BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS099E07

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG12401.1|  hypothetical protein F383_03889                       84.7    3e-16   Gossypium arboreum [tree cotton]
gb|AAO18731.1|  cysteine protease                                     83.2    7e-16   Gossypium hirsutum [American cotton]
gb|KJB66816.1|  hypothetical protein B456_010G159600                  83.6    8e-16   Gossypium raimondii
gb|KJB66817.1|  hypothetical protein B456_010G159600                  83.6    1e-15   Gossypium raimondii
gb|KJB66815.1|  hypothetical protein B456_010G159600                  83.6    1e-15   Gossypium raimondii
gb|KJB66818.1|  hypothetical protein B456_010G159600                  83.2    1e-15   Gossypium raimondii
ref|XP_007025363.1|  Xylem bark cysteine peptidase 3 isoform 1        76.3    3e-13   
ref|XP_010999738.1|  PREDICTED: low-temperature-induced cysteine ...  72.4    8e-12   Populus euphratica
gb|ABQ10203.1|  cysteine protease Cp5                                 70.9    2e-11   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002305743.2|  hypothetical protein POPTR_0004s05640g           70.9    3e-11   Populus trichocarpa [western balsam poplar]
emb|CDO96804.1|  unnamed protein product                              70.5    4e-11   Coffea canephora [robusta coffee]
ref|XP_002317417.2|  hypothetical protein POPTR_0011s07300g           68.9    9e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008225294.1|  PREDICTED: cysteine proteinase COT44-like        68.9    1e-10   Prunus mume [ume]
ref|XP_007211825.1|  hypothetical protein PRUPE_ppa004381mg           68.9    1e-10   Prunus persica
ref|XP_009613580.1|  PREDICTED: low-temperature-induced cysteine ...  68.2    2e-10   Nicotiana tomentosiformis
ref|XP_011039435.1|  PREDICTED: low-temperature-induced cysteine ...  68.2    2e-10   Populus euphratica
ref|XP_004293953.1|  PREDICTED: low-temperature-induced cysteine ...  67.8    3e-10   Fragaria vesca subsp. vesca
ref|XP_002533962.1|  cysteine protease, putative                      67.0    4e-10   Ricinus communis
gb|KHN28613.1|  P34 putative thiol protease                           65.9    4e-10   Glycine soja [wild soybean]
ref|XP_004233043.1|  PREDICTED: low-temperature-induced cysteine ...  67.0    4e-10   Solanum lycopersicum
ref|XP_006362442.1|  PREDICTED: uncharacterized protein LOC102602011  67.0    7e-10   
ref|XP_006362441.1|  PREDICTED: oryzain alpha chain-like              66.6    8e-10   
gb|KDO77866.1|  hypothetical protein CISIN_1g043774mg                 65.9    1e-09   Citrus sinensis [apfelsine]
ref|XP_006449509.1|  hypothetical protein CICLE_v10015066mg           65.9    1e-09   Citrus clementina [clementine]
ref|XP_006467643.1|  PREDICTED: cysteine proteinase RD21a-like        65.9    1e-09   Citrus sinensis [apfelsine]
gb|KHN08431.1|  Xylem cysteine proteinase 1                           65.5    1e-09   Glycine soja [wild soybean]
ref|XP_010277012.1|  PREDICTED: low-temperature-induced cysteine ...  65.1    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002317418.2|  hypothetical protein POPTR_0011s07310g           65.1    2e-09   Populus trichocarpa [western balsam poplar]
gb|ABK95906.1|  unknown                                               65.1    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010052188.1|  PREDICTED: low-temperature-induced cysteine ...  64.7    3e-09   Eucalyptus grandis [rose gum]
gb|KCW76106.1|  hypothetical protein EUGRSUZ_D00484                   64.7    3e-09   Eucalyptus grandis [rose gum]
ref|XP_009613579.1|  PREDICTED: low-temperature-induced cysteine ...  64.7    3e-09   Nicotiana tomentosiformis
gb|KDP21101.1|  hypothetical protein JCGZ_21572                       64.3    3e-09   Jatropha curcas
ref|XP_003542981.1|  PREDICTED: cysteine proteinase RD21a-like        64.3    3e-09   Glycine max [soybeans]
gb|AGV15822.1|  cysteine protease CP14                                64.3    4e-09   Nicotiana tabacum [American tobacco]
ref|XP_006852404.1|  hypothetical protein AMTR_s00021p00031000        63.9    5e-09   Amborella trichopoda
ref|XP_011039436.1|  PREDICTED: low-temperature-induced cysteine ...  63.9    5e-09   Populus euphratica
ref|XP_009797427.1|  PREDICTED: low-temperature-induced cysteine ...  63.5    6e-09   Nicotiana sylvestris
ref|XP_004233038.1|  PREDICTED: low-temperature-induced cysteine ...  62.8    1e-08   Solanum lycopersicum
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor   62.4    1e-08   Glycine max [soybeans]
ref|XP_010317333.1|  PREDICTED: xylem cysteine proteinase 2-like      62.8    1e-08   
ref|XP_010279138.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008371471.1|  PREDICTED: low-temperature-induced cysteine ...  60.8    5e-08   
