS  159

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  160  PWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  219

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  220  ANGAGVILSVCDDEVARNETATLTA  244



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  130  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  189  PWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  249  ANGAGVILSVCDDEVARNETATLTA  273



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  130  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  189  PWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  249  ANGAGVILSVCDDEVARNETATLTA  273



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  137  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  195

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  196  PWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  255

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  256  ANGAGVILSVCDDEVARNETATLTA  280



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 186/223 (83%), Gaps = 18/223 (8%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ----------  151
            VLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+          
Sbjct  70   VLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRILNYQFE  129

Query  152  ----NELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL  319
                 E SEQWALACGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK AD  P L
Sbjct  130  GLSHKEYSEQWALACGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSKFADSEPRL  189

Query  320  LSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST----ASS  487
             S  HERKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPST    ASS
Sbjct  190  PSMHHERKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTDFIVASS  249

Query  488  RGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
             GSGKH QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  250  HGSGKHHQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  292



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   349 bits (896),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  130  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  189  PWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  249  ANGAGVILSVCDDEVARNETATLTA  273



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   349 bits (895),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+WALA
Sbjct  71   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEEWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ QHE+KP+R LS
Sbjct  131  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QHEKKPIRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSG+MGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  190  PWITDILLASPVGIRSDYFRWCSGIMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETATLTA
Sbjct  250  ANGAGVILSVCDDEVARNETATLTA  274



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SEQWALA
Sbjct  47   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSEQWALA  106

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK+E+Q SE +RS+SGSHA+TS+  DG   +    Q E+KP+R L
Sbjct  107  CGEILRILTHYNRPIYKMERQSSETERSSSGSHATTSEPLDGKAVNNALAQQEKKPIRPL  166

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQ +PSTPRWA
Sbjct  167  SPWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQHVPSTPRWA  226

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  227  VANGAGVILSVCDDEVARNETAILTA  252



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score =   346 bits (887),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ Q E+KP+R LS
Sbjct  137  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QQEKKPIRPLS  195

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  196  PWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  255

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ET TLTA
Sbjct  256  ANGAGVILSVCDDEVARNETTTLTA  280



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+QD+E DRS+S SHA++S+SA+G  S +   Q ERKP R L
Sbjct  131  CGEILRILTHYNRPIYKREQQDNETDRSSSDSHATSSESAEGKSSSMPLVQQERKPFRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+T SSRGSGKHPQLIPSTPRWA
Sbjct  191  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTTSSRGSGKHPQLIPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  251  VANGAGVILSVCDEEVARYETATLTA  276



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   348 bits (894),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 186/207 (90%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIIS II+GTL YDK+SPPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVVLPIISSIIEGTLVYDKSSPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRL  355
            CGEILRILTHYNRP+YK+E+ +SE +RS+SG HA+TS S  GG +   P  Q ERKPLR 
Sbjct  130  CGEILRILTHYNRPIYKMEQHNSETERSSSGRHATTSNSG-GGETCHVPLVQQERKPLRP  188

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWITDILLAAPL IRSDYFRWCSGVMGKYAAGELKPP TASSRGSGKHPQL+PSTPRW
Sbjct  189  LSPWITDILLAAPLAIRSDYFRWCSGVMGKYAAGELKPPPTASSRGSGKHPQLMPSTPRW  248

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCD+EVARYETATLTA
Sbjct  249  AVANGAGVILSVCDDEVARYETATLTA  275



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   348 bits (894),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDGTL YD+ +PPFASFISLVCP+S+NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISGIIDGTLVYDRTTPPFASFISLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YKVE+  SE +RS+SGS A+TS   +     L  Q ERKP+R LS
Sbjct  130  CGEILRILTHYNRPIYKVEQHCSETERSSSGSQATTSDGGESSSRTLPVQQERKPIRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+TA SRGSGKHPQL+PSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTA-SRGSGKHPQLMPSTPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  249  ANGAGVILSVCDEEVARYETATLTA  273



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SEQWALA
Sbjct  75   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSEQWALA  134

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+  +G   +    Q E+KP+R L
Sbjct  135  CGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEPLNGKAVNNALAQQEKKPIRPL  194

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS A+SRGSGKHPQL+PSTPRWA
Sbjct  195  SPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPSIATSRGSGKHPQLVPSTPRWA  254

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  255  VANGAGVILSVCDDEVARNETAILTA  280



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SEQWALA
Sbjct  75   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSEQWALA  134

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK+E+Q SE +RS+SGSHA+TS+  DG   +    Q E+KP+R L
Sbjct  135  CGEILRILTHYNRPIYKMERQSSETERSSSGSHATTSEPLDGKAVNNALAQQEKKPIRPL  194

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQ +PSTPRWA
Sbjct  195  SPWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQHVPSTPRWA  254

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  255  VANGAGVILSVCDDEVARNETAILTA  280



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   347 bits (891),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ Q E+KP+R LS
Sbjct  130  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QQEKKPIRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  189  PWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ET TLTA
Sbjct  249  ANGAGVILSVCDDEVARNETTTLTA  273



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   347 bits (890),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+SA+G   S+   Q ERKP R L
Sbjct  131  CGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSESAEGKSTSMPLVQQERKPFRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+T SSRGSGKHPQLIPSTPRWA
Sbjct  191  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTTTSSRGSGKHPQLIPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  251  VANGAGVILSVCDEEVARYETATLTA  276



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   347 bits (890),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SEQWALA
Sbjct  74   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSEQWALA  133

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+E+Q SE +RS+SGS A+TS+  +G     +   E+KP+R LS
Sbjct  134  CGEILRILTHYNRPIYKMERQSSETERSSSGSLATTSEPLNGKAVNSALAQEKKPIRPLS  193

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAP+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  194  PWITDILLAAPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  253

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ETA LTA
Sbjct  254  ANGAGVILSVCDDEVARNETAILTA  278



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   346 bits (887),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SEQWALA
Sbjct  70   VLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+ K + Q    DRS SGS ASTS S D   S  S Q+E KPLRLLS
Sbjct  130  CGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSNSPDSETSSPSAQNENKPLRLLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTA-SSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS   +SRGSGKHPQL+PSTPRWA
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSVVMASRGSGKHPQLVPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   346 bits (888),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ Q E+KP+R LS
Sbjct  137  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QQEKKPIRPLS  195

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  196  PWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  255

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ET TLTA
Sbjct  256  ANGAGVILSVCDDEVARNETTTLTA  280



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   345 bits (886),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SEQWALA
Sbjct  70   VLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+ K + Q    DRS SGS ASTS S D   S  S Q+E KPLRLLS
Sbjct  130  CGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSNSPDSETSSPSAQNENKPLRLLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTA-SSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS   +SRGSGKHPQL+PSTPRWA
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSVVMASRGSGKHPQLVPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETATLTA
Sbjct  250  VANGAGVILSVCDEEVARYETATLTA  275



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   346 bits (888),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS SGSHA+TS+    G + L+ Q E+KP+R LS
Sbjct  137  CGEILRILTHYNRPIYKTERQSGETERSTSGSHATTSEPGKSGHNSLT-QQEKKPIRPLS  195

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILL++P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWAV
Sbjct  196  PWITDILLSSPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWAV  255

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVAR ET TLTA
Sbjct  256  ANGAGVILSVCDDEVARNETTTLTA  280



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   346 bits (888),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALA
Sbjct  77   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKVENEYSEQWALA  136

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+YK+E+Q  E +RS+SGSHA+TS+  DG     S    E+KP+R L
Sbjct  137  CGEILRILTHYNRPIYKIERQYGETERSSSGSHATTSEPIDGKSVHNSLTNQEKKPIRPL  196

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLA+P+GIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQL+PSTPRWA
Sbjct  197  SPWITDILLASPVGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLVPSTPRWA  256

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETATLTA
Sbjct  257  VANGAGVILSVCDDEVARNETATLTA  282



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   345 bits (886),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPE+GHA+I PIISCI DG LEY++N PPFASFISL CP  +N+ SEQWALA
Sbjct  70   VLALFVLHHPENGHAIILPIISCIFDGALEYNRNDPPFASFISLFCPGIENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+E+++ E +RS+SGS A+TS + D     +  Q ERKP+R LS
Sbjct  130  CGEILRILTHYNRPIYKMERKNGETERSSSGSRATTSDTDDRELVGVPQQQERKPVRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL+PP++ASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELRPPTSASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   345 bits (885),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  E SEQWALA
Sbjct  71   VLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDKEYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+ K + Q    DRS SGS ASTS S D   S  S Q+E KPLRLLS
Sbjct  131  CGEILRVLTHYNRPILKADHQHKVTDRSVSGSQASTSNSPDSETSSPSAQNENKPLRLLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST--ASSRGSGKHPQLIPSTPRW  535
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS   ASSRGSGKHPQL+P+TPRW
Sbjct  191  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSVVMASSRGSGKHPQLMPATPRW  250

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEV RYETATLTA
Sbjct  251  AVANGAGVILSVCDEEVTRYETATLTA  277



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   344 bits (883),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+  +G   +    Q E+KP+R L
Sbjct  130  CGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEPLNGKAVNNALAQQEKKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS A+SRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPSIATSRGSGKHPQLVPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  250  VANGAGVILSVCDDEVARNETAILTA  275



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   344 bits (883),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SEQWALA
Sbjct  75   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSEQWALA  134

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+  +G   +    Q E+KP+R L
Sbjct  135  CGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEPLNGKAVNNALAQQEKKPIRPL  194

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS A+SRGSGKHPQL+PSTPRWA
Sbjct  195  SPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPSIATSRGSGKHPQLVPSTPRWA  254

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  255  VANGAGVILSVCDDEVARNETAILTA  280



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   344 bits (883),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++QD+  DRS SGSH STSKS+   P + S QHERKP+R LS
Sbjct  130  CGEILRILTHYNRPIFKVDRQDNGTDRSTSGSHTSTSKSSCSEPGVPSIQHERKPIRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS+A+SRGSGKHPQL+P+TPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPSSAASRGSGKHPQLLPATPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEV+RYETATLTA
Sbjct  250  ANGAGVILSVCDEEVSRYETATLTA  274



