BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS099G08

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764792.1|  PREDICTED: uncharacterized protein LOC104216...    315   3e-96   Nicotiana sylvestris
ref|XP_009764791.1|  PREDICTED: uncharacterized protein LOC104216...    315   4e-96   Nicotiana sylvestris
ref|XP_009764793.1|  PREDICTED: uncharacterized protein LOC104216...    314   5e-96   Nicotiana sylvestris
ref|XP_011097014.1|  PREDICTED: uncharacterized protein LOC105176035    310   2e-94   
ref|XP_009616232.1|  PREDICTED: uncharacterized protein LOC104108...    308   7e-94   Nicotiana tomentosiformis
ref|XP_009616231.1|  PREDICTED: uncharacterized protein LOC104108...    308   7e-94   Nicotiana tomentosiformis
ref|XP_009616230.1|  PREDICTED: uncharacterized protein LOC104108...    308   7e-94   Nicotiana tomentosiformis
gb|EYU33022.1|  hypothetical protein MIMGU_mgv1a000375mg                307   2e-93   Erythranthe guttata [common monkey flower]
ref|XP_006341624.1|  PREDICTED: uncharacterized protein LOC102599875    305   2e-92   Solanum tuberosum [potatoes]
ref|XP_010318603.1|  PREDICTED: uncharacterized protein LOC101262...    302   2e-91   Solanum lycopersicum
ref|XP_010318604.1|  PREDICTED: uncharacterized protein LOC101262...    302   2e-91   Solanum lycopersicum
ref|XP_010094783.1|  hypothetical protein L484_019994                   285   8e-90   
gb|AIG51125.1|  stomatal cytokinesis defective 1                        296   1e-89   Gossypium hirsutum [American cotton]
ref|XP_003532497.1|  PREDICTED: uncharacterized protein LOC100818...    294   8e-89   Glycine max [soybeans]
gb|KJB37240.1|  hypothetical protein B456_006G195200                    294   9e-89   Gossypium raimondii
gb|KJB37239.1|  hypothetical protein B456_006G195200                    293   1e-88   Gossypium raimondii
ref|XP_002322040.1|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    293   2e-88   
emb|CAN64735.1|  hypothetical protein VITISV_022618                     276   2e-88   Vitis vinifera
gb|KDP20097.1|  hypothetical protein JCGZ_05866                         292   4e-88   Jatropha curcas
ref|XP_004512863.1|  PREDICTED: uncharacterized protein LOC101507...    292   4e-88   Cicer arietinum [garbanzo]
ref|XP_011011804.1|  PREDICTED: uncharacterized protein LOC105116...    292   4e-88   Populus euphratica
ref|XP_004512862.1|  PREDICTED: uncharacterized protein LOC101507...    292   5e-88   Cicer arietinum [garbanzo]
ref|XP_011011805.1|  PREDICTED: uncharacterized protein LOC105116...    292   6e-88   Populus euphratica
ref|XP_003634188.1|  PREDICTED: uncharacterized protein LOC100254...    292   6e-88   Vitis vinifera
ref|XP_011011807.1|  PREDICTED: uncharacterized protein LOC105116...    292   6e-88   Populus euphratica
emb|CBI15432.3|  unnamed protein product                                291   8e-88   Vitis vinifera
ref|XP_002511967.1|  F-box and wd40 domain protein, putative            289   6e-87   
gb|EPS64327.1|  hypothetical protein M569_10454                         285   7e-87   Genlisea aurea
ref|XP_011009995.1|  PREDICTED: uncharacterized protein LOC105114...    285   2e-85   Populus euphratica
gb|KDO41981.1|  hypothetical protein CISIN_1g0010392mg                  275   3e-85   Citrus sinensis [apfelsine]
gb|KJB37236.1|  hypothetical protein B456_006G195200                    280   4e-85   Gossypium raimondii
ref|XP_007160364.1|  hypothetical protein PHAVU_002G3153000g            275   2e-84   Phaseolus vulgaris [French bean]
ref|XP_007036483.1|  Stomatal cytokinesis defective / SCD1 protei...    281   2e-84   
ref|XP_010265188.1|  PREDICTED: uncharacterized protein LOC104602...    281   3e-84   Nelumbo nucifera [Indian lotus]
emb|CDO98446.1|  unnamed protein product                                281   3e-84   Coffea canephora [robusta coffee]
ref|XP_007036482.1|  Stomatal cytokinesis defective / SCD1 protei...    281   4e-84   
gb|KJB37238.1|  hypothetical protein B456_006G195200                    280   5e-84   Gossypium raimondii
gb|KJB37237.1|  hypothetical protein B456_006G195200                    281   5e-84   Gossypium raimondii
ref|XP_011465682.1|  PREDICTED: DENN domain and WD repeat-contain...    280   7e-84   Fragaria vesca subsp. vesca
ref|XP_010943311.1|  PREDICTED: uncharacterized protein LOC105061...    280   1e-83   Elaeis guineensis
ref|XP_008797769.1|  PREDICTED: uncharacterized protein LOC103712...    279   2e-83   Phoenix dactylifera
ref|XP_010943385.1|  PREDICTED: uncharacterized protein LOC105061...    279   2e-83   
ref|XP_008797770.1|  PREDICTED: uncharacterized protein LOC103712...    279   2e-83   
ref|XP_010549132.1|  PREDICTED: uncharacterized protein LOC104820400    278   3e-83   Tarenaya hassleriana [spider flower]
gb|KEH21369.1|  stomatal cytokinesis defective protein, putative        278   3e-83   Medicago truncatula
ref|XP_002317936.2|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    276   2e-82   
ref|XP_006485772.1|  PREDICTED: uncharacterized protein LOC102621...    276   3e-82   Citrus sinensis [apfelsine]
ref|XP_004137469.1|  PREDICTED: uncharacterized protein LOC101212131    274   1e-81   
gb|KGN64112.1|  hypothetical protein Csa_1G042240                       274   1e-81   Cucumis sativus [cucumbers]
ref|XP_008244009.1|  PREDICTED: uncharacterized protein LOC103342...    274   1e-81   Prunus mume [ume]
ref|XP_008244008.1|  PREDICTED: uncharacterized protein LOC103342...    274   1e-81   Prunus mume [ume]
ref|XP_009383583.1|  PREDICTED: uncharacterized protein LOC103971285    273   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009337275.1|  PREDICTED: myotubularin-related protein 13-like    273   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_009337189.1|  PREDICTED: myotubularin-related protein 13-like    273   4e-81   Pyrus x bretschneideri [bai li]
ref|XP_008457689.1|  PREDICTED: uncharacterized protein LOC103497299    272   4e-81   Cucumis melo [Oriental melon]
ref|XP_008393296.1|  PREDICTED: uncharacterized protein LOC103455486    272   6e-81   
ref|XP_006440944.1|  hypothetical protein CICLE_v10018557mg             271   9e-81   Citrus clementina [clementine]
ref|XP_011072936.1|  PREDICTED: uncharacterized protein LOC105158031    270   4e-80   Sesamum indicum [beniseed]
ref|XP_010677974.1|  PREDICTED: uncharacterized protein LOC104893555    269   9e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009346964.1|  PREDICTED: LOW QUALITY PROTEIN: myotubularin...    267   4e-79   
ref|XP_006837773.1|  hypothetical protein AMTR_s00104p00054580          266   9e-79   
ref|XP_010031872.1|  PREDICTED: uncharacterized protein LOC104421573    265   2e-78   Eucalyptus grandis [rose gum]
gb|EEE54850.1|  hypothetical protein OsJ_02315                          264   3e-78   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043390.1|  Os01g0575500                                       264   4e-78   
ref|XP_010231941.1|  PREDICTED: uncharacterized protein LOC100845189    263   7e-78   Brachypodium distachyon [annual false brome]
ref|XP_008672456.1|  PREDICTED: uncharacterized protein LOC100273...    263   8e-78   Zea mays [maize]
ref|XP_008672455.1|  PREDICTED: uncharacterized protein LOC100273...    263   1e-77   
ref|XP_007210443.1|  hypothetical protein PRUPE_ppa000437m1g            261   1e-77   
emb|CDY48589.1|  BnaCnng16480D                                          260   1e-76   Brassica napus [oilseed rape]
ref|XP_004969033.1|  PREDICTED: uncharacterized protein LOC101781233    258   4e-76   Setaria italica
gb|AGG55718.1|  stomatal cytokinesis defective 1                        258   7e-76   Gossypium arboreum [tree cotton]
ref|XP_009147917.1|  PREDICTED: myotubularin-related protein 13 i...    258   7e-76   Brassica rapa
emb|CDM83276.1|  unnamed protein product                                258   9e-76   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006393316.1|  hypothetical protein EUTSA_v10011186mg             257   1e-75   
tpg|DAA58649.1|  TPA: hypothetical protein ZEAMMB73_444537              251   4e-75   
ref|XP_010479332.1|  PREDICTED: myotubularin-related protein 13-like    256   4e-75   Camelina sativa [gold-of-pleasure]
ref|NP_001185177.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1           254   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175333.3|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              253   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461711.1|  PREDICTED: myotubularin-related protein 13-l...    255   8e-75   
ref|XP_010500445.1|  PREDICTED: myotubularin-related protein 13-like    255   8e-75   Camelina sativa [gold-of-pleasure]
gb|KFK36043.1|  hypothetical protein AALP_AA4G070500                    254   1e-74   Arabis alpina [alpine rockcress]
ref|NP_850959.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              254   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646026.1|  PREDICTED: uncharacterized protein LOC102710652    254   2e-74   
ref|XP_002894154.1|  stomatal cytokinesis-defective 1                   253   2e-74   
ref|XP_006306610.1|  hypothetical protein CARUB_v10008124mg             251   2e-73   Capsella rubella
gb|EEC70939.1|  hypothetical protein OsI_02530                          249   6e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_009147918.1|  PREDICTED: DENN domain-containing protein 4B...    246   2e-72   Brassica rapa
ref|XP_010265189.1|  PREDICTED: uncharacterized protein LOC104602...    246   8e-72   Nelumbo nucifera [Indian lotus]
gb|AAF69702.1|AC016041_7  F27J15.16                                     240   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989051.1|  hypothetical protein SELMODRAFT_129087             235   1e-67   
ref|XP_002983722.1|  hypothetical protein SELMODRAFT_118822             234   3e-67   
emb|CDY48854.1|  BnaA06g03280D                                          203   1e-62   Brassica napus [oilseed rape]
ref|XP_010677977.1|  PREDICTED: myotubularin-related protein 13-l...    208   4e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677975.1|  PREDICTED: uncharacterized protein LOC104893...    208   4e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677976.1|  PREDICTED: uncharacterized protein LOC104893...    208   4e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001752748.1|  predicted protein                                  189   2e-51   
gb|EMT33100.1|  hypothetical protein F775_01878                         150   4e-41   
ref|XP_008349874.1|  PREDICTED: uncharacterized protein LOC103413159    146   8e-41   
ref|XP_011470710.1|  PREDICTED: DENN domain and WD repeat-contain...    141   5e-36   Fragaria vesca subsp. vesca
emb|CDX98751.1|  BnaA03g45360D                                          127   5e-32   
emb|CDY28853.1|  BnaC06g26410D                                          113   5e-26   Brassica napus [oilseed rape]
ref|XP_008351915.1|  PREDICTED: uncharacterized protein LOC103415353    105   5e-25   
ref|XP_008356651.1|  PREDICTED: uncharacterized protein LOC103420...    105   6e-25   
ref|XP_008356653.1|  PREDICTED: uncharacterized protein LOC103420...    103   8e-25   
gb|EMS55158.1|  hypothetical protein TRIUR3_14216                       107   3e-24   Triticum urartu
emb|CDY72592.1|  BnaAnng41570D                                          102   8e-23   Brassica napus [oilseed rape]
gb|KIY96716.1|  hypothetical protein MNEG_11246                       90.9    2e-18   Monoraphidium neglectum
ref|XP_006485773.1|  PREDICTED: uncharacterized protein LOC102621...  78.2    1e-15   
ref|XP_002507362.1|  predicted protein                                71.2    9e-11   Micromonas commoda
ref|XP_001415729.1|  predicted protein                                63.2    3e-08   Ostreococcus lucimarinus CCE9901
ref|XP_005838612.1|  hypothetical protein GUITHDRAFT_134523           55.5    1e-05   Guillardia theta CCMP2712
ref|XP_003074105.1|  RAS signaling inhibitor ST5 (ISS)                53.9    3e-05   
emb|CEF96494.1|  WD40/YVTN repeat-like-containing domain              53.9    3e-05   Ostreococcus tauri
ref|XP_004212516.1|  PREDICTED: myotubularin-related protein 13-like  52.0    3e-05   Hydra vulgaris
ref|XP_002951775.1|  hypothetical protein VOLCADRAFT_92266            48.9    2e-04   Volvox carteri f. nagariensis
ref|XP_001692620.1|  predicted protein                                50.4    3e-04   Chlamydomonas reinhardtii
ref|XP_001033500.2|  hypothetical protein TTHERM_00313190             50.8    4e-04   
gb|EAR85837.3|  DENN (AEX-3) domain protein                           50.8    4e-04   Tetrahymena thermophila SB210