ref|XP_009797432.1|  PREDICTED: low-temperature-induced cysteine ...  60.1    9e-08   Nicotiana sylvestris
ref|XP_009350090.1|  PREDICTED: low-temperature-induced cysteine ...  59.7    1e-07   Pyrus x bretschneideri [bai li]
gb|AHM88211.1|  CAC1 protein                                          59.7    1e-07   Malus hybrid cultivar
ref|XP_008789986.1|  PREDICTED: low-temperature-induced cysteine ...  59.3    2e-07   Phoenix dactylifera
ref|XP_010915506.1|  PREDICTED: low-temperature-induced cysteine ...  58.5    3e-07   Elaeis guineensis
ref|XP_002266308.2|  PREDICTED: low-temperature-induced cysteine ...  57.8    5e-07   Vitis vinifera
ref|NP_001241331.1|  uncharacterized protein LOC100811719 precursor   57.4    6e-07   Glycine max [soybeans]
gb|KDO36580.1|  hypothetical protein CISIN_1g037262mg                 54.3    7e-07   Citrus sinensis [apfelsine]
gb|KHN04480.1|  Cysteine proteinase RD21a                             56.6    9e-07   Glycine soja [wild soybean]
ref|XP_003590277.1|  Cysteine protease                                56.6    1e-06   
gb|KEH36599.1|  papain family cysteine protease                       56.2    2e-06   Medicago truncatula
ref|XP_003636796.1|  Cysteine proteinase                              56.2    2e-06   
gb|KJB69616.1|  hypothetical protein B456_011G034300                  55.5    2e-06   Gossypium raimondii
dbj|BAD29959.1|  cysteine protease                                    55.8    2e-06   Daucus carota [carrots]
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      55.5    2e-06   
gb|KHN48002.1|  P34 putative thiol protease                           55.5    2e-06   Glycine soja [wild soybean]
ref|XP_007148042.1|  hypothetical protein PHAVU_006G175500g           55.8    3e-06   Phaseolus vulgaris [French bean]
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg          53.1    3e-06   
gb|KDP41692.1|  hypothetical protein JCGZ_16099                       55.1    4e-06   Jatropha curcas
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44             54.3    7e-06   Sesamum indicum [beniseed]
gb|AGV54734.1|  cysteine proteinase                                   54.3    7e-06   Phaseolus vulgaris [French bean]
gb|KCW74111.1|  hypothetical protein EUGRSUZ_E02751                   54.3    8e-06   Eucalyptus grandis [rose gum]
ref|XP_010057104.1|  PREDICTED: low-temperature-induced cysteine ...  54.3    8e-06   Eucalyptus grandis [rose gum]
ref|XP_004504420.1|  PREDICTED: P34 probable thiol protease-like      53.9    9e-06   
gb|AAQ55450.1|  34 kDa maturing seed vacuolar thiol protease prec...  51.6    1e-05   Glycine max [soybeans]
gb|AFO83614.1|  papain-like cysteine protease                         53.5    1e-05   Fagopyrum esculentum
ref|XP_004486273.1|  PREDICTED: P34 probable thiol protease-like      53.1    1e-05   Cicer arietinum [garbanzo]
ref|XP_007159458.1|  hypothetical protein PHAVU_002G239300g           53.1    1e-05   Phaseolus vulgaris [French bean]
ref|XP_006849993.1|  hypothetical protein AMTR_s00022p00166050        53.1    1e-05   Amborella trichopoda
gb|KJB69615.1|  hypothetical protein B456_011G034200                  53.1    2e-05   Gossypium raimondii
gb|EPS62067.1|  cysteine proteinase                                   52.8    2e-05   Genlisea aurea
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like              53.1    2e-05   Brachypodium distachyon [annual false brome]
ref|NP_001054087.2|  Os04g0650000                                     50.8    2e-05   
gb|KJB14608.1|  hypothetical protein B456_002G133800                  52.8    2e-05   Gossypium raimondii
gb|EEE61807.1|  hypothetical protein OsJ_16426                        52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KHN47997.1|  P34 putative thiol protease                           52.8    2e-05   Glycine soja [wild soybean]
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...  52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04498.2|  OSJNBb0059K02.8                                      52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA14402.1|  oryzain alpha precursor                              52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like              52.8    2e-05   Phoenix dactylifera
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           52.4    2e-05   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           52.4    3e-05   
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like        52.8    3e-05   Populus euphratica
ref|XP_010094652.1|  Cysteine proteinase RD21a                        52.4    3e-05   Morus notabilis
gb|KJB14610.1|  hypothetical protein B456_002G133800                  52.4    3e-05   Gossypium raimondii