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   345 bits (884),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q SE +RS+SGSHA+TS+  +G   +    Q E+KP+R L
Sbjct  130  CGEILRILTHYNRPIYKTERQSSETERSSSGSHATTSEPLNGKAVNNALAQQEKKPIRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILL AP+GIRSDYFRWCSGVMGKYAAGELKPPS A+SRGSGKHPQL+PSTPRWA
Sbjct  190  SPWITDILLVAPVGIRSDYFRWCSGVMGKYAAGELKPPSIATSRGSGKHPQLVPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVAR ETA LTA
Sbjct  250  VANGAGVILSVCDDEVARNETAILTA  275



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   340 bits (873),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 182/208 (88%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA  +LHHPEHGHAV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE SEQWA+A
Sbjct  71   VLAVLVLHHPEHGHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENEYSEQWAMA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGP---SLLSPQHERKPLR  352
            CGEILRILTHYNRP+YK+E+Q  E + S+  SHA+T+ S DG     SL+  Q E+KP+R
Sbjct  131  CGEILRILTHYNRPIYKMERQYCEPEVSSGKSHATTNDSVDGESGHNSLM--QQEKKPIR  188

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPR  532
             LSPWITDIL AAPLGIRSDYFRWCSGVMGKYAAGELKPP+  S+RGSGKHPQL+PSTPR
Sbjct  189  PLSPWITDILRAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIVSARGSGKHPQLVPSTPR  248

Query  533  WAVANGAGVILSVCDEEVARYETATLTA  616
            WAVANGAGVILSVCD+EVARYETATLTA
Sbjct  249  WAVANGAGVILSVCDDEVARYETATLTA  276



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   340 bits (873),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +2

Query  8    ATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACG  187
            ATF+LHHPEHGHAV+ PIISC+IDGTL YD+++PPFASFISLVCP+S+NE SEQWALACG
Sbjct  64   ATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSTPPFASFISLVCPSSENEYSEQWALACG  123

Query  188  EILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLLSP  364
            EILR+LTHYNRP+YK E+Q SE ++S  G  A     ADG  S   P Q ERKPLR LSP
Sbjct  124  EILRVLTHYNRPIYKKEQQKSETEKSGGGEDAVNGGLADGESSHTPPAQQERKPLRPLSP  183

Query  365  WITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVA  544
            WITDILL APLGIRSDYFRWCSGVMGKYA GELKPP+TASS GSGKHPQL+PSTPRWAVA
Sbjct  184  WITDILLTAPLGIRSDYFRWCSGVMGKYAGGELKPPTTASSHGSGKHPQLMPSTPRWAVA  243

Query  545  NGAGVILSVCDEEVARYETATLTA  616
            NGAGVILSVCD+EVARYETATLTA
Sbjct  244  NGAGVILSVCDDEVARYETATLTA  267



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   340 bits (871),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++QD   DRS SGSH STS+S+   P + S QHERK LR LS
Sbjct  130  CGEILRILTHYNRPIFKVDRQDKGTDRSTSGSHTSTSESSSSEPGVPSIQHERKLLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS+A+S GSGKHPQL+P+TPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPSSAASHGSGKHPQLLPATPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEV+RYETATLTA
Sbjct  250  ANGAGVILSVCDEEVSRYETATLTA  274



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   340 bits (871),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 189/205 (92%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSE-EYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++QD+  DRS SGSH STSKS+   P + S QHERKP+R LS
Sbjct  129  CGEILRILTHYNRPIFKVDRQDNGTDRSTSGSHTSTSKSSCSEPGVPSIQHERKPIRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS+A+SRGSGKHPQL+P+TPRWAV
Sbjct  189  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPSSAASRGSGKHPQLLPATPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEV+RYETATLTA
Sbjct  249  ANGAGVILSVCDEEVSRYETATLTA  273



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIIS +IDGTL YD+  PPFASFISLVCP+S+N  SEQWALA
Sbjct  58   VLAMFVLHHPEHGHAVMLPIISLVIDGTLFYDRCCPPFASFISLVCPSSENYYSEQWALA  117

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP++KVE + SEADRS SG HA+TS S D      +P Q ERKP+R L
Sbjct  118  CGEILRILTHYNRPIFKVEHR-SEADRSTSGKHATTSDSNDKECGAAAPGQQERKPIRPL  176

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLG+RSDYFRWC GVMGKYAAGELKPP TASS+GSGKHPQLIPSTPRWA
Sbjct  177  SPWITDILLAAPLGVRSDYFRWCGGVMGKYAAGELKPPITASSQGSGKHPQLIPSTPRWA  236

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEV+RY+TATLTA
Sbjct  237  VANGAGVILSVCDEEVSRYDTATLTA  262



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   340 bits (871),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  130  VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  189

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+SA+G   S+   Q ERKP R L
Sbjct  190  CGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSESAEGKSTSMPLVQQERKPFRPL  249

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP T SSR SGKHPQL+PSTPRWA
Sbjct  250  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPRTTSSRVSGKHPQLMPSTPRWA  309

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETA LTA
Sbjct  310  VANGAGVILSVCDEEVARYETAALTA  335



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   338 bits (867),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVILPIISCIIDGTMAYCKDGSPFSSFISLFCPDTEHDYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS   +H +TS S +  P  +    +RKPLRLLS
Sbjct  131  CGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSDSNNVPPGQMPLNQDRKPLRLLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+TA+SRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPTTATSRGSGKHPQLVPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  251  ANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score =   337 bits (865),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 184/209 (88%), Gaps = 6/209 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVIHPI+SCIIDGTL YDK +PPF+SFISL  P+S+ + SEQWALA
Sbjct  43   VLAIFVLHHPEHGHAVIHPILSCIIDGTLIYDKGNPPFSSFISLFSPSSEKDYSEQWALA  102

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGG---PSLLSPQHERKPLR  352
            CGEILR+LTHYNRP++KVEKQ+ E +RS+SG++A+TS   +G    P L+ P  E+KPLR
Sbjct  103  CGEILRVLTHYNRPIFKVEKQNCELERSSSGNYATTSSGREGKACHPLLMEP--EKKPLR  160

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTP  529
             LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TAS RGSGKHPQL+PSTP
Sbjct  161  PLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTASGRGSGKHPQLMPSTP  220

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCDEEVARYETA LTA
Sbjct  221  RWAVANGAGVILSVCDEEVARYETANLTA  249



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEHDYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS   +H +TS S +  P  +    +RKPLR LS
Sbjct  131  CGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSDSNNVPPGQMPLNQDRKPLRPLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+TA+SRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPTTATSRGSGKHPQLVPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  251  ANGAGVILSVCDEEVARYETATLTA  275



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   335 bits (860),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 182/205 (89%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGP--SLLSPQHERKPLRL  355
            CGEILR+LTHYNRP+YK E Q++EADRS+SGSHA+TS S +G    S LS Q E+KP R 
Sbjct  130  CGEILRVLTHYNRPIYKAEHQNNEADRSSSGSHATTSNSTEGESCHSALSKQ-EKKPSRP  188

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWI DILLAAPLGIRSDYFRWC GVMGKY+A GELKPP+TA SRGSGKHPQLIPSTPR
Sbjct  189  LSPWIADILLAAPLGIRSDYFRWCGGVMGKYSAGGELKPPTTACSRGSGKHPQLIPSTPR  248

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGA VILSVCD+EVARYETAT
Sbjct  249  WAVANGAAVILSVCDDEVARYETAT  273



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   336 bits (862),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 180/205 (88%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL YD+N PPF+SFISLV  NS+ E SEQWALA
Sbjct  70   VLAIFILHHPEHGHAIVHPILSLIIDGTLVYDRNDPPFSSFISLVGQNSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSK--SADGGPSLLSPQHERKPLRL  355
            CGEILRILTHYNRP+YKVE  +SE +RSNSG+HA+TSK    DG   +L  +H+RKPLR 
Sbjct  130  CGEILRILTHYNRPIYKVEHHNSETERSNSGNHATTSKPVKQDGHDQILQ-EHDRKPLRP  188

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  189  LSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  248

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  249  WAVANGAGVILSVCDEEVARYETAN  273



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   335 bits (859),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 182/205 (89%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+NE SEQWALA
Sbjct  68   VLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSENEYSEQWALA  127

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGP--SLLSPQHERKPLRL  355
            CGEILR+LTHYNRP+YK E Q++EADRS+SGSHA+TS S +G    S LS Q E+KP R 
Sbjct  128  CGEILRVLTHYNRPIYKAEHQNNEADRSSSGSHATTSNSTEGESCHSALSKQ-EKKPSRP  186

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWI DILLAAPLGIRSDYFRWC GVMGKY+A GELKPP+TA SRGSGKHPQLIPSTPR
Sbjct  187  LSPWIADILLAAPLGIRSDYFRWCGGVMGKYSAGGELKPPTTACSRGSGKHPQLIPSTPR  246

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGA VILSVCD+EVARYETAT
Sbjct  247  WAVANGAAVILSVCDDEVARYETAT  271



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   336 bits (862),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  73   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  132

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS S    P  LSP QHERKPLR L
Sbjct  133  CGEILRILTHYNRPIYKTEQQNGETER-NCFSKATTSGSPTSEPKALSPTQHERKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  192  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  251  VANGAGVILSVCDDEVARYETATLTA  276



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score =   332 bits (852),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHG AV+ PIISCIIDGT+EY++++PPFASFISL+CP++ NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGDAVMLPIISCIIDGTIEYERSTPPFASFISLICPSTDNEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            C EILR+LTHYNRP++KVE+ + EADRS+SGS ASTSK+ DG  S  S QHERKPLR LS
Sbjct  130  CVEILRMLTHYNRPIFKVERLNGEADRSSSGSQASTSKATDGESSSPSVQHERKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST--ASSRGSGKHPQLIPSTPRW  535
            PWITD+LLAAPLG+RSDYFRWC GVMGKYA GELKPPS   ASSRGSGKHPQL+P+TPRW
Sbjct  190  PWITDLLLAAPLGVRSDYFRWCGGVMGKYAGGELKPPSVVMASSRGSGKHPQLMPATPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEV RYETATLTA
Sbjct  250  AVANGAGVILSVCDEEVTRYETATLTA  276



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   335 bits (859),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSE-EYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP++KV++QD   DRS SGSH STS+S+   P + S QHERK LR LS
Sbjct  129  CGEILRILTHYNRPIFKVDRQDKGTDRSTSGSHTSTSESSSSEPGVPSIQHERKLLRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAG+LKPPS+A+S GSGKHPQL+P+TPRWAV
Sbjct  189  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGDLKPPSSAASHGSGKHPQLLPATPRWAV  248