>ref|XP_009764792.1| PREDICTED: uncharacterized protein LOC104216452 isoform X2 [Nicotiana 
sylvestris]
Length=1213

 Score =   315 bits (807),  Expect = 3e-96, Method: Composition-based stats.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_009764791.1| PREDICTED: uncharacterized protein LOC104216452 isoform X1 [Nicotiana 
sylvestris]
Length=1215

 Score =   315 bits (806),  Expect = 4e-96, Method: Composition-based stats.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_009764793.1| PREDICTED: uncharacterized protein LOC104216452 isoform X3 [Nicotiana 
sylvestris]
Length=1205

 Score =   314 bits (805),  Expect = 5e-96, Method: Composition-based stats.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_011097014.1| PREDICTED: uncharacterized protein LOC105176035 [Sesamum indicum]
Length=1205

 Score =   310 bits (793),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+GTGIMYL SLLDQYP  NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGTGIMYLPSLLDQYPSSNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FY SGFDS++PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVQFYASGFDSSDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICL+SR+PSF ILR+ALEEIF LCFS+SGSSKPLWDVIAY++SNVPLP PG
Sbjct  121  SFADKCICLISRAPSFSILRDALEEIFLLCFSTSGSSKPLWDVIAYLISNVPLPTPG  177



>ref|XP_009616232.1| PREDICTED: uncharacterized protein LOC104108811 isoform X3 [Nicotiana 
tomentosiformis]
Length=1205

 Score =   308 bits (790),  Expect = 7e-94, Method: Composition-based stats.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPIPG  177



>ref|XP_009616231.1| PREDICTED: uncharacterized protein LOC104108811 isoform X2 [Nicotiana 
tomentosiformis]
Length=1213

 Score =   308 bits (790),  Expect = 7e-94, Method: Composition-based stats.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPIPG  177



>ref|XP_009616230.1| PREDICTED: uncharacterized protein LOC104108811 isoform X1 [Nicotiana 
tomentosiformis]
Length=1215

 Score =   308 bits (790),  Expect = 7e-94, Method: Composition-based stats.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFGILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPIPG  177



>gb|EYU33022.1| hypothetical protein MIMGU_mgv1a000375mg [Erythranthe guttata]
Length=1207

 Score =   307 bits (786),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G RG++GTGIMYL+SLLDQYP LNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGFHGTGIMYLSSLLDQYPSLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FY SGFDS +PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN
Sbjct  61   LPAGVQFYASGFDSTDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC VSR+PSF ILR+ALEEIF LCFS +GSSKPLWDVIAY+VSNVPLP PG
Sbjct  121  SFADKCICFVSRAPSFGILRDALEEIFLLCFSKTGSSKPLWDVIAYLVSNVPLPTPG  177



>ref|XP_006341624.1| PREDICTED: uncharacterized protein LOC102599875 [Solanum tuberosum]
Length=1215

 Score =   305 bits (780),  Expect = 2e-92, Method: Composition-based stats.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPVN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCIC+VSRSPSF+ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICIVSRSPSFQILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_010318603.1| PREDICTED: uncharacterized protein LOC101262196 isoform X1 [Solanum 
lycopersicum]
Length=1215

 Score =   302 bits (773),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY IP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYCIPVN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF+ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFQILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_010318604.1| PREDICTED: uncharacterized protein LOC101262196 isoform X2 [Solanum 
lycopersicum]
Length=1212

 Score =   302 bits (773),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY IP N
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYCIPVN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF+ILR+ALEEIF LCFSSSGSSKPLWDVIAY VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFQILRDALEEIFVLCFSSSGSSKPLWDVIAYSVSNVPLPTPG  177



>ref|XP_010094783.1| hypothetical protein L484_019994 [Morus notabilis]
 gb|EXB56948.1| hypothetical protein L484_019994 [Morus notabilis]
Length=526

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G +G++GTGIMYL SLLDQYPPLNHSLYPPPPPQL TCV
Sbjct  1    MAPIFEYFVVCGIGPEIRTLDGNKGFHGTGIMYLPSLLDQYPPLNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYP GFDS++  TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVEFYPLGFDSSDALTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYHIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR ALEE+F LCFS SGSSKPLWD+IAY+VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFRVLRNALEELFALCFSESGSSKPLWDIIAYLVSNVPLPTPG  177



>gb|AIG51125.1| stomatal cytokinesis defective 1 [Gossypium hirsutum]
Length=1135

 Score =   296 bits (758),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHIVSNVPLPTPG  177



>ref|XP_003532497.1| PREDICTED: uncharacterized protein LOC100818305 isoform X1 [Glycine 
max]
 gb|KHN16584.1| DENN domain-containing protein 5B [Glycine soja]
Length=1208