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...  52.4    3e-05   Sesamum indicum [beniseed]
gb|KJB14609.1|  hypothetical protein B456_002G133800                  52.4    3e-05   Gossypium raimondii
gb|AAL14614.1|AF417109_1  cysteine proteinase precursor               50.4    3e-05   Vasconcellea cundinamarcensis
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like        51.6    3e-05   
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g           52.4    4e-05   
gb|ABI30276.1|  VXH-C                                                 51.6    4e-05   Vasconcellea x heilbornii [babaco]
gb|EEC78138.1|  hypothetical protein OsI_17694                        52.0    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004485897.1|  PREDICTED: cysteine proteinase RD21a-like        52.4    4e-05   Cicer arietinum [garbanzo]
emb|CAJ86180.1|  H0212B02.7                                           52.0    4e-05   Oryza sativa [red rice]
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like        52.0    4e-05   Glycine max [soybeans]
ref|XP_003547166.1|  PREDICTED: P34 probable thiol protease-like      51.6    4e-05   Glycine max [soybeans]
dbj|BAJ85145.1|  predicted protein                                    52.0    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                   52.0    4e-05   Eucalyptus grandis [rose gum]
emb|CAQ00105.1|  papain-like cysteine proteinase                      52.0    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002519955.1|  cysteine protease, putative                      51.6    4e-05   
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...  52.0    4e-05   Eucalyptus grandis [rose gum]
gb|KHN18913.1|  P34 putative thiol protease                           51.6    5e-05   Glycine soja [wild soybean]
dbj|BAA25899.1|  Bd 30K                                               51.6    5e-05   Glycine max [soybeans]
dbj|BAJ92693.1|  predicted protein                                    51.2    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK26996.1|  unknown                                               51.6    5e-05   Picea sitchensis
ref|XP_002525124.1|  cysteine protease, putative                      51.6    5e-05   Ricinus communis
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  51.2    5e-05   Elaeis guineensis
gb|AFK47737.1|  unknown                                               51.2    6e-05   Medicago truncatula
gb|AJA74414.1|  cysteine protease                                     51.6    6e-05   Cicer arietinum [garbanzo]
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like        51.6    6e-05   Cicer arietinum [garbanzo]
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  51.6    6e-05   
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...  51.2    7e-05   Vitis vinifera
gb|EAY87283.1|  hypothetical protein OsI_08685                        51.2    7e-05   Oryza sativa Indica Group [Indian rice]
emb|CAN61026.1|  hypothetical protein VITISV_001146                   51.2    7e-05   Vitis vinifera
ref|NP_001047923.1|  Os02g0715000                                     51.2    7e-05   
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...  51.2    7e-05   Theobroma cacao [chocolate]
gb|AAU81594.1|  cysteine proteinase                                   49.7    7e-05   Petunia x hybrida [garden petunia]
gb|KEH36581.1|  papain family cysteine protease                       51.2    7e-05   Medicago truncatula
gb|AAX84673.1|  cysteine protease CP1                                 51.2    7e-05   Manihot esculenta [manioc]
gb|KHN22488.1|  Cysteine proteinase RD21a                             51.2    7e-05   Glycine soja [wild soybean]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...  51.2    7e-05   Sesamum indicum [beniseed]
ref|XP_010091715.1|  hypothetical protein L484_001478                 50.8    7e-05   Morus notabilis
gb|KDP47124.1|  hypothetical protein JCGZ_22120                       50.4    8e-05   Jatropha curcas
gb|KDP21086.1|  hypothetical protein JCGZ_21557                       48.9    8e-05   Jatropha curcas
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like              50.1    9e-05   
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like              50.8    9e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22490.1|  Cysteine proteinase RD21a                             50.8    9e-05   Glycine soja [wild soybean]
gb|ACU18172.1|  unknown                                               50.8    9e-05   Glycine max [soybeans]
ref|XP_006362397.1|  PREDICTED: oryzain alpha chain-like              50.8    9e-05   Solanum tuberosum [potatoes]
ref|XP_009796444.1|  PREDICTED: xylem cysteine proteinase 1-like      50.8    1e-04   Nicotiana sylvestris
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44             50.8    1e-04   Vitis vinifera