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEV+RYETATLTA
Sbjct  249  ANGAGVILSVCDEEVSRYETATLTA  273



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   335 bits (858),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  73   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  132

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS S    P  +SP QHERKPLR L
Sbjct  133  CGEILRILTHYNRPIYKTEQQNGETER-NCFSKATTSGSPTSEPKAVSPTQHERKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  192  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  251  VANGAGVILSVCDDEVARYETATLTA  276



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALA
Sbjct  27   VLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALA  86

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            C EILRILTHYNRP+YK E+Q+SE +RS+S SHA+TS S DG  S +   Q ERKPLR L
Sbjct  87   CTEILRILTHYNRPIYKTEQQNSEFERSSSSSHATTSDSRDGELSNMPLVQQERKPLRPL  146

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ ASSRGSGKHPQL+ STPRWA
Sbjct  147  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASSRGSGKHPQLMLSTPRWA  206

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+E+ARYETATLTA
Sbjct  207  VANGAGVILSVCDDELARYETATLTA  232



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +  N  S A+TS SA   P  +SP QHERKPLR L
Sbjct  130  CGEILRILTHYNRPIYKTEQQNGETE-INCLSKATTSGSALSEPKAVSPVQHERKPLRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  189  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  247

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  248  VANGAGVILSVCDDEVARYETATLTA  273



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   334 bits (857),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP+++++ SEQWALA
Sbjct  71   VLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEHDYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK E+Q  E +RS   +H +TS S +  P  +    +RKPLR LS
Sbjct  131  CGEILRILTHYNRPIYKTEQQSVEGERSGCDNHTTTSDSNNVPPGQMPLNQDRKPLRPLS  190

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYA  ELKPP+TA+SRGSGKHPQL+PSTPRWAV
Sbjct  191  PWITDILLAAPLGIRSDYFRWCSGVMGKYAVRELKPPTTATSRGSGKHPQLVPSTPRWAV  250

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  251  ANGAGVILSVCDEEVARYETATLTA  275



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS S    P  +SP QHERKP+R L
Sbjct  130  CGEILRILTHYNRPIYKTEQQNGETER-NCLSKATTSGSTLSEPKAVSPVQHERKPIRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  189  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  247

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  248  VANGAGVILSVCDDEVARYETATLTA  273



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   334 bits (856),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            C EILRILTHYNRP+YK E+Q+SE +RS+S SHA+TS S DG  S +   Q ERKPLR L
Sbjct  130  CTEILRILTHYNRPIYKTEQQNSEFERSSSSSHATTSDSRDGELSNMPLVQQERKPLRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ ASSRGSGKHPQL+ STPRWA
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASSRGSGKHPQLMLSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+E+ARYETATLTA
Sbjct  250  VANGAGVILSVCDDELARYETATLTA  275



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   333 bits (854),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFI LV  N++ E +EQWALA
Sbjct  70   VLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFIYLVSQNNEKEYNEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILR+LTHYNRP+YK E   SE DRS+SG+HA+TS S +G   S L  +H+RKPLR L
Sbjct  130  CGEILRVLTHYNRPIYKFEHHSSEVDRSSSGNHATTSDSNEGEAASPLLQEHDRKPLRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            SPWITD+LLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA S GSGKHPQL+PSTPRW
Sbjct  190  SPWITDMLLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSHGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETANLTA  276



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   332 bits (851),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 181/206 (88%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  70   VLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +  N  S A+TS SA   P  +SP QHERKPLR L
Sbjct  130  CGEILRILTHYNRPIYKTEQQNGETE-INCLSKATTSGSALSEPKAVSPVQHERKPLRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  189  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  247

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  248  VANGAGVILSVCDDEVARYETATLTA  273



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   331 bits (848),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   331 bits (848),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   330 bits (847),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 177/208 (85%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA  +LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFISLVCP ++NE SEQWALA
Sbjct  74   VLAVLVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASFISLVCPKNENEYSEQWALA  133

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSA---DGGPSLLSPQHERKPLR  352
            CGEILRILT YNRP+YK+E+Q  EA+ S+ GSHA  + SA    G  S++  Q E+KP R
Sbjct  134  CGEILRILTLYNRPIYKMERQYCEAEGSSGGSHAMVNDSAYGESGHNSMM--QQEKKPTR  191

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPR  532
             LSPWITDILLAAPLGIRSDYFRWCSGV+GKY AGEL+PP   S+RGSGKHPQL+PSTPR
Sbjct  192  PLSPWITDILLAAPLGIRSDYFRWCSGVLGKYGAGELQPPMIVSARGSGKHPQLMPSTPR  251

Query  533  WAVANGAGVILSVCDEEVARYETATLTA  616
            WAVANGAGVILSVCD EVARYETATLTA
Sbjct  252  WAVANGAGVILSVCDNEVARYETATLTA  279



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   329 bits (843),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +2

Query  14   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  193
            F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALAC EI
Sbjct  2    FVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALACTEI  61

Query  194  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLLSPWI  370
            LRILTHYNRP+YK E+Q+SE +RS+S SHA+TS S DG  S +   Q ERKPLR LSPWI
Sbjct  62   LRILTHYNRPIYKTEQQNSEFERSSSSSHATTSDSRDGELSNMPLVQQERKPLRPLSPWI  121

Query  371  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANG  550
            TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ ASSRGSGKHPQL+ STPRWAVANG
Sbjct  122  TDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASSRGSGKHPQLMLSTPRWAVANG  181

Query  551  AGVILSVCDEEVARYETATLTA  616
            AGVILSVCD+E+ARYETATLTA
Sbjct  182  AGVILSVCDDELARYETATLTA  203



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   330 bits (845),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 176/213 (83%), Gaps = 18/213 (8%)
 Frame = +2

Query  32   EHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ--------------NELSEQ  169
            EHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+               E SEQ
Sbjct  72   EHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEVLRILNYQFEGLSHKEYSEQ  131

Query  170  WALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPL  349
            WALACGEILRILTHYNRP+YKV +Q+  ADRS+ GSHASTSK AD  P L S  HERKPL
Sbjct  132  WALACGEILRILTHYNRPIYKVVQQEGGADRSSRGSHASTSKFADSEPRLPSMHHERKPL  191

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPST----ASSRGSGKHPQLI  517
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPST    ASS GSGKH QLI
Sbjct  192  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTDFIVASSHGSGKHHQLI  251

Query  518  PSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            PSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  252  PSTPRWAVANGAGVILSVCDEEVARYETATLTA  284



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   330 bits (845),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 179/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N    A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLRKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 179/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N    A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLRKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF SFI LV  N++ E +EQWALA
Sbjct  70   VLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFCSFIYLVSQNNEKEYNEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            C EILR+LTHYNRP+YK E   SEADRS+SG+HA+TS S +G   + L  +H+RKPLR L
Sbjct  130  CAEILRVLTHYNRPIYKSEHHSSEADRSSSGNHATTSDSNEGEAANSLLQEHDRKPLRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            SPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPRW
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETAT  607
            AVANGAGVILSVCDEEVARYETA 
Sbjct  250  AVANGAGVILSVCDEEVARYETAN  273



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE SEQWALA
Sbjct  69   VLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LT YNRP+YK E Q+ E DRSNS S ASTSKS +G  S+   Q ER+P+R LS
Sbjct  129  CGEILRMLTLYNRPIYKTEHQNGEPDRSNSCSSASTSKSTEGD-SVPLVQQERRPIRPLS  187

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP T++SRGSGKHPQL+PSTPRWAV
Sbjct  188  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPITSTSRGSGKHPQLMPSTPRWAV  247

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  248  ANGAGVILSVCDEEVARYETATLTA  272



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE SEQWALA
Sbjct  69   VLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEYSEQWALA  128

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LT YNRP+YK E Q+ E DRSNS S ASTSKS +G  S+   Q ER+P+R LS
Sbjct  129  CGEILRMLTLYNRPIYKTEHQNGEPDRSNSCSSASTSKSTEGD-SVPLVQQERRPIRPLS  187

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP T++SRGSGKHPQL+PSTPRWAV
Sbjct  188  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPITSTSRGSGKHPQLMPSTPRWAV  247

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  248  ANGAGVILSVCDEEVARYETATLTA  272



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 178/205 (87%), Gaps = 3/205 (1%)
 Frame = +2

Query  5    LATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALAC  184
             + F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALAC
Sbjct  85   FSMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALAC  144

Query  185  GEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLLS  361
            GEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR LS
Sbjct  145  GEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPLS  203

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWAV
Sbjct  204  PWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWAV  262

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCD+EVARYETATLTA
Sbjct  263  ANGAGVILSVCDDEVARYETATLTA  287



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score =   328 bits (840),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 171/198 (86%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+HPI+SCIIDGTL YDKN PPF+SFISLVCP+S+ E SEQWALA
Sbjct  90   VLAIFVLHHPEHGHAVVHPILSCIIDGTLVYDKNDPPFSSFISLVCPSSEKEYSEQWALA  149

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILRILTHYNRP+Y +E Q SE +RSNSG+HA+TS S DG    LS  +HERKPLR L
Sbjct  150  CGEILRILTHYNRPIYNIENQSSEMERSNSGNHATTSDSRDGEACQLSLVEHERKPLRPL  209

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGS-GKHPQLIPSTPRW  535
            SPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPP+T        KHPQL+PSTPRW
Sbjct  210  SPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPTTGYLWSQVRKHPQLMPSTPRW  269

Query  536  AVANGAGVILSVCDEEVA  589
            AVANGAGVILSVCDEEVA
Sbjct  270  AVANGAGVILSVCDEEVA  287



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCD+EVARYETAT
Sbjct  250  VANGAGVILSVCDDEVARYETAT  272



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   326 bits (836),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 4/208 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFISL   N++ + +EQWALA
Sbjct  70   VLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEKDYNEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST--SKSADGGPSLLSPQHERKPLRL  355
            CGEILR+LTHYNRP+YK E   SE DRS+  +HA T  SK  +   SLL  +H+RKPLR 
Sbjct  130  CGEILRVLTHYNRPIYKSEHHSSEVDRSSCSNHAPTSDSKEKEASNSLLQ-EHDRKPLRP  188