 Score =   294 bits (753),  Expect = 8e-89, Method: Composition-based stats.
 Identities = 145/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M+ IFEYFVVCGIGPEIRT++G +GY+GTG +YL SLLDQYPP NH+LYP PPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRTMDGNKGYHGTGCLYLPSLLDQYPPPNHTLYPSPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+P++FP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFYSSGFDSNDPASFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSR PSFR+L+ ALEEIF LCFS +GSSKPLWDVIA++VS+VPLP PG
Sbjct  121  SYADKCICLVSRLPSFRVLKSALEEIFALCFSPNGSSKPLWDVIAHMVSSVPLPTPG  177



>gb|KJB37240.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1199

 Score =   294 bits (753),  Expect = 9e-89, Method: Composition-based stats.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>gb|KJB37239.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1191

 Score =   293 bits (751),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>ref|XP_002322040.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEF06167.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   293 bits (751),  Expect = 2e-88, Method: Composition-based stats.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MAGIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYPSG D+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGLDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSF +LR ALEE+F LCFS +GSSKPLWDVI+Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFGVLRTALEELFALCFSPAGSSKPLWDVISYMVSNVPLPTPG  177



>emb|CAN64735.1| hypothetical protein VITISV_022618 [Vitis vinifera]
Length=371

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYLASLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLASLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSR PSF +LR ALEE+F LCFS +GSSKPLWDVI Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSRLPSFCMLRNALEELFALCFSPTGSSKPLWDVIEYMVSNVPLPTPG  177



>gb|KDP20097.1| hypothetical protein JCGZ_05866 [Jatropha curcas]
Length=1205

 Score =   292 bits (748),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 148/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+G  +MYL SLLDQYPP  H+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGNKGYHGKEVMYLPSLLDQYPPDYHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFD+N+ STFP+SYPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVLFYSSGFDANDASTFPRSYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSF ILR ALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFGILRNALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>ref|XP_004512863.1| PREDICTED: uncharacterized protein LOC101507359 isoform X2 [Cicer 
arietinum]
Length=1210

 Score =   292 bits (748),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF +LR ALEE+F LCFS +GSSKPLWD+IA++VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFSVLRSALEELFALCFSPNGSSKPLWDIIAHMVSNVPLPTPG  177



>ref|XP_011011804.1| PREDICTED: uncharacterized protein LOC105116250 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   292 bits (748),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVS SPSF +LR ALEE+F LCFS +GSSKPLWDVI+Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSHSPSFGVLRTALEELFALCFSPAGSSKPLWDVISYMVSNVPLPTPG  177



>ref|XP_004512862.1| PREDICTED: uncharacterized protein LOC101507359 isoform X1 [Cicer 
arietinum]
Length=1211

 Score =   292 bits (747),  Expect = 5e-88, Method: Composition-based stats.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAYRI AN
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAYRIQAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSPSF +LR ALEE+F LCFS +GSSKPLWD+IA++VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPSFSVLRSALEELFALCFSPNGSSKPLWDIIAHMVSNVPLPTPG  177



>ref|XP_011011805.1| PREDICTED: uncharacterized protein LOC105116250 isoform X2 [Populus 
euphratica]
Length=1206

 Score =   292 bits (747),  Expect = 6e-88, Method: Composition-based stats.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVS SPSF +LR ALEE+F LCFS +GSSKPLWDVI+Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSHSPSFGVLRTALEELFALCFSPAGSSKPLWDVISYMVSNVPLPTPG  177



>ref|XP_003634188.1| PREDICTED: uncharacterized protein LOC100254135 isoform X1 [Vitis 
vinifera]
Length=1215

 Score =   292 bits (747),  Expect = 6e-88, Method: Composition-based stats.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSR PSF +LR ALEE+F LCFS +GSSKPLWDVI Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSRLPSFCMLRNALEELFALCFSPTGSSKPLWDVIEYMVSNVPLPTPG  177



>ref|XP_011011807.1| PREDICTED: uncharacterized protein LOC105116251 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   292 bits (747),  Expect = 6e-88, Method: Composition-based stats.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVS SPSF +LR ALEE+F LCFS +GSSKPLWDVI+Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSHSPSFGVLRTALEELFALCFSPAGSSKPLWDVISYMVSNVPLPTPG  177



>emb|CBI15432.3| unnamed protein product [Vitis vinifera]
Length=1254

 Score =   291 bits (746),  Expect = 8e-88, Method: Composition-based stats.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSR PSF +LR ALEE+F LCFS +GSSKPLWDVI Y+VSNVPLP PG
Sbjct  121  SFADKCICLVSRLPSFCMLRNALEELFALCFSPTGSSKPLWDVIEYMVSNVPLPTPG  177



>ref|XP_002511967.1| F-box and wd40 domain protein, putative [Ricinus communis]
 gb|EEF50636.1| F-box and wd40 domain protein, putative [Ricinus communis]
Length=1204

 Score =   289 bits (739),  Expect = 6e-87, Method: Composition-based stats.
 Identities = 142/177 (80%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+G E+RTL+G +GY+G G+MYLASLLDQYPP NH   PPP     TCV
Sbjct  1    MARIFEYFVVCGLGAELRTLDGNKGYHGRGVMYLASLLDQYPPDNHHSPPPPQL--PTCV  58

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFD+N+ S+FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  59   LPAGVEFYSSGFDANDASSFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  118

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSF +LR ALEEIF LCFS SGSSKPLWDVIAY++SNVPLP  G
Sbjct  119  SFADKCICLVSRSPSFSVLRNALEEIFALCFSPSGSSKPLWDVIAYMISNVPLPTAG  175



>gb|EPS64327.1| hypothetical protein M569_10454 [Genlisea aurea]
Length=885

 Score =   285 bits (730),  Expect = 7e-87, Method: Composition-based stats.
 Identities = 139/177 (79%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCGIGP+IRTL+G RGY+GT  +YL S+LDQYP  N+SLYPPPPPQL TC+
Sbjct  1    MPQIFEYFVVCGIGPDIRTLDGSRGYHGTSTVYLPSVLDQYPASNNSLYPPPPPQLPTCI  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAG++FY SG+DSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPVC+DI EAYRIP +
Sbjct  61   LPAGIQFYSSGYDSNDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCQDICEAYRIPGH  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            +FADKCICLVSRSPSFR LREALEEIF LCFS++GSSKPLW+V++++VSNVPLP PG
Sbjct  121  TFADKCICLVSRSPSFRTLREALEEIFKLCFSATGSSKPLWEVVSFLVSNVPLPIPG  177



>ref|XP_011009995.1| PREDICTED: uncharacterized protein LOC105114954 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   285 bits (728),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  +FEYFVVCG+GPEIRT++G +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEIRTVDGNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFYPSGFD+N+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVEFYPSGFDANDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSF +LR ALEE+F LCFS +GSSKPLW+VI++++SNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFGVLRNALEELFALCFSPAGSSKPLWEVISHMISNVPLPTPG  177



>gb|KDO41981.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
 gb|KDO41982.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
Length=583

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFRILR ALEEI++LCF S GSSKPLWDVI+++VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFRILRNALEEIYSLCFLSDGSSKPLWDVISHLVSNVPLPTPG  177



>gb|KJB37236.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=838

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>ref|XP_007160364.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
 gb|ESW32358.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
Length=690

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M+ +FEYFVVCGIGPEIRT++G +GY+G G MYL SLLDQYPP NH+LYPPPPPQLSTCV
Sbjct  1    MSRMFEYFVVCGIGPEIRTIDGSKGYHGPGWMYLPSLLDQYPPPNHALYPPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PS+FP+SYPIVLTEGDGSKIYVSCI+FRD VCEDIAEAYRI AN
Sbjct  61   LPAGVEFYSSGFDSNDPSSFPRSYPIVLTEGDGSKIYVSCISFRDLVCEDIAEAYRIQAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSR PSF ILR ALEEIFTLCFSS GSSKPLWDVIA++VS+VPLP PG
Sbjct  121  SYADKCICLVSRLPSFSILRSALEEIFTLCFSSKGSSKPLWDVIAHMVSSVPLPTPG  177



>ref|XP_007036483.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
 gb|EOY20984.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
Length=1035

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPTN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSP FR+LR+ALEE+F LCFS  GSSKPLWD+IAY+VS VPLP PG
Sbjct  121  SFADKCICLVSRSPCFRVLRDALEELFALCFSPIGSSKPLWDIIAYMVSKVPLPTPG  177



>ref|XP_010265188.1| PREDICTED: uncharacterized protein LOC104602996 isoform X1 [Nelumbo 
nucifera]
Length=1209

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAYRIPAN
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR+ALEE+F LCFS  GSSKPLWD+IAY+VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRVLRDALEELFALCFSPDGSSKPLWDIIAYIVSGVPLPTPG  177



>emb|CDO98446.1| unnamed protein product [Coffea canephora]
Length=1209

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCGIGPEIRTL+G+RGY+G+  +YL SLLDQYPP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGIGPEIRTLDGERGYHGSEFIYLPSLLDQYPPTDHTLYPPPPPQLPTCVLPA  64