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270        50.4    1e-04   Amborella trichopoda
gb|ABQ10200.1|  cysteine protease Cp2                                 50.8    1e-04   Actinidia deliciosa [Chinese gooseberry]
gb|KJB58559.1|  hypothetical protein B456_009G214900                  50.8    1e-04   Gossypium raimondii
ref|XP_010911312.1|  PREDICTED: senescence-specific cysteine prot...  49.7    1e-04   
dbj|BAC75927.1|  cysteine protease-5                                  50.4    1e-04   Helianthus annuus
gb|KJB58557.1|  hypothetical protein B456_009G214900                  50.8    1e-04   Gossypium raimondii
gb|KEH30224.1|  papain family cysteine protease                       50.4    1e-04   Medicago truncatula
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like              50.8    1e-04   Phoenix dactylifera
gb|KHG05637.1|  Cysteinease RD21a -like protein                       50.8    1e-04   Gossypium arboreum [tree cotton]
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like        50.4    1e-04   Eucalyptus grandis [rose gum]
gb|AHA62772.1|  papain-like cysteine protease                         50.4    1e-04   Solanum stoloniferum
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           50.4    1e-04   
gb|KJB58558.1|  hypothetical protein B456_009G214900                  50.4    1e-04   Gossypium raimondii
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g           50.4    1e-04   Phaseolus vulgaris [French bean]
gb|ABQ10204.1|  cysteine protease Cp6                                 50.4    1e-04   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like        48.9    1e-04   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  50.1    1e-04   Elaeis guineensis
gb|ACU13684.1|  unknown                                               49.7    1e-04   Glycine max [soybeans]
gb|KEH31479.1|  papain family cysteine protease                       50.4    1e-04   Medicago truncatula
ref|XP_008782844.1|  PREDICTED: xylem cysteine proteinase 1-like      50.1    1e-04   Phoenix dactylifera
emb|CAB17076.1|  cysteine proteinase precursor                        50.4    1e-04   Phaseolus vulgaris [French bean]
ref|XP_003559142.1|  PREDICTED: oryzain alpha chain-like              47.8    1e-04   Brachypodium distachyon [annual false brome]
dbj|BAD29958.1|  cysteine protease                                    50.4    1e-04   Daucus carota [carrots]
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...  50.4    1e-04   Nicotiana sylvestris
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      50.1    1e-04   Elaeis guineensis
emb|CAA53377.1|  cysteine protease                                    50.1    1e-04   Vicia sativa [spring vetch]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...  50.4    2e-04   Sesamum indicum [beniseed]
gb|AFJ15103.1|  mexicain-like cystein protease                        50.1    2e-04   Jacaratia mexicana [bonete]
ref|XP_009599970.1|  PREDICTED: xylem cysteine proteinase 1-like      50.1    2e-04   Nicotiana tomentosiformis
gb|AHA62773.1|  papain-like cysteine protease                         50.1    2e-04   Solanum demissum
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like        50.1    2e-04   Cucumis sativus [cucumbers]
gb|ABG33750.1|  cysteine protease                                     50.1    2e-04   Hevea brasiliensis [jebe]
gb|KHN27075.1|  Cysteine proteinase RD21a                             50.1    2e-04   Glycine soja [wild soybean]
gb|AHA62774.1|  papain-like cysteine protease                         50.1    2e-04   Solanum demissum
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like        50.1    2e-04   Glycine max [soybeans]
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                  49.7    2e-04   Solanum tuberosum [potatoes]
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like        50.1    2e-04   Citrus sinensis [apfelsine]
gb|AHA62776.1|  papain-like cysteine protease                         49.7    2e-04   Solanum tuberosum [potatoes]
sp|O23791.1|BROM1_ANACO  RecName: Full=Fruit bromelain; AltName: ...  49.7    2e-04   Ananas comosus
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...  50.1    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg           50.1    2e-04   Prunus persica
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...  50.1    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...  50.1    2e-04   
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like      49.7    2e-04   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like              49.7    2e-04   Elaeis guineensis
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...  49.7    2e-04   Prunus mume [ume]