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP TA SRGSGKHPQL+PSTPR
Sbjct  189  LSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPMTACSRGSGKHPQLMPSTPR  248

Query  533  WAVANGAGVILSVCDEEVARYETATLTA  616
            WAVANGAGVILSVCDEEVARYETA LTA
Sbjct  249  WAVANGAGVILSVCDEEVARYETANLTA  276



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   326 bits (836),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 179/206 (87%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  71   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  130

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQH-ERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  + A+TS S       +SP H ERKPLR L
Sbjct  131  CGEILRILTHYNRPIYKTEQQNGDTER-NCLNKATTSGSPPSESKAVSPTHNERKPLRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  190  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  249  VANGAGVILSVCDDEVARYETATLTA  274



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+A
Sbjct  70   VLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YK E Q+S  DRS+SG HA++S + +G      PQ ++KPLR LS
Sbjct  130  CGEILRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSSTKEGTCYSALPQQDKKPLRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+     GSGKHPQ IPSTPRWA
Sbjct  189  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTIVCGGGSGKHPQFIPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGA VILSVCDEEVARYETAT
Sbjct  249  VANGAAVILSVCDEEVARYETAT  271



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   325 bits (832),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +2

Query  17   LLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEIL  196
            +L   +HGHAV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE SEQWA+ACGEIL
Sbjct  65   MLLFDDHGHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENEYSEQWAMACGEIL  124

Query  197  RILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGP---SLLSPQHERKPLRLLSPW  367
            RILTHYNRP+YK+E+Q  E + S+  SHA+T+ S DG     SL+  Q E+KP+R LSPW
Sbjct  125  RILTHYNRPIYKMERQYCEPEVSSGKSHATTNDSVDGESGHNSLM--QQEKKPIRPLSPW  182

Query  368  ITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVAN  547
            ITDIL AAPLGIRSDYFRWCSGVMGKYAAGELKPP+  S+RGSGKHPQL+PSTPRWAVAN
Sbjct  183  ITDILRAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIVSARGSGKHPQLVPSTPRWAVAN  242

Query  548  GAGVILSVCDEEVARYETATLTA  616
            GAGVILSVCD+EVARYETATLTA
Sbjct  243  GAGVILSVCDDEVARYETATLTA  265



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   325 bits (832),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 178/206 (86%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP++K E+Q+ E +R N  + A+TS S       +SP  HERKPLR L
Sbjct  132  CGEILRILTHYNRPIFKTEQQNGEIER-NCLNKATTSGSPPSETKAVSPTHHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  191  SPWICDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  250  VANGAGVILSVCDDEVARYETATLTA  275



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   325 bits (832),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 180/207 (87%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPS-LLSP-QHERKPLRL  355
            CGEILRILTHYNRP+YK E+Q+ E +R N  S A+TS S     +  +SP  HERKPLR 
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETER-NCLSKATTSGSPPPAETKAVSPTHHERKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRW
Sbjct  191  LSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCD+EVARYETATLTA
Sbjct  250  AVANGAGVILSVCDDEVARYETATLTA  276



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   324 bits (831),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+A
Sbjct  70   VLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YK E Q+S  DRS+SG HA++S + +G      PQ ++KPLR LS
Sbjct  130  CGEILRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSSTKEGTCYSALPQQDKKPLRPLS  188

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+     GSGKHPQ IPSTPRWA
Sbjct  189  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTIVCGGGSGKHPQFIPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGA VILSVCDEEVARYETAT
Sbjct  249  VANGAAVILSVCDEEVARYETAT  271



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +RS      ++          +SP  HERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGSPPPSETKAVSPTHHERKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  192  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  251  VANGAGVILSVCDDEVARYETATLTA  276



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ E +RS      ++          +SP  HERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGSPPPSETKAVSPTHHERKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRWA
Sbjct  192  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRWA  250

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  251  VANGAGVILSVCDDEVARYETATLTA  276



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 175/207 (85%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFISL   N++ + +EQWALA
Sbjct  70   VLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEKDYNEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG-GPSLLSPQHERKPLRLL  358
            CGEILR+LTHYNRP+YK E   SE D S+  +HA+TS S +    S L  +H+RKPLR L
Sbjct  130  CGEILRVLTHYNRPIYKSEHHSSEVDGSSCSNHATTSDSREKEASSSLLQEHDRKPLRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            SPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP TA SRGSGKHPQL+PSTPRW
Sbjct  190  SPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPMTACSRGSGKHPQLMPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA LTA
Sbjct  250  AVANGAGVILSVCDEEVARYETANLTA  276



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   323 bits (828),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 179/211 (85%), Gaps = 16/211 (8%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL-----LSP-QHERK  343
            CGEILRILTHYNRP+YK E+Q+ E +     S ASTS    G P+L     +SP QHERK
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETE-----SKASTS----GSPTLSEAKAVSPGQHERK  182

Query  344  PLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPS  523
            PLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A +RGSGKHPQ +PS
Sbjct  183  PLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-TRGSGKHPQYMPS  241

Query  524  TPRWAVANGAGVILSVCDEEVARYETATLTA  616
            TPRWAVANGAGVILSVCD+EVARYETATLTA
Sbjct  242  TPRWAVANGAGVILSVCDDEVARYETATLTA  272



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   323 bits (828),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 179/211 (85%), Gaps = 16/211 (8%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL-----LSP-QHERK  343
            CGEILRILTHYNRP+YK E+Q+ E +     S ASTS    G P+L     +SP QHERK
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETE-----SKASTS----GSPTLSEAKAVSPGQHERK  182

Query  344  PLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPS  523
            PLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A +RGSGKHPQ +PS
Sbjct  183  PLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-TRGSGKHPQYMPS  241

Query  524  TPRWAVANGAGVILSVCDEEVARYETATLTA  616
            TPRWAVANGAGVILSVCD+EVARYETATLTA
Sbjct  242  TPRWAVANGAGVILSVCDDEVARYETATLTA  272



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   322 bits (824),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            V+A F+LHHPEHGHAVI PII+CIIDG+L Y+K +PPFASFISLVC +S+N+ SEQWALA
Sbjct  70   VMAMFVLHHPEHGHAVILPIIACIIDGSLVYNKETPPFASFISLVCSSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK+EKQ  E +RSN G   +T+        ++ P Q ERKPLR L
Sbjct  130  CGEILRILTHYNRPIYKMEKQLGETERSN-GVCRNTADPTHAESKVVPPVQQERKPLRPL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI DILLAAPL IRSDYFRW SGVMG+YAAG+L+PP  ASSRGSGKHPQL+PSTPRWA
Sbjct  189  SPWIADILLAAPLSIRSDYFRWSSGVMGRYAAGDLRPPIIASSRGSGKHPQLMPSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  249  VANGAGVILSVCDDEVARYETATLTA  274



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 175/207 (85%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QNELSEQWAL  178
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S QN+ SEQWAL
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQNDYSEQWAL  131

Query  179  ACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRL  355
            ACGEILRILTHYNRP+YK E+Q+ E +RS      ++          +SP  HERKPLR 
Sbjct  132  ACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGSPPPSETKAVSPTHHERKPLRP  191

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRW
Sbjct  192  LSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRW  250

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCD+EVARYETATLTA
Sbjct  251  AVANGAGVILSVCDDEVARYETATLTA  277



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 175/207 (85%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QNELSEQWAL  178
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S QN+ SEQWAL
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQNDYSEQWAL  131

Query  179  ACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRL  355
            ACGEILRILTHYNRP+YK E+Q+ E +RS      ++          +SP  HERKPLR 
Sbjct  132  ACGEILRILTHYNRPIYKTEQQNGETERSCLSKATTSGSPPPSETKAVSPTHHERKPLRP  191

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRW  535
            LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A SRGSGKHPQL+PSTPRW
Sbjct  192  LSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-SRGSGKHPQLMPSTPRW  250

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCD+EVARYETATLTA
Sbjct  251  AVANGAGVILSVCDDEVARYETATLTA  277



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 178/211 (84%), Gaps = 16/211 (8%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV P S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPTSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL-----LSP-QHERK  343
            CGEILRILTHYNRP+YK E+Q+ E +     S ASTS    G P+L     +SP QHERK
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETE-----SKASTS----GSPTLSETKAVSPGQHERK  182

Query  344  PLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPS  523
            PLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+ A +RGSGKHPQ +PS
Sbjct  183  PLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIA-TRGSGKHPQYMPS  241

Query  524  TPRWAVANGAGVILSVCDEEVARYETATLTA  616
            TPRWAVANGAGVILSVCD+EVARYETATLTA
Sbjct  242  TPRWAVANGAGVILSVCDDEVARYETATLTA  272



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = +2

Query  14   FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  193
            F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+ACGEI
Sbjct  2    FVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMACGEI  61

Query  194  LRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWIT  373
            LR+LTHYNRP+YK E Q+S  DRS+SG HA++S + +G      PQ ++KPLR LSPWIT
Sbjct  62   LRVLTHYNRPIYKAEHQNS-VDRSSSGIHATSSSTKEGTCYSALPQQDKKPLRPLSPWIT  120

Query  374  DILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWAVANG  550
            DILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+     GSGKHPQ IPSTPRWAVANG
Sbjct  121  DILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTIVCGGGSGKHPQFIPSTPRWAVANG  180

Query  551  AGVILSVCDEEVARYETAT  607
            A VILSVCDEEVARYETAT
Sbjct  181  AAVILSVCDEEVARYETAT  199



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   320 bits (820),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPE+GHA+I PIISCII+G LEY++N PPFASFISL CP  +N+ SEQWALA
Sbjct  70   VLALFVLHHPENGHAIILPIISCIINGALEYNRNDPPFASFISLFCPGIENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+E+++ E +RS+S S A+TS + D     +  Q ERKP+R LS
Sbjct  130  CGEILRILTHYNRPIYKMEQKNGETERSSSCSLATTSDTDDRELVGVPQQQERKPVRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGEL+PP++ASSRGSGKHPQLIPSTPRWAV
Sbjct  190  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELRPPTSASSRGSGKHPQLIPSTPRWAV  249

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  250  ANGAGVILSVCDEEVARYETATLTA  274