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV+F+ SGFDS +PSTFP++YPIVLTEGDGSKIYVSCIAFRDPVCEDI EAYRI ANSFA
Sbjct  65   GVQFHASGFDSKDPSTFPRNYPIVLTEGDGSKIYVSCIAFRDPVCEDIVEAYRIAANSFA  124

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVSRSPSF ILR+ALEEIF LCFSSSGSSKPLWDVIAY+VS+VPLP PG
Sbjct  125  DKCICLVSRSPSFHILRDALEEIFLLCFSSSGSSKPLWDVIAYLVSSVPLPTPG  178



>ref|XP_007036482.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
 gb|EOY20983.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
Length=1201

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPTN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSP FR+LR+ALEE+F LCFS  GSSKPLWD+IAY+VS VPLP PG
Sbjct  121  SFADKCICLVSRSPCFRVLRDALEELFALCFSPIGSSKPLWDIIAYMVSKVPLPTPG  177



>gb|KJB37238.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1129

 Score =   280 bits (717),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>gb|KJB37237.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1197

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGSSKPLWDVIA++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSSKPLWDVIAHMVSNVPLPTPG  177



>ref|XP_011465682.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1 
[Fragaria vesca subsp. vesca]
Length=1157

 Score =   280 bits (716),  Expect = 7e-84, Method: Composition-based stats.
 Identities = 142/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL SLLDQ+PP NH+LYPPPPPQL TCV
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPSLLDQFPPANHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFD+N+ +TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVSFYSSGFDANDATTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFA+KCICLVSRSPS R+L+  LEE+F LCFSSSGSSKPLWD+IA +VSNVPLP PG
Sbjct  121  SFAEKCICLVSRSPSLRLLKNVLEELFALCFSSSGSSKPLWDIIASMVSNVPLPTPG  177



>ref|XP_010943311.1| PREDICTED: uncharacterized protein LOC105061043 isoform X1 [Elaeis 
guineensis]
Length=1211

 Score =   280 bits (715),  Expect = 1e-83, Method: Composition-based stats.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY++P NS A
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYQVPTNSSA  125

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF+ LR+ALEE+F LCFS +G SK LW++IAY+VSNVPLP PG
Sbjct  126  DKCICLVSHSPSFQALRDALEELFVLCFSQAGCSKALWEIIAYMVSNVPLPTPG  179



>ref|XP_008797769.1| PREDICTED: uncharacterized protein LOC103712861 isoform X1 [Phoenix 
dactylifera]
Length=1211

 Score =   279 bits (714),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA++IPA SFA
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAHQIPATSFA  125

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF+ LR+ALEE+F LCFS +G SKPLW+VIAY+VSNVPLP PG
Sbjct  126  DKCICLVSHSPSFQALRDALEELFILCFSHAGCSKPLWEVIAYMVSNVPLPTPG  179



>ref|XP_010943385.1| PREDICTED: uncharacterized protein LOC105061043 isoform X2 [Elaeis 
guineensis]
Length=1194

 Score =   279 bits (714),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY++P NS A
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYQVPTNSSA  125

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF+ LR+ALEE+F LCFS +G SK LW++IAY+VSNVPLP PG
Sbjct  126  DKCICLVSHSPSFQALRDALEELFVLCFSQAGCSKALWEIIAYMVSNVPLPTPG  179



>ref|XP_008797770.1| PREDICTED: uncharacterized protein LOC103712861 isoform X2 [Phoenix 
dactylifera]
Length=1189

 Score =   279 bits (713),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA++IPA SFA
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAHQIPATSFA  125

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF+ LR+ALEE+F LCFS +G SKPLW+VIAY+VSNVPLP PG
Sbjct  126  DKCICLVSHSPSFQALRDALEELFILCFSHAGCSKPLWEVIAYMVSNVPLPTPG  179



>ref|XP_010549132.1| PREDICTED: uncharacterized protein LOC104820400 [Tarenaya hassleriana]
Length=1186

 Score =   278 bits (712),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPEIRTL+G  G++GT  +YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTLDGDIGFHGTQTLYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGFDS++P++FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDI EAYR+P  
Sbjct  61   LPAGVEFHSSGFDSSDPASFPRSYPIVLTEGDGSKIYVSCIAFRDPVAEDIIEAYRLPPK  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
             +ADKCICLVS SPSFRILR ALEEIF LCFSS GSSKPLWDVIAY+VSNVPLP PG
Sbjct  121  VYADKCICLVSHSPSFRILRNALEEIFALCFSSEGSSKPLWDVIAYMVSNVPLPTPG  177



>gb|KEH21369.1| stomatal cytokinesis defective protein, putative [Medicago truncatula]
Length=1209

 Score =   278 bits (712),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M+ IFEYFVVCGIGPEIR+++G +GY+G G MYL SLLDQ+PP  HSLYPPPPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGNKGYHGPGWMYLPSLLDQFPPSTHSLYPPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRD VCED+ EAYRI  N
Sbjct  61   LPAGVEFHASGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDHVCEDVIEAYRIQGN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVSRSP F +LR  LEE+F LCFS +GSSKPLWD+IA+ VSNVPLP PG
Sbjct  121  SYADKCICLVSRSPCFSVLRSTLEELFVLCFSPTGSSKPLWDIIAHTVSNVPLPTPG  177



>ref|XP_002317936.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEE96156.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   276 bits (707),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 137/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  +FEYFVVCG+GPE+RT++  +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEMRTVDRNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FYPSGFD+++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYPSGFDADDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSF +LR ALEE+F LCFS +GSSKPLW+VI++++SNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFGVLRNALEELFALCFSPAGSSKPLWEVISHMISNVPLPTPG  177



>ref|XP_006485772.1| PREDICTED: uncharacterized protein LOC102621506 isoform X1 [Citrus 
sinensis]
Length=1206

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFRILR ALEEI++LCF S GSSKPLWDVI+++VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFRILRNALEEIYSLCFLSDGSSKPLWDVISHLVSNVPLPTPG  177



>ref|XP_004137469.1| PREDICTED: uncharacterized protein LOC101212131 [Cucumis sativus]
 ref|XP_004157419.1| PREDICTED: uncharacterized LOC101212131 [Cucumis sativus]
Length=1212

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCIC+VSRSPSFR+L++ALEE+F LCFSSSGSSKPLWD+IA++VSNVPL  PG
Sbjct  121  SYADKCICIVSRSPSFRVLKDALEELFALCFSSSGSSKPLWDIIAHIVSNVPLSTPG  177



>gb|KGN64112.1| hypothetical protein Csa_1G042240 [Cucumis sativus]
Length=1209

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCIC+VSRSPSFR+L++ALEE+F LCFSSSGSSKPLWD+IA++VSNVPL  PG
Sbjct  121  SYADKCICIVSRSPSFRVLKDALEELFALCFSSSGSSKPLWDIIAHIVSNVPLSTPG  177



>ref|XP_008244009.1| PREDICTED: uncharacterized protein LOC103342183 isoform X2 [Prunus 
mume]
Length=1193

 Score =   274 bits (700),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR  LEE+FTLCFS  GSSKPLWDVIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLRNTLEELFTLCFSPGGSSKPLWDVIASLVSTVPLPTPG  177



>ref|XP_008244008.1| PREDICTED: uncharacterized protein LOC103342183 isoform X1 [Prunus 
mume]
Length=1207

 Score =   274 bits (700),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR  LEE+FTLCFS  GSSKPLWDVIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLRNTLEELFTLCFSPGGSSKPLWDVIASLVSTVPLPTPG  177



>ref|XP_009383583.1| PREDICTED: uncharacterized protein LOC103971285 [Musa acuminata 
subsp. malaccensis]
Length=1211

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +2

Query  86   AMAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  265
            A + IFEYFVVCGIGPEIRTLEG +G+ G  +MY+ SLLDQYPP NHSLYPPPPPQL TC
Sbjct  4    ASSRIFEYFVVCGIGPEIRTLEGNKGFQGMEVMYMPSLLDQYPPSNHSLYPPPPPQLPTC  63

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            VLPAGVEFY SGF+S++ +T+P+SYPIVLTEGDGSKIYV+CIAFRDPVCEDI EAY+IPA
Sbjct  64   VLPAGVEFYSSGFNSDDVTTYPRSYPIVLTEGDGSKIYVACIAFRDPVCEDIIEAYQIPA  123

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NSFADKCIC+VSRSPSF++L++ALEE+F LCFS +GSSKPLWDVIAY+VSNVPLP PG
Sbjct  124  NSFADKCICVVSRSPSFQVLKDALEELFILCFSPAGSSKPLWDVIAYMVSNVPLPTPG  181



>ref|XP_009337275.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1207

 Score =   273 bits (697),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+L+ ALEE+F LCFS +GSSKPLW+VIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLKNALEELFALCFSPNGSSKPLWEVIASLVSTVPLPTPG  177



>ref|XP_009337189.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1208

 Score =   273 bits (697),  Expect = 4e-81, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+L+ ALEE+F LCFS +GSSKPLW+VIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLKNALEELFALCFSPNGSSKPLWEVIASLVSTVPLPTPG  177



>ref|XP_008457689.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
 ref|XP_008457770.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
Length=1209