dbj|BAH11164.1|  cysteine protease                                    49.7    2e-04   Hordeum vulgare [barley]
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like        49.7    2e-04   Pyrus x bretschneideri [bai li]
ref|NP_001275606.1|  fruit bromelain-like precursor                   49.3    3e-04   Solanum tuberosum [potatoes]
gb|KHN30007.1|  Cysteine proteinase RD21a                             49.3    3e-04   Glycine soja [wild soybean]
ref|XP_002510170.1|  cysteine protease, putative                      49.7    3e-04   Ricinus communis
ref|XP_003293312.1|  hypothetical protein DICPUDRAFT_41833            49.3    3e-04   Dictyostelium purpureum
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like      49.3    3e-04   Camelina sativa [gold-of-pleasure]
gb|AES64023.2|  papain family cysteine protease                       49.3    3e-04   Medicago truncatula
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...  49.7    3e-04   
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a             49.3    3e-04   Glycine max [soybeans]
dbj|BAE80740.1|  cysteine proteinase                                  49.7    3e-04   Platycodon grandiflorus [balloon-flower]
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg              49.3    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...  49.7    3e-04   Nicotiana tomentosiformis
ref|XP_007212679.1|  hypothetical protein PRUPE_ppa018439mg           47.8    3e-04   
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like        49.7    3e-04   
gb|KHG12125.1|  Cysteinease RD21a -like protein                       49.7    3e-04   Gossypium arboreum [tree cotton]
ref|XP_002869093.1|  hypothetical protein ARALYDRAFT_491113           49.3    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...  49.3    3e-04   Eucalyptus grandis [rose gum]
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                   49.3    3e-04   Eucalyptus grandis [rose gum]
ref|XP_010928427.1|  PREDICTED: xylem cysteine proteinase 2-like      49.3    3e-04   
ref|XP_010091714.1|  Fruit bromelain                                  49.3    3e-04   
ref|NP_001149658.1|  cysteine protease 1 precursor                    49.3    3e-04   
emb|CDP01294.1|  unnamed protein product                              49.3    3e-04   Coffea canephora [robusta coffee]
gb|AFP73359.1|  cysteine protease                                     48.9    3e-04   Solanum chilense
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1              49.3    3e-04   
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like        49.3    3e-04   
emb|CDP18154.1|  unnamed protein product                              48.9    3e-04   Coffea canephora [robusta coffee]
gb|AFP73362.1|  cysteine protease                                     48.9    3e-04   Solanum chilense
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           48.9    3e-04   
dbj|BAF46304.1|  cysteine proteinase precursor                        49.3    4e-04   Ipomoea nil [qian niu]
ref|XP_010276986.1|  PREDICTED: ervatamin-B-like                      48.9    4e-04   Nelumbo nucifera [Indian lotus]
gb|AFP73327.1|  cysteine protease                                     48.9    4e-04   Solanum peruvianum [Peruvian tomato]
sp|P00784.1|PAPA1_CARPA  RecName: Full=Papain; AltName: Full=Papa...  48.9    4e-04   Carica papaya [mamon]
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like      48.9    4e-04   Elaeis guineensis
gb|AAP41846.1|  cysteine protease                                     48.9    4e-04   Anthurium andraeanum [flamingo-lily]
sp|P22895.1|P34_SOYBN  RecName: Full=P34 probable thiol protease;...  48.9    4e-04   Glycine max [soybeans]
ref|NP_001238219.1|  P34 probable thiol protease precursor            48.9    4e-04   
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g           48.9    4e-04   Phaseolus vulgaris [French bean]
ref|XP_010099370.1|  hypothetical protein L484_004796                 46.2    4e-04   
gb|EMS56635.1|  Oryzain alpha chain                                   48.9    4e-04   Triticum urartu
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg              48.9    4e-04   Erythranthe guttata [common monkey flower]
gb|KCW74083.1|  hypothetical protein EUGRSUZ_E02722                   46.6    4e-04   Eucalyptus grandis [rose gum]
sp|P05994.3|PAPA4_CARPA  RecName: Full=Papaya proteinase 4; AltNa...  48.5    5e-04   Carica papaya [mamon]
ref|XP_010913142.1|  PREDICTED: ervatamin-B-like                      48.5    5e-04   Elaeis guineensis
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                  47.4    5e-04   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          48.5    5e-04   Morus notabilis