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   319 bits (818),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 179/222 (81%), Gaps = 26/222 (12%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSL-----LSP-QHERK  343
            CGEILRILTHYNRP+YK E+Q+ E +     S ASTS    G P+L     +SP QHERK
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGETE-----SKASTS----GSPTLSEAKAVSPGQHERK  182

Query  344  PLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP-----------STASSR  490
            PLR LSPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP           +  S+R
Sbjct  183  PLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIGECPSPLATTMGSTR  242

Query  491  GSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            GSGKHPQ +PSTPRWAVANGAGVILSVCD+EVARYETATLTA
Sbjct  243  GSGKHPQYMPSTPRWAVANGAGVILSVCDDEVARYETATLTA  284



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIIS IIDGTL YDK  PPFASFISL CPN +NE SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVVLPIISIIIDGTLVYDKERPPFASFISLFCPNDENEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQH-ERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q S  + ++   +A+ S ++D   S  S    ER+  R L
Sbjct  130  CGEILRILTHYNRPIYKHERQKSPENCTSCKDYATCSNASDAKSSHSSSVQSERRTSRPL  189

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWITDILLAAPLGI+SDYFRWC GVMG+YAAGELKPP  ASSRG+GKHPQL+PSTPRWA
Sbjct  190  SPWITDILLAAPLGIKSDYFRWCGGVMGRYAAGELKPPMIASSRGNGKHPQLMPSTPRWA  249

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETA+LTA
Sbjct  250  VANGAGVILSVCDEEVARYETASLTA  275



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   317 bits (813),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF+SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSAD-GGPSLLSPQHERKPLRLL  358
            CGEILR+LTHYNRP++KVE+Q SEA+ S +   A++S S D    + L  + +RKPLR L
Sbjct  132  CGEILRVLTHYNRPIFKVERQHSEAECSTTSDQATSSDSTDKKSNNSLGNESDRKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            +PWITDILLAAPLGIRSDYFRWCSGVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPRW
Sbjct  192  TPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPSTPRW  251

Query  536  AVANGAGVILSVCDEEVARYETAT  607
            AVANGAGVILSVCDEEVARYETA 
Sbjct  252  AVANGAGVILSVCDEEVARYETAN  275



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   316 bits (810),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 174/206 (84%), Gaps = 9/206 (4%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQWALA
Sbjct  72   VLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSP-QHERKPLRLL  358
            CGEILRILTHYNRP+YK E+Q+ + +R N  S A+TS S    P   SP QHERKPLR L
Sbjct  132  CGEILRILTHYNRPIYKTEQQNGDTER-NCLSKATTSGSPTSEPKAGSPTQHERKPLRPL  190

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            SPWI+DILLAAPLGIRSDYFRWCSGVMGKYAAGELKPP+        +HPQL+PSTPRWA
Sbjct  191  SPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTI-------EHPQLMPSTPRWA  243

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCD+EVARYETATLTA
Sbjct  244  VANGAGVILSVCDDEVARYETATLTA  269



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   315 bits (808),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF+SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSAD-GGPSLLSPQHERKPLRLL  358
            CGEILR+LTHYNRP++KVE+Q SEA+ S +   A++S S D    + L  + +RKPLR L
Sbjct  132  CGEILRVLTHYNRPIFKVERQHSEAECSTTSDQATSSDSTDKKSNNSLGNESDRKPLRPL  191

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            +PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPRW
Sbjct  192  TPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPSTPRW  251

Query  536  AVANGAGVILSVCDEEVARYETAT  607
            AVANGAGVILSVCDEEVARYETA 
Sbjct  252  AVANGAGVILSVCDEEVARYETAN  275



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA+IHP++SCIIDGTL YDK  PPF+SF SL  P+S+N+ SEQWALA
Sbjct  70   VLAIFVLHHPEHGHAIIHPLLSCIIDGTLIYDKKMPPFSSFNSLFSPSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEK-QDSEADRSNSGSHASTSKSADGGPS--LLSPQHERKPLR  352
            CGEILR+LTHYNRPVY+V++    E +R  SG+ ASTS S + G S   +    ++KPLR
Sbjct  130  CGEILRVLTHYNRPVYQVDRTHKQETERCVSGNSASTSNSRENGISGHSIRQDQDKKPLR  189

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTP  529
            LL+PWITDILLAAPLGIRSDYFRWC GV GKYAA GELKPP+TA  RG GKHPQL+PSTP
Sbjct  190  LLTPWITDILLAAPLGIRSDYFRWCGGVKGKYAAGGELKPPTTAGGRGPGKHPQLMPSTP  249

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCD+EV RYETA LTA
Sbjct  250  RWAVANGAGVILSVCDDEVTRYETANLTA  278



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER--KPLRL  355
            CGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S S D   S  SP +E   KPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKR-SNNSPGNESDWKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   314 bits (804),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA+IHPI+S IIDGTL YD+N  PF SFISL   NS+ E SEQWALA
Sbjct  70   VLAVFVLHHPEHGHAIIHPILSLIIDGTLAYDRNDSPFCSFISLFKQNSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KVE  + E +RSNS + A+TSKS     +    Q +RKPLR LS
Sbjct  130  CGEILRVLTHYNRPIHKVEHHNVEYERSNSDNRATTSKSKQEEANHPLQQEDRKPLRPLS  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAPLGIRSDYFRWC GVMGKYAA G+LKPP+TA SRGSGKH QL+ STPRWA
Sbjct  190  PWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGDLKPPTTACSRGSGKH-QLMQSTPRWA  248

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGAGVILSVCDEEVARYETA LTA
Sbjct  249  VANGAGVILSVCDEEVARYETANLTA  274



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   314 bits (804),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+SCIIDGTL + KN+PPF+SFISL+   ++ E SEQWALA
Sbjct  70   VLAIFVLHHPEHGHAIVHPILSCIIDGTLVHGKNNPPFSSFISLIGQTTEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LT YNRP+YK E  + EA+RS+SGSHA+TS+S  GG S  SP  ERKPLR L+
Sbjct  130  CGEILRVLTLYNRPIYKSEHHNIEAERSSSGSHATTSESI-GGESSNSP--ERKPLRPLT  186

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKY-AAGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILLAAP+GIRSDYFRWC GVMGKY AAGELKPP+TA SR SGKHPQL+PSTP WA
Sbjct  187  PWITDILLAAPVGIRSDYFRWCGGVMGKYAAAGELKPPTTARSRRSGKHPQLMPSTPGWA  246

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCD+EVARYE+A 
Sbjct  247  VANGAGVILSVCDDEVARYESAN  269



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ + SEQWALA
Sbjct  70   VLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEKQCSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSAD---GGPSLLSPQHERKPLR  352
            CGEILRILTHYNRP++K E  ++  +RSNS +HA+TSKS       P L   +H+RKPLR
Sbjct  130  CGEILRILTHYNRPIFKAECHNTGTERSNSCNHATTSKSEKQEANNPIL--QEHDRKPLR  187

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTP  529
             LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GELKPP+TA S GSGKHP L+PSTP
Sbjct  188  PLSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSHGSGKHPLLMPSTP  247

Query  530  RWAVANGAGVILSVCDEEVARYETAT  607
            RWAVANGAGVILSVCDEEVA YETA 
Sbjct  248  RWAVANGAGVILSVCDEEVAHYETAN  273



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score =   312 bits (800),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER--KPLRL  355
            CGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S S D   S  SP +E   KPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKR-SNNSPGNESDWKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 174/206 (84%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ + SEQWALA
Sbjct  70   VLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEKQCSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSAD---GGPSLLSPQHERKPLR  352
            CGEILRILTHYNRP++K E  ++  +RSNS +HA+TSKS       P L   +H+RKPLR
Sbjct  130  CGEILRILTHYNRPIFKAECHNTGTERSNSCNHATTSKSEKQEANNPIL--QEHDRKPLR  187

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTP  529
             LSPWITDILLA+PLGIRSDYFRWC GVMGKYAA GELKPP+TA S GSGKHP L+PSTP
Sbjct  188  PLSPWITDILLASPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSHGSGKHPLLMPSTP  247

Query  530  RWAVANGAGVILSVCDEEVARYETAT  607
            RWAVANGAGVILSVCDEEVA YETA 
Sbjct  248  RWAVANGAGVILSVCDEEVAHYETAN  273



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER--KPLRL  355
            CGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S S D   S  SP +E   KPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKR-SNNSPGNESDWKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER--KPLRL  355
            CGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S S D   S  SP +E   KPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKR-SNNSPGNESDWKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNSEQEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHE--RKPLRL  355
            CGEILR+LTHYNRP++KVE+Q +EA+ S++   A++S S D   S  SP +E  RKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKR-SNNSPGNESDRKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQ +PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQPMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   311 bits (798),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 172/207 (83%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPST  526
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PST
Sbjct  189  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPST  248

Query  527  PRWAVANGAGVILSVCDEEVARYETAT  607
            PRWAVANGAGVILSVCDEEVARYETA 
Sbjct  249  PRWAVANGAGVILSVCDEEVARYETAN  275



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 174/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGAPFSSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHE--RKPLRL  355
            CGEILR+LTHYNRP++KVE+Q SEA+ S++   A++S S D   S  SP  E  RKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVERQHSEAECSSTSDQATSSDSTD-KKSDDSPGTEPDRKPLRP  190

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            L+PWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PSTPR
Sbjct  191  LTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPSTPR  250

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  251  WAVANGAGVILSVCDEEVARYETAN  275



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 173/209 (83%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LH+PEHGHA+IHP++SCIIDGTL YDK   PF+SF SL  P+S+N+ SEQWALA
Sbjct  70   VLAIFVLHYPEHGHAIIHPLLSCIIDGTLIYDKKMSPFSSFNSLFSPSSENDYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQ-DSEADRSNSGSHASTSKSADGGPS--LLSPQHERKPLR  352
            CGEILR+LTHYNRPVYKV++    E +R  SG+ ASTS S + G S   +    ++KPLR
Sbjct  130  CGEILRVLTHYNRPVYKVDRTYKQETERCVSGNSASTSNSRENGISGHSIRQDQDKKPLR  189

Query  353  LLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTP  529
            LL+PWITDILLAAPLGIRSDYFRWC GV GKYAA GELKPP+TA  RG GKHPQL+PSTP
Sbjct  190  LLTPWITDILLAAPLGIRSDYFRWCGGVKGKYAAGGELKPPTTAGGRGPGKHPQLMPSTP  249