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S   PPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCSPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGFDS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP N
Sbjct  61   LPAGVEFFSSGFDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCIC+VSRSPSFR+L++ALEE+F LCFS+SGSSKPLWD+IA++VSNVPL  PG
Sbjct  121  SYADKCICIVSRSPSFRVLKDALEELFALCFSNSGSSKPLWDIIAHIVSNVPLSTPG  177



>ref|XP_008393296.1| PREDICTED: uncharacterized protein LOC103455486 [Malus domestica]
Length=1208

 Score =   272 bits (695),  Expect = 6e-81, Method: Composition-based stats.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV ED+AEAY IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDVAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+L+ ALEE+FTLCFS +GSSKPLW+VIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLKNALEELFTLCFSPNGSSKPLWEVIASLVSTVPLPTPG  177



>ref|XP_006440944.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
 gb|ESR54184.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
Length=1206

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLYP PPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYPHPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAYRIPAN
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR  LEEI++LCF S GSS PLWDVI+++VSNVPLP PG
Sbjct  121  SFADKCICLVSRSPSFRVLRNVLEEIYSLCFLSDGSSTPLWDVISHLVSNVPLPTPG  177



>ref|XP_011072936.1| PREDICTED: uncharacterized protein LOC105158031 [Sesamum indicum]
Length=1198

 Score =   270 bits (689),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCGIGPEIRTL+G RGY+GT  MYL +LLDQYP  N+SLYPPPPPQLSTCV
Sbjct  1    MPQIFEYFVVCGIGPEIRTLDGSRGYHGTDTMYLPALLDQYPHSNNSLYPPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV+F+ SG DSN+ ++FP+SYPIVLTEGDGSKIYVSCIAFRD VCEDIAEAYRIPA+
Sbjct  61   LPAGVQFHSSGCDSNDLTSFPRSYPIVLTEGDGSKIYVSCIAFRDRVCEDIAEAYRIPAD  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFRILREALEEI+ LCF++SGSS+PLW+VI++V+S V LP PG
Sbjct  121  SFADKCICLVSRSPSFRILREALEEIYILCFATSGSSRPLWEVISFVISKVSLPAPG  177



>ref|XP_010677974.1| PREDICTED: uncharacterized protein LOC104893555 [Beta vulgaris 
subsp. vulgaris]
Length=1198

 Score =   269 bits (687),  Expect = 9e-80, Method: Composition-based stats.
 Identities = 136/178 (76%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-C  265
            MA IFEYF+VCGIGPEIRTL+G +G+ GT   YL SLLDQYPP N SL PPPPP     C
Sbjct  1    MAPIFEYFIVCGIGPEIRTLDGDKGFYGTNYRYLPSLLDQYPPSNPSLRPPPPPPQLPIC  60

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            VLPAGVEFY SGFD N+P T+P++YPIVLTEGDGSKIYV+CIAFRDPV EDI EA+RIP 
Sbjct  61   VLPAGVEFYASGFDGNDPLTYPRTYPIVLTEGDGSKIYVTCIAFRDPVDEDIVEAHRIPL  120

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NSFADKCICLVSR PSF +LR ALEEIF LC S  GS KPLWDVIAY+VSNVPLP PG
Sbjct  121  NSFADKCICLVSRLPSFYVLRSALEEIFALCSSLKGSCKPLWDVIAYMVSNVPLPTPG  178



>ref|XP_009346964.1| PREDICTED: LOW QUALITY PROTEIN: myotubularin-related protein 
13-like [Pyrus x bretschneideri]
Length=1207

 Score =   267 bits (682),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 130/177 (73%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G G  Y  SLLDQYP       PPP     TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFGTYYQTSLLDQYPXHTLYPPPPPQL--PTCV  58

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  59   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  118

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICL+SRSPSF +L+ ALEE+F LCFS +GSSKPLW+VIA +VS VPLP PG
Sbjct  119  SFADKCICLISRSPSFHLLKNALEELFALCFSPNGSSKPLWEVIASLVSTVPLPTPG  175



>ref|XP_006837773.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
 gb|ERN00342.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
Length=1221

 Score =   266 bits (680),  Expect = 9e-79, Method: Composition-based stats.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            +FEY VVCG+GPE+R+L+G RG+ GT +MY+ SLLDQ+P    +LYPPPPPQL TCVLPA
Sbjct  8    LFEYVVVCGLGPELRSLDGTRGFQGTNVMYMPSLLDQFPSSKDALYPPPPPQLPTCVLPA  67

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVEFY SG +  + ST P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP NSFA
Sbjct  68   GVEFYSSGLNPIDVSTHPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPPNSFA  127

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVSRSPSF +LR+A+EE+F LCFS SGSSKP+WDVIA++V NVP P PG
Sbjct  128  DKCICLVSRSPSFHVLRDAVEELFNLCFSPSGSSKPIWDVIAHMVLNVPFPTPG  181



>ref|XP_010031872.1| PREDICTED: uncharacterized protein LOC104421573 [Eucalyptus grandis]
 gb|KCW83843.1| hypothetical protein EUGRSUZ_B00711 [Eucalyptus grandis]
Length=1213

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIRTL+  +G++GT ++Y+ S LDQ+P  +HSLYPPPPPQLSTCVLPA
Sbjct  5    IFEYFVVCGLGPEIRTLDMDKGFHGTEVLYMPSQLDQFPSSDHSLYPPPPPQLSTCVLPA  64

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GVE Y SGFD N P+TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAYRIP+NSFA
Sbjct  65   GVEVYSSGFDPNIPATFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAYRIPSNSFA  124

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSFR+LR ALEEIF LCFS  GSSKPLW+VIAY+V+NVPLP PG
Sbjct  125  DKCICLVSHSPSFRVLRNALEEIFALCFSDGGSSKPLWEVIAYMVTNVPLPTPG  178



>gb|EEE54850.1| hypothetical protein OsJ_02315 [Oryza sativa Japonica Group]
Length=1202

 Score =   264 bits (675),  Expect = 3e-78, Method: Composition-based stats.
 Identities = 130/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAYQIPANSFA  124

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCIC VS SPSF++LR+ALEEIF LCFS +G SKPLWD+I+++VS VPLP PG
Sbjct  125  DKCICFVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHLVSKVPLPTPG  178



>ref|NP_001043390.1| Os01g0575500 [Oryza sativa Japonica Group]
 dbj|BAF05304.1| Os01g0575500 [Oryza sativa Japonica Group]
Length=1248

 Score =   264 bits (675),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 130/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAYQIPANSFA  124

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCIC VS SPSF++LR+ALEEIF LCFS +G SKPLWD+I+++VS VPLP PG
Sbjct  125  DKCICFVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHLVSKVPLPTPG  178



>ref|XP_010231941.1| PREDICTED: uncharacterized protein LOC100845189 [Brachypodium 
distachyon]
Length=1205

 Score =   263 bits (673),  Expect = 7e-78, Method: Composition-based stats.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGVKGFHGADEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP NSFA
Sbjct  67   GVRVYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPVNSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCIC VS SPSF++LR+ALEEIF LCFS +G SKPLWD+I++VVSNVPLP PG
Sbjct  127  DKCICFVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHVVSNVPLPTPG  180



>ref|XP_008672456.1| PREDICTED: uncharacterized protein LOC100273771 isoform X2 [Zea 
mays]
Length=1185

 Score =   263 bits (672),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 129/174 (74%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF++LR+ALEEIF LCFS SG SKPLWD+I+++VS+V LP PG
Sbjct  127  DKCICLVSHSPSFQVLRDALEEIFVLCFSPSGCSKPLWDIISHMVSHVTLPTPG  180



>ref|XP_008672455.1| PREDICTED: uncharacterized protein LOC100273771 isoform X1 [Zea 
mays]
Length=1201

 Score =   263 bits (672),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 129/174 (74%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF++LR+ALEEIF LCFS SG SKPLWD+I+++VS+V LP PG
Sbjct  127  DKCICLVSHSPSFQVLRDALEEIFVLCFSPSGCSKPLWDIISHMVSHVTLPTPG  180



>ref|XP_007210443.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
 gb|EMJ11642.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
Length=1016

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY IPAN
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAYCIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR  LEE+FTLCFS  GSSKPLWDVIA +VS VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRLLRNTLEELFTLCFSPGGSSKPLWDVIASLVSTVPLPTPG  177



>emb|CDY48589.1| BnaCnng16480D [Brassica napus]
Length=1187

 Score =   260 bits (664),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+P  +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPSSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAYR+P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCIC+VS +P+FR LR++LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICIVSHAPNFRALRDSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|XP_004969033.1| PREDICTED: uncharacterized protein LOC101781233 [Setaria italica]
Length=1205

 Score =   258 bits (660),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 127/174 (73%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + L+Q+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGAKGFHGVEDMYMPAFLEQFPPSNHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDISTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF++LR+ALEEIF LCFS +G SKPLWD+I+++VS+V LP PG
Sbjct  127  DKCICLVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHMVSHVTLPTPG  180



>gb|AGG55718.1| stomatal cytokinesis defective 1 [Gossypium arboreum]
Length=1181