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCD+EV RYETA LTA
Sbjct  250  RWAVANGAGVILSVCDDEVTRYETANLTA  278



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 172/207 (83%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPST  526
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PST
Sbjct  189  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPST  248

Query  527  PRWAVANGAGVILSVCDEEVARYETAT  607
            PRWAVANGAGVILSVCDEEVARYETA 
Sbjct  249  PRWAVANGAGVILSVCDEEVARYETAN  275



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 172/207 (83%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPST  526
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PST
Sbjct  189  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPST  248

Query  527  PRWAVANGAGVILSVCDEEVARYETAT  607
            PRWAVANGAGVILSVCDEEVARYETA 
Sbjct  249  PRWAVANGAGVILSVCDEEVARYETAN  275



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   310 bits (794),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 5/203 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEH HA++HPI+SCIIDG+L YDKN PPF+SFISLV  N++ E SEQWA+A
Sbjct  70   VLATFVLHHPEHSHAIVHPILSCIIDGSLLYDKNEPPFSSFISLVGQNNEKEYSEQWAMA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YKV+ Q S  + S S + A +S      P     ++ERKPLR LS
Sbjct  130  CGEILRVLTHYNRPIYKVDNQGS-GEESRSENSACSSGETSRSP---KQENERKPLRPLS  185

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
             WITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP TASSRGSGKHPQL+PSTPRWA
Sbjct  186  AWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPITASSRGSGKHPQLMPSTPRWA  245

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVAR+ETA 
Sbjct  246  VANGAGVILSVCDEEVARHETAN  268



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 174/207 (84%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILR+LTHYNRP++K E Q+ + +R +S   A+TS   +      S P+++RKP+R L
Sbjct  130  CGEILRVLTHYNRPIFKAEHQN-KIERLSSCDQATTSDPKEEKVHHSSMPENDRKPVRAL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            SPWI DIL+ +PLGIRSDYFRWC GVMGKYAA GELKPP T+SSRGSGKHPQL+ STPRW
Sbjct  189  SPWIADILITSPLGIRSDYFRWCGGVMGKYAAGGELKPPITSSSRGSGKHPQLMQSTPRW  248

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA LTA
Sbjct  249  AVANGAGVILSVCDEEVARYETANLTA  275



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 174/207 (84%), Gaps = 3/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPLRLL  358
            CGEILR+LTHYNRP++K E Q+ + +R +S   A+TS   +      S P+++RKP+R L
Sbjct  130  CGEILRVLTHYNRPIFKAEHQN-KIERLSSCDQATTSDPKEEKVHHSSMPENDRKPVRAL  188

Query  359  SPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRW  535
            SPWI DIL+ +PLGIRSDYFRWC GVMGKYAA GELKPP T+SSRGSGKHPQL+ STPRW
Sbjct  189  SPWIADILITSPLGIRSDYFRWCGGVMGKYAAGGELKPPITSSSRGSGKHPQLMQSTPRW  248

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGAGVILSVCDEEVARYETA LTA
Sbjct  249  AVANGAGVILSVCDEEVARYETANLTA  275



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 169/207 (82%), Gaps = 8/207 (4%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGT+ YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTMSYDRNGFPFKSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++K E Q  EA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKAEHQHCEAECSSTSDQASSCESIEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPST  526
            R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP+TA SRGSGKHPQL+PST
Sbjct  189  RPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQLMPST  248

Query  527  PRWAVANGAGVILSVCDEEVARYETAT  607
            PRWAVANGAGVILSVCDEEV RYETA 
Sbjct  249  PRWAVANGAGVILSVCDEEVTRYETAN  275



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   302 bits (774),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  71   IIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDS  250
            ++DGTL YD +SPPFASFISLVCP+S+NE SEQWALACGEILRILTHYNRP+YK+EKQ+S
Sbjct  83   VLDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALACGEILRILTHYNRPIYKLEKQNS  142

Query  251  EADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCS  430
            E DRS+S  H+++ +S     ++   Q ERKP R LSPWITD+LLAAPLGIRSDYFRWCS
Sbjct  143  ETDRSSSDGHSTSIESEGKSSTIPLVQQERKPFRPLSPWITDVLLAAPLGIRSDYFRWCS  202

Query  431  GVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATL  610
            GVMGKYAAGELKPP T SSR SGKHPQL+PSTPRWAVANGAGVILSVCDEEVARYETA L
Sbjct  203  GVMGKYAAGELKPPRTTSSRVSGKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETAAL  262

Query  611  TA  616
            TA
Sbjct  263  TA  264



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 169/203 (83%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KV +++S +D++ +    S  + A+G P     + +RKPLR LS
Sbjct  132  CGEILRVLTHYNRPIFKVAERNSTSDQATAS--YSVQEKANGSP---GNEPDRKPLRPLS  186

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPRWA
Sbjct  187  PWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPRWA  246

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVARYETA 
Sbjct  247  VANGAGVILSVCDEEVARYETAN  269



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   300 bits (767),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 168/205 (82%), Gaps = 10/205 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQH--ERKPLRL  355
            CGEILR+LTHYNRP++KV      AD +N+   A+TS SA    +  SP +  ERKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKV------ADCNNTSDQATTSCSAQEKAN-YSPGNEPERKPLRP  184

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPR
Sbjct  185  LSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPR  244

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  245  WAVANGAGVILSVCDEEVARYETAN  269



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 167/205 (81%), Gaps = 10/205 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQH--ERKPLRL  355
            CGEILR+LTHYNRP++KV      AD +N+   A+ S SA    +  SP +  ERKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKV------ADCNNTSDQATASCSAQEKAN-FSPGNEPERKPLRP  184

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPR
Sbjct  185  LSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPR  244

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  245  WAVANGAGVILSVCDEEVARYETAN  269



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   297 bits (761),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 167/205 (81%), Gaps = 10/205 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQH--ERKPLRL  355
            CGEILR+LTHYNRP++KV      AD +N+   A+ S SA    +  SP +  ERKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKV------ADCNNTSDQATASCSAQEKAN-YSPGNEPERKPLRP  184

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPR
Sbjct  185  LSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPR  244

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  245  WAVANGAGVILSVCDEEVARYETAN  269



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   297 bits (760),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 164/203 (81%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KV   ++ +D++ +   A    +   G      + ERKPLR LS
Sbjct  132  CGEILRVLTHYNRPIFKVADCNNRSDQATASCSAQEKANYSPG-----NEPERKPLRPLS  186

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPRWA
Sbjct  187  PWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPRWA  246

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVARYETA 
Sbjct  247  VANGAGVILSVCDEEVARYETAN  269



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   296 bits (759),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 11/203 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHA++HP +SCII+G+L Y KN PPF SFISLV  N++ E SEQWALA
Sbjct  70   VLATFVLHHPEHGHAIVHPTLSCIIEGSLVYSKNVPPFNSFISLVSQNNEKEYSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YKV+ Q SE +  + G  + + K           ++ERKPLR LS
Sbjct  130  CGEILRVLTHYNRPIYKVDHQGSEEESRSEGESSRSPKQ----------ENERKPLRPLS  179

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
             WITDILLAAPLGIRSDYFRWC GVMGKYAA GELKPP TASSRG+GKHPQL+PSTPRWA
Sbjct  180  AWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPITASSRGAGKHPQLMPSTPRWA  239

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVAR+ETA 
Sbjct  240  VANGAGVILSVCDEEVARHETAN  262



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF SFISL    ++ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTAEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KV + +  +D++ +    S  + A+  P     + ERKPLR LS
Sbjct  132  CGEILRVLTHYNRPIFKVAECNDTSDQATTS--YSLQEKANSSP---ENEPERKPLRPLS  186

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPRWA
Sbjct  187  PWITDILLNAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPRWA  246

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVARYETA 
Sbjct  247  VANGAGVILSVCDEEVARYETAN  269



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 165/205 (80%), Gaps = 10/205 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF SFISL    ++ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTAEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGS--HASTSKSADGGPSLLSPQHERKPLRL  355
            CGEILR+LTHYNRP++KV + +  +D++ +    H   + S +  P       ERKPLR 
Sbjct  132  CGEILRVLTHYNRPIFKVAECNDTSDQATTSYSLHDKANSSPENEP-------ERKPLRP  184

Query  356  LSPWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPR  532
            LSPWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPR
Sbjct  185  LSPWITDILLNAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPR  244

Query  533  WAVANGAGVILSVCDEEVARYETAT  607
            WAVANGAGVILSVCDEEVARYETA 
Sbjct  245  WAVANGAGVILSVCDEEVARYETAN  269



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS+S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSSSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE SEQWALA
Sbjct  23   VLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENEYSEQWALA  82

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILRILTHYNRP+YK+EKQ+SE DRS S  ++++ +S     ++   Q ERKP R LS
Sbjct  83   CGEILRILTHYNRPIYKLEKQNSETDRSXSDGNSTSIESEGKSSTIPLVQQERKPFRPLS  142

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAV  541
            PW                   CSGVMGKYAAGEL       SRGSGKHPQL+PSTPRWAV
Sbjct  143  PWXXXXXXXXXXXXXXXXXXXCSGVMGKYAAGELXXXXXXXSRGSGKHPQLVPSTPRWAV  202

Query  542  ANGAGVILSVCDEEVARYETATLTA  616
            ANGAGVILSVCDEEVARYETATLTA
Sbjct  203  ANGAGVILSVCDEEVARYETATLTA  227



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 160/203 (79%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  64   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  123

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KV   +      ++    +    A  G      + ERKPLR LS
Sbjct  124  CGEILRVLTHYNRPIFKVADCNQHLWPGHNKLFCTEKAIALPG-----NEPERKPLRPLS  178

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDILL APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPRWA
Sbjct  179  PWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPRWA  238

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVARYETA 
Sbjct  239  VANGAGVILSVCDEEVARYETAN  261



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP++KV   + +    +S    +     +   +L   + E KPLR LS
Sbjct  132  CGEILRVLTHYNRPIFKVADCNHQIRPGHSKLFCT-----EKAITLPGNEPEGKPLRPLS  186

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAA-GELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITDI+L APLGIRSDYFRWC GVMGKYAA GELKPP+TA SRG+GKHPQL+PSTPRWA
Sbjct  187  PWITDIVLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGKHPQLMPSTPRWA  246

Query  539  VANGAGVILSVCDEEVARYETAT  607
            VANGAGVILSVCDEEVARYETA 
Sbjct  247  VANGAGVILSVCDEEVARYETAN  269



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   275 bits (703),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 142/159 (89%), Gaps = 7/159 (4%)
 Frame = +2

Query  152  NELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADG----GPSL  319
            NE SEQWALACGEILRILTHYNRP+YKVE Q SEADRS+SG HA+TS S DG    GP L
Sbjct  122  NEYSEQWALACGEILRILTHYNRPIYKVEHQSSEADRSSSGRHATTSDSVDGKSSQGPLL  181

Query  320  LSPQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSG  499
               Q+ERKP R LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPSTAS+RGSG
Sbjct  182  ---QNERKPSRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPSTASTRGSG  238

Query  500  KHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            KHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  239  KHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  277


 Score = 63.5 bits (153),  Expect(2) = 4e-84, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  6    WQHFSSIIQSMGMLLFIQLSHVSLMVHWSMIKIVHLLPLSFHWSVQTVR  152
            WQ    II++MGML F QL  VSLMVHW MI ++ LLPLSF WS Q  R
Sbjct  71   WQRLFFIIRNMGMLSFFQLFRVSLMVHWCMIGVLLLLPLSFPWSAQAAR  119



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 155/206 (75%), Gaps = 5/206 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ +L+EQWALA
Sbjct  70   VLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSERDLTEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YK E       RS+S S     +   G P        R P RLL+
Sbjct  130  CGEILRLLTHYNRPIYKSESSADGEKRSSSDSGDPADRDGSGSPD----NGRRAPKRLLT  185

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYA-AGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITD LLAAPLG +SDYFRWC GV+GKYA  G+L+PP+T   +G GKHPQL+ STPRWA
Sbjct  186  PWITDSLLAAPLGTKSDYFRWCGGVLGKYAGGGDLRPPTTGDGKGHGKHPQLLSSTPRWA  245

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGA VI SVCD+EV RYETA LTA
Sbjct  246  VANGAAVISSVCDDEVLRYETADLTA  271



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score =   276 bits (707),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 155/206 (75%), Gaps = 5/206 (2%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ +L+EQWALA
Sbjct  70   VLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSERDLTEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGEILR+LTHYNRP+YK E       RS+S S     +   G P        R P RLL+
Sbjct  130  CGEILRLLTHYNRPIYKSESSADGEKRSSSDSGDPADRDGSGSPD----NGRRAPKRLLT  185

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYA-AGELKPPSTASSRGSGKHPQLIPSTPRWA  538
            PWITD LLAAPLG +SDYFRWC GV+GKYA  G+L+PP+T   +G GKHPQL+ STPRWA
Sbjct  186  PWITDSLLAAPLGTKSDYFRWCGGVLGKYAGGGDLRPPTTGDGKGHGKHPQLLSSTPRWA  245

Query  539  VANGAGVILSVCDEEVARYETATLTA  616
            VANGA VI SVCD+EV RYETA LTA
Sbjct  246  VANGAAVISSVCDDEVLRYETADLTA  271



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 5/170 (3%)
 Frame = +2

Query  110  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST  289
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP+YK      EA+RS+SGSHA+T
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRPIYK----HVEAERSSSGSHATT  57

Query  290  SKSADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  466
            S  ADG     S  Q E+KP R LSPWI+DILLAAP+GIRSDYFRWCSGVMGKYAAGELK
Sbjct  58   SGPADGKSEHNSLTQQEKKPTRPLSPWISDILLAAPVGIRSDYFRWCSGVMGKYAAGELK  117

Query  467  PPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGVILSVCD+EV+RYETA LTA
Sbjct  118  PPSTAASRGSGKHPQLVPSTPRWAVANGAGVILSVCDDEVSRYETAILTA  167



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   274 bits (700),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 5/170 (3%)
 Frame = +2

Query  110  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST  289
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP+YK      EA+RS+SGSHA+T
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRPIYK----HVEAERSSSGSHATT  57

Query  290  SKSADGGPSLLS-PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELK  466
            S  ADG     S  Q E+KP R LSPWI+DILLAAP+GIRSDYFRWCSGVMGKYAAGELK
Sbjct  58   SGPADGKSEHNSLTQQEKKPTRPLSPWISDILLAAPVGIRSDYFRWCSGVMGKYAAGELK  117

Query  467  PPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            PPSTA+SRGSGKHPQL+PSTPRWAVANGAGVILSVCD+EV+RYETA LTA
Sbjct  118  PPSTAASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVSRYETAILTA  167



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 160/217 (74%), Gaps = 12/217 (6%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS------QNELS  163
            VLATF+LHHPEHGH  IHP++S IID  + YDK  PPF+SFISL  P+S      Q +  
Sbjct  70   VLATFVLHHPEHGHTFIHPLLSLIIDRIVIYDKKIPPFSSFISLFSPSSKLHFPWQKDYP  129

Query  164  EQWALACGEILRILTHYNRPVYKVE---KQDSEADRSNSGSHASTSKSADGGP--SLLSP  328
            EQW +AC  ILR+LTHYNRP+   E    Q+   +RS SG+ ASTSKS D  P       
Sbjct  130  EQWGVACLGILRVLTHYNRPLLDNEVDRAQNGATERSASGNSASTSKSRDKEPLGDCAQQ  189

Query  329  QHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPSTASSRGSGKH  505
              E+KPLRLL+PWITD LLA  +GIRSDYFRWC GVMGKYAAG ELKPP TA  +G GKH
Sbjct  190  YQEKKPLRLLTPWITDSLLATSMGIRSDYFRWCGGVMGKYAAGGELKPPITAGGQGPGKH  249

Query  506  PQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            PQL+PSTPRWAVANGAGVILSVCD+EVARYE+  LT+
Sbjct  250  PQLMPSTPRWAVANGAGVILSVCDDEVARYESVNLTS  286



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 152/207 (73%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+H ++SC+IDGTL Y+K +PPF SF+SL  P+++ + SEQWALA
Sbjct  70   VLATFVLHHPEHGHAVLHALLSCVIDGTLIYNKKTPPFGSFVSLFSPSTERDFSEQWALA  129

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHERKPLRLLS  361
            CGE LR+LTHYNRP ++ + +       +  S    S       +       R P RLL+
Sbjct  130  CGETLRVLTHYNRPTFRSDTRQPSGSNPSPSSSGEGSGKCSQERAGWDEYDRRSPTRLLT  189

Query  362  PWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPSTA-SSRGSGKHPQLIPSTPRW  535
            PWITD LLAAP  IRSDYF+WC GVMGKY AG EL+PP+TA   R  GK PQL+PSTPRW
Sbjct  190  PWITDSLLAAPPSIRSDYFQWCGGVMGKYTAGEELRPPTTAVGGRSQGKQPQLLPSTPRW  249

Query  536  AVANGAGVILSVCDEEVARYETATLTA  616
            AVANGA VILSVCD+EV+RYETA LTA
Sbjct  250  AVANGAAVILSVCDDEVSRYETADLTA  276



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 10/157 (6%)
 Frame = +2

Query  146  SQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS  325
            +Q E SEQWALACGEILR+LTHYNRP++KV      AD +N+   A+ S SA    +  S
Sbjct  113  AQKEYSEQWALACGEILRVLTHYNRPIFKV------ADCNNTSDQATASCSAQEKANY-S  165

Query  326  PQHE--RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPSTASSRGS  496
            P +E  RKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAAG ELKPP+TA SRG+
Sbjct  166  PGNEPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGA  225

Query  497  GKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETAT  607
            GKHPQL+PSTPRWAVANGAGVILSVCDEEVARYETA 
Sbjct  226  GKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETAN  262



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 125/155 (81%), Gaps = 6/155 (4%)
 Frame = +2

Query  146  SQNELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS  325
            +Q E SEQWALACGEILR+LTHYNRP++KV   ++ +D++ +   A    +   G     
Sbjct  91   AQKEYSEQWALACGEILRVLTHYNRPIFKVADCNNRSDQATASCSAQEKANYSPGN----  146

Query  326  PQHERKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPSTASSRGSGK  502
             + ERKPLR LSPWITDILL APLGIRSDYFRWC GVMGKYAAG ELKPP+TA SRG+GK
Sbjct  147  -EPERKPLRPLSPWITDILLTAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGAGK  205

Query  503  HPQLIPSTPRWAVANGAGVILSVCDEEVARYETAT  607
            HPQL+PSTPRWAVANGAGVILSVCDEEVARYETA 
Sbjct  206  HPQLMPSTPRWAVANGAGVILSVCDEEVARYETAN  240



>gb|KJB59490.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1022

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +2

Query  233  VEKQDSEADRSNSGSHASTSKSADGGPSLLSP--QHERKPLRLLSPWITDILLAAPLGIR  406
            +E Q++E DRS+S S A+TS+S DG PS   P  Q ERKPLR LSPWITDILLAAPLGIR
Sbjct  1    MEPQNNETDRSHSSSQATTSESVDGEPSFQIPLMQQERKPLRPLSPWITDILLAAPLGIR  60

Query  407  SDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEV  586
            SDYFRWCSGVMGKYAAG+LKPP+TASSRGSGKHPQL+PSTPRWAVANGAGVILSVCDEEV
Sbjct  61   SDYFRWCSGVMGKYAAGDLKPPTTASSRGSGKHPQLMPSTPRWAVANGAGVILSVCDEEV  120

Query  587  ARYETATLTA  616
            ARYETA+LTA
Sbjct  121  ARYETASLTA  130



>gb|ACJ09481.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09482.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09478.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09484.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09485.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09486.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09487.1| putative gigantea, partial [Oryza sativa]
 gb|ACJ09489.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09490.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09491.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09492.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09493.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09480.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09479.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCEPMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09488.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEILR LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEILRALTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>gb|ACJ09483.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 7/140 (5%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S+ E SEQWALA
Sbjct  72   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTSEKEYSEQWALA  131

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHAST----SKSADGGPSLLSPQHERKPL  349
            CGEI R+LTHYNRP++KV+ Q SEA+ S++   AS+     K A+G P     + +RKPL
Sbjct  132  CGEIPRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSP---RNEPDRKPL  188