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MTRIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAYRIP N
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAYRIPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCIC+VSRSP FR+LREALEEIF LCFS SGS      ++ ++VSNVPLP PG
Sbjct  121  SFADKCICVVSRSPCFRVLREALEEIFALCFSPSGSRASRCGMLLHIVSNVPLPTPG  177



>ref|XP_009147917.1| PREDICTED: myotubularin-related protein 13 isoform X1 [Brassica 
rapa]
Length=1187

 Score =   258 bits (658),  Expect = 7e-76, Method: Composition-based stats.
 Identities = 127/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCIC+VS +P+FR LR++LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICIVSHAPNFRALRDSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>emb|CDM83276.1| unnamed protein product [Triticum aestivum]
Length=1205

 Score =   258 bits (658),  Expect = 9e-76, Method: Composition-based stats.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP NSFA
Sbjct  67   GVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPVNSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCIC VS SP F++LR+ALEEIF LCFS +G SKPLWD+I++VVSNVPLP PG
Sbjct  127  DKCICFVSHSPCFQVLRDALEEIFVLCFSPAGCSKPLWDIISHVVSNVPLPTPG  180



>ref|XP_006393316.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
 gb|ESQ30602.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
Length=1248

 Score =   257 bits (657),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 128/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  60   MGRIFEYFVVCGLGPEMRTLDGDLGFHGLETHYLPSLLDQFPPSDHSLYPPPPPQLPTCV  119

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P+ FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  120  LPAGVAFHSSGFVSSDPANFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDITEAYRLPPN  179

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCIC+VS +P+FR LR++LEEIF LCFS+ GS KPLW+ IAY+VSNVPLP PG
Sbjct  180  TYADKCICIVSHAPNFRALRDSLEEIFVLCFSTEGSCKPLWETIAYMVSNVPLPTPG  236



>tpg|DAA58649.1| TPA: hypothetical protein ZEAMMB73_444537 [Zea mays]
Length=695

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPANSFA
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPANSFA  126

Query  458  DKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            DKCICLVS SPSF++LR+ALEEIF LCFS SG SKPLWD+I+++VS+V LP PG
Sbjct  127  DKCICLVSHSPSFQVLRDALEEIFVLCFSPSGCSKPLWDIISHMVSHVTLPTPG  180



>ref|XP_010479332.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+P  + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPSTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|NP_001185177.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32387.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1040

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|NP_175333.3| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32386.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=909

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|XP_010461711.1| PREDICTED: myotubularin-related protein 13-like isoform X1 [Camelina 
sativa]
 ref|XP_010461712.1| PREDICTED: myotubularin-related protein 13-like isoform X2 [Camelina 
sativa]
 ref|XP_010461713.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Camelina 
sativa]
Length=1185

 Score =   255 bits (651),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|XP_010500445.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   255 bits (651),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>gb|KFK36043.1| hypothetical protein AALP_AA4G070500 [Arabis alpina]
Length=1188

 Score =   254 bits (650),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 126/177 (71%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLEANYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF  +GF S++P++FP+SYP+VLTEGDG+KI+VSC+AFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFRTTGFVSSDPASFPRSYPLVLTEGDGAKIFVSCVAFRDRVCEDIVEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR LR ALEEIF LCFS  GS KPLWD I+++VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRALRNALEEIFVLCFSREGSCKPLWDTISHMVSNVPLPTPG  177



>ref|NP_850959.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 sp|Q8RXA7.1|SCD1_ARATH RecName: Full=DENN domain and WD repeat-containing protein SCD1; 
AltName: Full=Protein STOMATAL CYTOKINESIS DEFECTIVE 1 [Arabidopsis 
thaliana]
 gb|AAL92456.1| stomatal cytokinesis defective [Arabidopsis thaliana]
 gb|AEE32385.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1187

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|XP_006646026.1| PREDICTED: uncharacterized protein LOC102710652 [Oryza brachyantha]
Length=1210

 Score =   254 bits (649),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASL---LDQYpplnhslypppppqlSTCV  268
            IFEYFVVCG+GPEIRTL+G +G++G   M L S+   L+      H L          CV
Sbjct  9    IFEYFVVCGLGPEIRTLDGVKGFHGADDMDLNSVYLWLESLYREGHYLVHHDAAVAEMCV  68

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IPAN
Sbjct  69   LPAGVRIYSSGLDANDLSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPAN  128

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            S+ADKCICLVS SPSF++LR+ALEEIF LCFS +G SKPLWD+I++VVSNVPLP PG
Sbjct  129  SYADKCICLVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHVVSNVPLPTPG  185



>ref|XP_002894154.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70413.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
Length=1187

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPEIRT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+I Y+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIITYMVSNVPLPTPG  177



>ref|XP_006306610.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
 gb|EOA39508.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
Length=1185

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RT++G  G++G    YL SLLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDPGFHGIQTFYLPSLLDQFPPTDQSPYPAPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAYR+P N
Sbjct  61   LPAGVVFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAYRLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>gb|EEC70939.1| hypothetical protein OsI_02530 [Oryza sativa Indica Group]
Length=1118

 Score =   249 bits (636),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 11/185 (6%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTE-----------GDGSKIYVSCIAFRDPVCEDIA  424
            GV  Y SG D+N+ ST+P+SYPIVLT+           G   KIYVSCIAFRDP+CEDI 
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTDCSLTFVLTSCRGRWLKIYVSCIAFRDPICEDIL  124

Query  425  EAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVP  604
            EAY+IPANSFADKCIC VS SPSF++LR+ALEEIF LCFS +G SKPLWD+I+++VSNVP
Sbjct  125  EAYQIPANSFADKCICFVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHLVSNVP  184

Query  605  LPNPG  619
            LP PG
Sbjct  185  LPTPG  189



>ref|XP_009147918.1| PREDICTED: DENN domain-containing protein 4B isoform X2 [Brassica 
rapa]
Length=880

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            ++ADKCIC+VS +P+FR LR++LEEIF LCFSS GS KPLWD+IAY+VSNVPLP PG
Sbjct  121  TYADKCICIVSHAPNFRALRDSLEEIFVLCFSSEGSCKPLWDIIAYMVSNVPLPTPG  177



>ref|XP_010265189.1| PREDICTED: uncharacterized protein LOC104602996 isoform X2 [Nelumbo 
nucifera]
Length=1195

 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 149/177 (84%), Gaps = 14/177 (8%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAYRIPAN
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAYRIPAN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            SFADKCICLVSRSPSFR+LR+ALEE+F LCFS  GS              VPLP PG
Sbjct  121  SFADKCICLVSRSPSFRVLRDALEELFALCFSPDGS--------------VPLPTPG  163



>gb|AAF69702.1|AC016041_7 F27J15.16 [Arabidopsis thaliana]
Length=931

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 24/201 (12%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST--  262
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL T  
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTVK  60

Query  263  ----------------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKI  376
                                  CVLPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI
Sbjct  61   FFTTSFVILVEIRILIGFRSMLCVLPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKI  120

Query  377  YVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGS  556
            +VSCIAFRD VCEDI EAYR+P N++ADKCICLVS +P+FR+LR +LEEIF LCFSS GS
Sbjct  121  FVSCIAFRDRVCEDIIEAYRLPPNTYADKCICLVSHAPNFRVLRNSLEEIFVLCFSSEGS  180

Query  557  SKPLWDVIAYVVSNVPLPNPG  619
             KPLWD+IAY+VSNVPLP PG
Sbjct  181  CKPLWDIIAYMVSNVPLPTPG  201



>ref|XP_002989051.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
 gb|EFJ09845.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
Length=1180

 Score =   235 bits (600),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNG-TGIMYLASLLDQYpplnhslypppppqlSTC  265
            MA + EYF+VCG+GPE++   G RGY+G TG+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSTGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAYRIPA
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAYRIPA  119

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NS+ DKCICLVS SP FR+  EALEE+  LCFS SGSSKPLWD++A++V++VPLP PG
Sbjct  120  NSYVDKCICLVSHSPCFRLFAEALEELHRLCFSPSGSSKPLWDIVAHMVTSVPLPTPG  177



>ref|XP_002983722.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
 gb|EFJ15218.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
Length=1180

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGT-GIMYLASLLDQYpplnhslypppppqlSTC  265
            MA + EYF+VCG+GPE++   G RGY+G+ G+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSSGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAYRIPA
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAYRIPA  119

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NS+ DKCICLVS SP FR+  EALEE+  LCFS SGSSKPLWD++A++V++VPLP PG
Sbjct  120  NSYVDKCICLVSHSPCFRLFAEALEELHRLCFSPSGSSKPLWDIVAHMVTSVPLPTPG  177



>emb|CDY48854.1| BnaA06g03280D [Brassica napus]
Length=157

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY++P N
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAYQLPPN  120

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCFSSSGS  556
            ++ADKCIC+VS +P+FR LR++LEEIF LCFSS GS
Sbjct  121  TYADKCICIVSHAPNFRALRDSLEEIFVLCFSSEGS  156