Query  350  RLLSPWITDILLAAPLGIRS  409
            R LSPWITDILLAAPLGIRS
Sbjct  189  RPLSPWITDILLAAPLGIRS  208



>dbj|BAI40156.1| gigantea-like protein [Diospyros kaki]
Length=102

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  161  SEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQHER  340
            SEQWALACGEILRILTHYNRP+YKVE+Q SEA+RS SGS A+TS S  G       QHE+
Sbjct  1    SEQWALACGEILRILTHYNRPIYKVERQQSEAERSESGSLATTSSSTAG-----DAQHEK  55

Query  341  KPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPS  475
            KPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAGELKPPS
Sbjct  56   KPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGELKPPS  100



>gb|AEK05888.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05908.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKP  346
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+SA+G  S +   Q ERKP
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSESAEGKSSSMPLXQQERKP  137



>gb|AEK05878.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05883.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05893.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05898.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05903.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05913.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05918.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKP  346
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+SA+G  S +   Q ERKP
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSESAEGKSSSMPLVQQERKP  137



>gb|AEK05858.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05863.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05868.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05873.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 1/116 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKP  346
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S +G  S +   Q ERKP
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDRSSSDSHATSSESVEGKSSSMPLVQQERKP  137



>gb|AEK26574.1| gigantea 5 [Populus tremula]
Length=138

 Score =   165 bits (418),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLS-PQHERKPL  349
            CGEILRILTHYNRP+YK E+Q++E DRS+S SHA++S+S +G  S +   Q ERKP 
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDRSSSESHATSSESTEGKSSSMPLVQQERKPF  138



>emb|CAB56058.1| gigantea homologue [Oryza sativa]
Length=975

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (95%), Gaps = 1/91 (1%)
 Frame = +2

Query  338  RKPLRLLSPWITDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPSTASSRGSGKHPQL  514
            RKPLR LSPWITDILLAAPLGIRSDYFRWC GVMGKYAAG ELKPP+TA SRGSGKHPQL
Sbjct  1    RKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGKHPQL  60

Query  515  IPSTPRWAVANGAGVILSVCDEEVARYETAT  607
            +PSTPRWAVANGAGVILSVCDEEVARYETA 
Sbjct  61   MPSTPRWAVANGAGVILSVCDEEVARYETAN  91



>gb|AEK05813.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05818.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05823.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05828.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05833.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05838.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05843.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05853.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADR  262
            CGEILRILTHYNRP+YK E+Q++E DR
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDR  108



>gb|AEK05848.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALA  181
            VLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE SEQWALA
Sbjct  22   VLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEYSEQWALA  81

Query  182  CGEILRILTHYNRPVYKVEKQDSEADR  262
            CGEILRILTHYNRP+YK E+Q++E DR
Sbjct  82   CGEILRILTHYNRPIYKREQQNNETDR  108



>gb|KGN44454.1| LATE BLOOMER 1 [Cucumis sativus]
Length=101

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +2

Query  152  NELSEQWALACGEILRILTHYNRPVYKVEKQDSEADRSNSGSHASTSKSADGGPSLLSPQ  331
            N+ SEQWALACGEILRILTHYNRP+YK+E+++ E +RS+SGS A+TS + D     +  Q
Sbjct  11   NDYSEQWALACGEILRILTHYNRPIYKMERKNGETERSSSGSRATTSDTDDRELVGVPQQ  70

Query  332  HERKPLRLLSPWITDILLAAPLGIRSDYFRW  424
             ERKP+R LSPWITDILLAAPLGIRSDYFRW
Sbjct  71   QERKPVRPLSPWITDILLAAPLGIRSDYFRW  101



>gb|KGN44455.1| hypothetical protein Csa_7G293730 [Cucumis sativus]
Length=284

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/65 (95%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +2

Query  422  WCSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYET  601
            WCSGVMGKYAAGEL+PP++ASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYET
Sbjct  119  WCSGVMGKYAAGELRPPTSASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYET  178

Query  602  ATLTA  616
            ATLTA
Sbjct  179  ATLTA  183



>ref|XP_004163795.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1016

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +2

Query  341  KPLRLLSPWITDILLAAP-LGIRSDYFRWCSGVMGKYAAGELKPPSTASSRGSGKHPQLI  517
            + + +L  ++ DI+L+   +       + CSGVMGKYAAGEL+PP++ASSRGSGKHPQLI
Sbjct  61   RKITVLIVYVDDIILSGDDIAEIIQLKKRCSGVMGKYAAGELRPPTSASSRGSGKHPQLI  120

Query  518  PSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            PSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  121  PSTPRWAVANGAGVILSVCDEEVARYETATLTA  153



>ref|XP_010062090.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
 ref|XP_010062091.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
Length=983

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  425  CSGVMGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETA  604
            C GVMGKYAAGELKPP T++SRGSGKHPQL+PSTPRWAVANGAGVILSVCDEEVARYETA
Sbjct  26   CGGVMGKYAAGELKPPITSTSRGSGKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETA  85

Query  605  TLTA  616
            TLTA
Sbjct  86   TLTA  89



>ref|XP_008461913.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cucumis melo]
Length=999

 Score = 97.8 bits (242),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  473  STASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            S ASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  58   SAASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  105


 Score = 51.2 bits (121),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  246  IVKQIEVTVAAMLQQVNLLMGALVCCLRNMRGNH*GCCLHGLLIYCWQHL*VLEVTTSGG  425
            +VKQ E  VAA+ +QV  ++G L+ CL N RGN    C  GLLIYC  H    EVT S  
Sbjct  1    MVKQKEAVVAALPRQVTPMIGNLLECLSNKRGNLYDLCPPGLLIYCLPHHWASEVTISAA  60



>ref|XP_009631436.1| PREDICTED: protein GIGANTEA-like isoform X7 [Nicotiana tomentosiformis]
Length=941

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/60 (97%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  437  MGKYAAGELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            MGKYAAGELKPPSTASS GSGKH QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  1    MGKYAAGELKPPSTASSHGSGKHHQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  60



>dbj|BAD68053.1| putative gigantea [Oryza sativa Japonica Group]
Length=261

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 1/60 (2%)
 Frame = +2

Query  437  MGKYAAG-ELKPPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLT  613
            MGKYAAG ELKPP+TA SRGSGKHPQL+PSTPRWAVANGAGVILSVCDEEVARYETA LT
Sbjct  1    MGKYAAGGELKPPTTAYSRGSGKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETANLT  60



>ref|XP_009631435.1| PREDICTED: protein GIGANTEA-like isoform X6 [Nicotiana tomentosiformis]
Length=945

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 58/64 (91%), Gaps = 4/64 (6%)
 Frame = +2

Query  437  MGKYAAGELKPPST----ASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETA  604
            MGKYAAGELKPPST    ASS GSGKH QLIPSTPRWAVANGAGVILSVCDEEVARYETA
Sbjct  1    MGKYAAGELKPPSTDFIVASSHGSGKHHQLIPSTPRWAVANGAGVILSVCDEEVARYETA  60

Query  605  TLTA  616
            TLTA
Sbjct  61   TLTA  64



>ref|XP_008461914.1| PREDICTED: protein GIGANTEA-like isoform X3 [Cucumis melo]
Length=954

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  473  STASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            S ASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  13   SIASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  60



>gb|ABV55998.1| gigantea1A, partial [Zea mays]
Length=335

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  467  PPSTASSRGSGKHPQLIPSTPRWAVANGAGVILSVCDEEVARYETA  604
            PP+TA SRGSGKHPQL+PSTPRWAVANGAGVILSVCDEEVARYETA
Sbjct  1    PPTTACSRGSGKHPQLMPSTPRWAVANGAGVILSVCDEEVARYETA  46



>gb|ADX35837.1| gigantea, partial [Brachypodium rupestre]
 gb|ADX35838.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35840.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35841.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35842.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35843.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35850.1| gigantea, partial [Brachypodium sylvaticum subsp. glaucovirens]
 gb|ADX35851.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35852.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35853.1| gigantea, partial [Brachypodium sylvaticum]
 gb|ADX35854.1| gigantea, partial [Brachypodium sylvaticum]
 gb|AFB78140.1| gigantea, partial [Brachypodium arbuscula]
 gb|AFB78141.1| gigantea, partial [Brachypodium arbuscula]
Length=110

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  55   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35845.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLA F+LHHPEHGHAV+HPI+SCIIDGTL YD++  PF SFISL    S+   SEQ
Sbjct  55   VLANFVLHHPEHGHAVVHPILSCIIDGTLSYDRHGSPFNSFISLFTQTSEKMYSEQ  110



>ref|XP_004173872.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=92

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCP  142
            VLA F+LHHPE+GHA+I PIISCI DG LEY++N PPFASFISL CP
Sbjct  43   VLALFVLHHPENGHAIILPIISCIFDGALEYNRNDPPFASFISLFCP  89



>gb|ADX35848.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35849.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  55   VLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35839.1| gigantea, partial [Brachypodium retusum]
 gb|AFB78143.1| gigantea, partial [Brachypodium boissieri]
 gb|AFB78144.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S+ E SEQ
Sbjct  55   VLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYSEQ  110



>gb|ADX35844.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  55   VLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35846.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35847.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLA F+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  55   VLANFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|AFB78142.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    VLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  169
            VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S+ E  EQ
Sbjct  55   VLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYLEQ  110



>gb|AEK26575.1| gigantea 5 [Populus tremula]
Length=110

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  509  QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  616
            QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  1    QLIPSTPRWAVANGAGVILSVCDEEVARYETATLTA  36



>gb|AEK05815.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05820.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05825.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05830.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05835.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05840.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05845.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05850.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05855.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05865.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05870.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05875.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05880.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05885.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05890.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05895.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05900.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05905.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05910.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05915.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05920.1| gigantea-5, partial [Populus balsamifera]
Length=97

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  530  RWAVANGAGVILSVCDEEVARYETATLTA  616
            RWAVANGAGVILSVCDEEVARYETATLTA
Sbjct  1    RWAVANGAGVILSVCDEEVARYETATLTA  29



>gb|AEK05860.1| gigantea-5, partial [Populus balsamifera]
Length=97

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  530  RWAVANGAGVILSVCDEEVARYETAT  607
            RWAVANGAGVILSVCDEEVARYETAT
Sbjct  1    RWAVANGAGVILSVCDEEVARYETAT  26



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090