>ref|XP_010677977.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1175

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  265
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NSF  KCI LVSR P F +LR+ALEEIF LCFS+ GS  PLW+VIA  VSNVPLP PG
Sbjct  121  NSFTRKCISLVSRIPCFCVLRDALEEIFALCFSTRGSRTPLWEVIAATVSNVPLPIPG  178



>ref|XP_010677975.1| PREDICTED: uncharacterized protein LOC104893556 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1232

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  265
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NSF  KCI LVSR P F +LR+ALEEIF LCFS+ GS  PLW+VIA  VSNVPLP PG
Sbjct  121  NSFTRKCISLVSRIPCFCVLRDALEEIFALCFSTRGSRTPLWEVIAATVSNVPLPIPG  178



>ref|XP_010677976.1| PREDICTED: uncharacterized protein LOC104893556 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1200

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  265
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPA  445
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY IP 
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAYGIPP  120

Query  446  NSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            NSF  KCI LVSR P F +LR+ALEEIF LCFS+ GS  PLW+VIA  VSNVPLP PG
Sbjct  121  NSFTRKCISLVSRIPCFCVLRDALEEIFALCFSTRGSRTPLWEVIAATVSNVPLPIPG  178



>ref|XP_001752748.1| predicted protein [Physcomitrella patens]
 gb|EDQ82252.1| predicted protein [Physcomitrella patens]
Length=1149

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRT--LEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST  262
            M  + EYF+VCG+GP+++T  +   RGY GT   Y  +LLDQ+PP   +  P PP QL  
Sbjct  1    MGRLLEYFLVCGLGPDLQTTYIPPTRGYFGTNAYYQPALLDQFPPSELAACPDPPDQLPV  60

Query  263  CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIP  442
            CVLP GV  Y  G  S +PS+ P+SYPIVLTEGDGSKIY+SCIAFRDPV +D+A+AY IP
Sbjct  61   CVLPDGVRIYSQGPSSQDPSSSPRSYPIVLTEGDGSKIYLSCIAFRDPVDDDVAQAYNIP  120

Query  443  ANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            AN + DKCIC +SRSP F + R+ALEEI+  CFS+SG SKP+WD+IA+VV +VP P+PG
Sbjct  121  ANYYVDKCICFLSRSPCFELFRDALEEIYRCCFSASGCSKPIWDIIAHVVLSVPFPSPG  179



>gb|EMT33100.1| hypothetical protein F775_01878 [Aegilops tauschii]
Length=231

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  277
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  278  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFA  457
            GV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+IP  SF 
Sbjct  67   GVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQIPI-SFQ  125

Query  458  DKCICL  475
                CL
Sbjct  126  PLVQCL  131



>ref|XP_008349874.1| PREDICTED: uncharacterized protein LOC103413159 [Malus domestica]
Length=123

 Score =   146 bits (369),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGP IRT +G +G +G    Y  SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPXIRTJDGAKGXHGFXTYYQTSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGD +KIYVSCIAFR  V EDIAEA  IPAN
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDTTKIYVSCIAFRGTVSEDIAEANCIPAN  120

Query  449  S  451
            S
Sbjct  121  S  121



>ref|XP_011470710.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1-like 
[Fragaria vesca subsp. vesca]
Length=440

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 91/151 (60%), Gaps = 32/151 (21%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL                      +   
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPH---------------SLSSSAASA  45

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIPAN  448
               GV FY SGFD+N+ +TFP+SYPIVLTEG                 EDIAE Y IPAN
Sbjct  46   PHPGVSFYSSGFDANDATTFPRSYPIVLTEG-----------------EDIAEDYCIPAN  88

Query  449  SFADKCICLVSRSPSFRILREALEEIFTLCF  541
            SFADKCICLVS+SPS R+L+  LEE+F L F
Sbjct  89   SFADKCICLVSQSPSLRLLKNVLEELFALVF  119



>emb|CDX98751.1| BnaA03g45360D [Brassica napus]
Length=278

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 96/124 (77%), Gaps = 14/124 (11%)
 Frame = +2

Query  185  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  364
            YL+SLLDQ+PP +HSLYPPPPPQL TC+LPAGV F+ SGF S++P++FP+SYPI      
Sbjct  50   YLSSLLDQFPPSDHSLYPPPPPQLPTCILPAGVAFHSSGFVSSDPASFPRSYPI------  103

Query  365  GSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFS  544
                    IAFRD VCED+ EAYR+P N++ DKCIC+VS +PSFR LR++LEEIF L FS
Sbjct  104  --------IAFRDRVCEDVTEAYRLPPNTYTDKCICIVSYAPSFRALRDSLEEIFVLYFS  155

Query  545  SSGS  556
            S GS
Sbjct  156  SEGS  159



>emb|CDY28853.1| BnaC06g26410D [Brassica napus]
Length=378

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  EGDGSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTL  535
            EGDG+KI+VSCIAFRD VC+D+ E YR+P N++A KCIC++S +P+F  LR++LEEIF L
Sbjct  163  EGDGAKIFVSCIAFRDRVCDDVTEPYRLPPNTYAYKCICIISHAPNFPALRDSLEEIFVL  222

Query  536  CFSSSGSSKPLWDVIA  583
            CFSS  S KP WD+IA
Sbjct  223  CFSSERSCKPFWDIIA  238



>ref|XP_008351915.1| PREDICTED: uncharacterized protein LOC103415353 [Malus domestica]
Length=108

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  355
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>ref|XP_008356651.1| PREDICTED: uncharacterized protein LOC103420367 isoform X1 [Malus 
domestica]
Length=131

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTE  358
            LPAGV FY SGFDSN+  TFP+SYPIVLT+
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTD  90



>ref|XP_008356653.1| PREDICTED: uncharacterized protein LOC103420367 isoform X2 [Malus 
domestica]
Length=90

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  89   MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  268
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  269  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  355
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>gb|EMS55158.1| hypothetical protein TRIUR3_14216 [Triticum urartu]
Length=309

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  257  STCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYR  436
             +CVLPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY+
Sbjct  138  KSCVLPAGVRIYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQ  197

Query  437  IPANSFADKCICL  475
            IP  SF     CL
Sbjct  198  IPI-SFQPLVQCL  209


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  98   IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQY  211
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQF  44



>emb|CDY72592.1| BnaAnng41570D, partial [Brassica napus]
Length=235

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 88/141 (62%), Gaps = 24/141 (17%)
 Frame = +2

Query  185  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  364
            YL SLLDQ+PP +HSLYPP PP   TCVLPAGV F+ SGF S++P               
Sbjct  28   YLPSLLDQFPPSDHSLYPPHPPHFPTCVLPAGVAFHSSGFVSSDP---------------  72

Query  365  GSKIYVSCIAFRDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFS  544
                    IAFRD VCED+ EAYR+P N++ADKCIC+VS +P+FR L ++LE IF L FS
Sbjct  73   --------IAFRDRVCEDVTEAYRLPPNTYADKCICIVSHAPNFRALWDSLEVIFGLYFS  124

Query  545  SSGSSKPLWDVIAYVVSNVPL  607
            S GS  P  +      + +PL
Sbjct  125  SEGSC-PTGETTFAATAELPL  144



>gb|KIY96716.1| hypothetical protein MNEG_11246 [Monoraphidium neglectum]
Length=298

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 103/188 (55%), Gaps = 8/188 (4%)
 Frame = +2

Query  53   VTDLRGFGFW*AMAGIFEYFVVCGI-GPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhs  229
            + D R  G   A   +FE+FVVCG+ G  ++T++G+ G+ GT + Y  S LD+ P  ++ 
Sbjct  7    MVDARAAG---ATLPLFEHFVVCGLSGHGLQTVQGEPGFLGTDVNYKPSFLDRLPHSDNP  63

Query  230  lypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPV  409
               PPP    TC LPAGV       D       P+ Y +VLTEGDG+K+Y SC+A+ D +
Sbjct  64   KRQPPPQL-PTCCLPAGVNIILKE-DIAGAVLNPRMYAVVLTEGDGTKVYASCLAYYDEL  121

Query  410  CEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYV  589
              ++   +     + A K +CL+S  P        L E+  L F  +GS  P+ DVI+++
Sbjct  122  PAELRARHEQLCGARALKALCLLSHQPYLACSERVLRELCNLAF-VTGSPVPVVDVISHL  180

Query  590  VSNVPLPN  613
            ++ VP P+
Sbjct  181  LA-VPCPS  187



>ref|XP_006485773.1| PREDICTED: uncharacterized protein LOC102621506 isoform X2 [Citrus 
sinensis]
Length=1086

 Score = 78.2 bits (191),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  494  FRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
            FRILR ALEEI++LCF S GSSKPLWDVI+++VSNVPLP PG
Sbjct  16   FRILRNALEEIYSLCFLSDGSSKPLWDVISHLVSNVPLPTPG  57


 Score = 31.2 bits (69),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 1/20 (5%)
 Frame = +3

Query  363  MGQRFMLVALRSEILFVRIL  422
            MG+RFMLVA R EILF RIL
Sbjct  1    MGRRFMLVAYRLEILF-RIL  19



>ref|XP_002507362.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68620.1| predicted protein [Micromonas sp. RCC299]
Length=2680

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 74/167 (44%), Gaps = 23/167 (14%)
 Frame = +2

Query  104  EYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-------  262
            E FVVCG+     T++G  G+ G G  Y   +L  YPP           +  T       
Sbjct  7    ECFVVCGLPASPVTVDGVAGFVGAGESYRPEVLSSYPPRARPPRGAGTNRGETDEPSTTG  66

Query  263  ---------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAF  397
                           C +P GV+ + +  D    +  P SYPIVLT+GDG+ +Y +C+AF
Sbjct  67   DDQGSRPPWPPHLALCAMPLGVDVHVAS-DPPRDALAPTSYPIVLTDGDGAPVYCACLAF  125

Query  398  RDPVCEDIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLC  538
              PV      A     ++ A  C+ LVSR+P   +LR AL  +   C
Sbjct  126  LAPVPSRTRAAVPALRSACARMCVVLVSRAPIIDVLRHALNAVVGRC  172



>ref|XP_001415729.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94021.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1301

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 43/121 (36%), Positives = 57/121 (47%), Gaps = 17/121 (14%)
 Frame = +2

Query  257  STCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCE-------  415
            +T  LP GV+ Y  G D       P  YP +LT+ +G +IYV+C++F     E       
Sbjct  101  ATLALPRGVDAY--GDDERADDEHPTRYPTILTDENGDRIYVACVSFVAATPERSLRTMS  158

Query  416  -DIAEAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSK-PLWDVIAYV  589
             + A A R      A  C+CLVSR P      EALE +F   F   G    P+  VIA +
Sbjct  159  GETAGATR------ARACVCLVSRMPCLDAWMEALEHVFEAYFRKPGRGHLPVLSVIAEM  212

Query  590  V  592
            V
Sbjct  213  V  213



>ref|XP_005838612.1| hypothetical protein GUITHDRAFT_134523 [Guillardia theta CCMP2712]
 gb|EKX51632.1| hypothetical protein GUITHDRAFT_134523 [Guillardia theta CCMP2712]
Length=1215

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 13/127 (10%)
 Frame = +2

Query  266  VLPAGVEFY--PSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRI  439
            + P  V  +  P G         P  Y +V T  +GS++Y S + F D + +D    Y++
Sbjct  67   IFPPQVAMFALPEGLSVKISCPLPTFYIVVFTSNEGSRLYASVLTFHDELPKD--ALYKM  124

Query  440  PANS-------FADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSN  598
              N        +  KCICL+S  P F + RE L++++ +  S + S  P+   I+ ++  
Sbjct  125  CKNPESIKNELWIPKCICLISHWPFFDLHREFLKQLYRV--SLTASRIPVERYISNLIYE  182

Query  599  VPLPNPG  619
            VPLP  G
Sbjct  183  VPLPPRG  189



>ref|XP_003074105.1| RAS signaling inhibitor ST5 (ISS) [Ostreococcus tauri]
Length=1608

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +2

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCE----DIAEAY  433
            V+P GV+ Y SG  +++     + YP +LT+  G ++YV+C++F     E     + E  
Sbjct  87   VMPRGVDAYDSGARTSDDDA--ERYPTILTDEKGERVYVACVSFIAAAPERSLLTMTEWD  144

Query  434  RIPANSFADKCICLVSRSPSFRILREALEEIF  529
              PA + A  C+CLVSR+P      EAL  +F
Sbjct  145  WTPARARA--CVCLVSRAPCLDAWMEALWHMF  174



>emb|CEF96494.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=1288

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +2

Query  266  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCE----DIAEAY  433
            V+P GV+ Y SG  +++     + YP +LT+  G ++YV+C++F     E     + E  
Sbjct  87   VMPRGVDAYDSGARTSDDDA--ERYPTILTDEKGERVYVACVSFIAAAPERSLLTMTEWD  144

Query  434  RIPANSFADKCICLVSRSPSFRILREALEEIF  529
              PA + A  C+CLVSR+P      EAL  +F
Sbjct  145  WTPARARA--CVCLVSRAPCLDAWMEALWHMF  174



>ref|XP_004212516.1| PREDICTED: myotubularin-related protein 13-like, partial [Hydra 
vulgaris]
Length=177

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 4/119 (3%)
 Frame = +2

Query  269  LPAGVEFY--PSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAYRIP  442
             P G+E +  P G+ S+  +  P  Y  +LT+ +G   Y++C+ F + +  D +  +   
Sbjct  23   FPQGLEHFCQPGGWFSSVKNLPPTFYVAILTDIEGKSNYLACLTFYEGISVDTSSDHLTD  82

Query  443  ANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPNPG  619
               +  KC+CLVSR+  F  L+  L  I  L    +G S+ L  +I  ++  V +P PG
Sbjct  83   KICYIPKCLCLVSRNKYFNTLKNCLLTI--LAGFLNGKSEILEKMIGCMLGFVHVPPPG  139



>ref|XP_002951775.1| hypothetical protein VOLCADRAFT_92266 [Volvox carteri f. nagariensis]
 gb|EFJ47226.1| hypothetical protein VOLCADRAFT_92266 [Volvox carteri f. nagariensis]
Length=138

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (48%), Gaps = 7/122 (6%)
 Frame = +2

Query  263  CVLPAGVEFYPSG---FDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  433
            C +P GVE   +    F   +    P  Y +VLT+  G ++Y +C+ + +P+   I   +
Sbjct  12   CCMPDGVEIVSAERAEFRLRSSDYSPVVYSLVLTDEGGRRLYGTCLTYLEPLPPIITCRH  71

Query  434  RIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLPN  613
                 ++  + +CLVS+ P      + L  +F+  F   G S P+ D++  ++    LP 
Sbjct  72   EHLIGAYGTRALCLVSKLPYLTTAEQVLRGLFSTVF-LRGPSAPVADLLGALLR---LPC  127

Query  614  PG  619
            PG
Sbjct  128  PG  129



>ref|XP_001692620.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04098.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 16/112 (14%)
 Frame = +2

Query  269  LPAGVEFYP-SGFDSN-NPSTF-PKSYPIVLTEGDGSKIYVSCIAFRDPV-----CEDIA  424
            +P GVE  P S  ++   P+   PK Y +VLT+  G ++YVSC+++ D +     CE + 
Sbjct  1    MPDGVELIPPSEVEAAVKPAGLGPKLYAVVLTDEGGRRLYVSCLSYMDAMPPAAACEQL-  59

Query  425  EAYRIPANSFADKCICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVI  580
                  A   A + +CLVSR P      + L  ++   F   G S P+ D++
Sbjct  60   ------AGWQASRALCLVSRQPYLATAEQVLRRLYVAVF-CLGPSAPVADLV  104



>ref|XP_001033500.2| hypothetical protein TTHERM_00313190 [Tetrahymena thermophila]
Length=1110

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 77/168 (46%), Gaps = 14/168 (8%)
 Frame = +2

Query  122  GIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSG  301
            G+  + R    QR Y      Y  ++LD+YP  +H   P P      C  P GV+F    
Sbjct  199  GLQEQNRVFCLQRDYEIQNKRYKPAVLDRYPLADHMHTPFPDAVSQFC-FPEGVKF----  253

Query  302  FDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRD-PVCEDIAEAYRIPANS----FADKC  466
                + ST P+ +  VLT  DG +IY +C+ F + P  + I +   I  +     F  K 
Sbjct  254  --KRDNSTQPECFNFVLTLQDGCRIYCTCLIFNEVPDQKVIEQLGHIKIDDQTPLFVQKA  311

Query  467  ICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLP  610
            ICL+S    F   ++ L+ ++ L  S S +  P+   I  +V ++ LP
Sbjct  312  ICLISHYNYFDEYKQILKHLYRL--SLSKNEIPIERFICNIVDDIRLP  357



>gb|EAR85837.3| DENN (AEX-3) domain protein [Tetrahymena thermophila SB210]
Length=1161

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 77/168 (46%), Gaps = 14/168 (8%)
 Frame = +2

Query  122  GIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSG  301
            G+  + R    QR Y      Y  ++LD+YP  +H   P P      C  P GV+F    
Sbjct  199  GLQEQNRVFCLQRDYEIQNKRYKPAVLDRYPLADHMHTPFPDAVSQFC-FPEGVKF----  253

Query  302  FDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRD-PVCEDIAEAYRIPANS----FADKC  466
                + ST P+ +  VLT  DG +IY +C+ F + P  + I +   I  +     F  K 
Sbjct  254  --KRDNSTQPECFNFVLTLQDGCRIYCTCLIFNEVPDQKVIEQLGHIKIDDQTPLFVQKA  311

Query  467  ICLVSRSPSFRILREALEEIFTLCFSSSGSSKPLWDVIAYVVSNVPLP  610
            ICL+S    F   ++ L+ ++ L  S S +  P+   I  +V ++ LP
Sbjct  312  ICLISHYNYFDEYKQILKHLYRL--SLSKNEIPIERFICNIVDDIRLP  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520