dbj|BAF02546.1|  triticain alpha                                      48.9    5e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          48.5    5e-04   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...  48.5    5e-04   Sesamum indicum [beniseed]
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g           48.9    5e-04   
ref|XP_010059008.1|  PREDICTED: ananain-like                          47.0    5e-04   Eucalyptus grandis [rose gum]
pdb|3TNX|A  Chain A, Structure Of The Precursor Of A Thermostable...  48.5    5e-04   Carica papaya [mamon]
gb|EMT10408.1|  Oryzain alpha chain                                   48.5    5e-04   
ref|XP_003522988.1|  PREDICTED: xylem cysteine proteinase 2-like      48.5    5e-04   
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like        48.5    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like      48.5    6e-04   
gb|AFP73358.1|  cysteine protease                                     48.1    6e-04   Solanum habrochaites
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like              48.5    6e-04   Setaria italica
ref|XP_003527269.1|  PREDICTED: xylem cysteine proteinase 2-like      48.1    6e-04   Glycine max [soybeans]
dbj|BAC75923.1|  cysteine protease-1                                  48.5    6e-04   Helianthus annuus
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...  48.5    6e-04   Solanum lycopersicum
gb|AFP73357.1|  cysteine protease                                     48.1    6e-04   Solanum habrochaites
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                 48.1    6e-04   Citrus sinensis [apfelsine]
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like        48.1    6e-04   Citrus sinensis [apfelsine]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg           48.5    6e-04   Citrus clementina [clementine]
gb|EPS63305.1|  hypothetical protein M569_11479                       48.5    6e-04   Genlisea aurea
gb|KCW74081.1|  hypothetical protein EUGRSUZ_E02719                   46.2    6e-04   Eucalyptus grandis [rose gum]
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                 48.5    7e-04   Citrus sinensis [apfelsine]
gb|AFP73348.1|  cysteine protease                                     48.1    7e-04   Solanum lycopersicoides
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like        48.1    7e-04   Citrus sinensis [apfelsine]
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      48.1    7e-04   
gb|ADY68475.1|  stem bromelain                                        48.1    7e-04   Ananas comosus
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like      48.1    7e-04   
ref|XP_008453002.1|  PREDICTED: xylem cysteine proteinase 2           48.1    7e-04   Cucumis melo [Oriental melon]
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g           48.1    7e-04   Phaseolus vulgaris [French bean]
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like      48.1    7e-04   
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                  48.1    7e-04   
ref|XP_011100156.1|  PREDICTED: xylem cysteine proteinase 2-like      48.1    7e-04   Sesamum indicum [beniseed]
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like        48.1    8e-04   Tarenaya hassleriana [spider flower]
gb|KHN33772.1|  Xylem cysteine proteinase 2                           47.8    8e-04   Glycine soja [wild soybean]
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...  48.1    8e-04   Camelina sativa [gold-of-pleasure]
gb|ACO57104.1|  cysteine protease                                     45.8    8e-04   Pinus halepensis [Aleppo pine]
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220        48.1    8e-04   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g           47.8    8e-04   Phaseolus vulgaris [French bean]
ref|XP_010446933.1|  PREDICTED: xylem cysteine proteinase 1           47.8    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like        47.8    8e-04   Eucalyptus grandis [rose gum]
gb|AEZ65082.1|  cysteine protease                                     48.1    8e-04   Carica papaya [mamon]
ref|XP_010274464.1|  PREDICTED: zingipain-2-like                      47.8    8e-04   Nelumbo nucifera [Indian lotus]
gb|KHN12823.1|  Cysteine proteinase RD21a                             47.8    8e-04   Glycine soja [wild soybean]
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like              48.1    8e-04   Elaeis guineensis
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like              48.1    9e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002525123.1|  cysteine protease, putative                      47.8    9e-04   Ricinus communis
emb|CAB17074.1|  cysteine proteinase precursor                        47.8    9e-04   Phaseolus vulgaris [French bean]
dbj|BAA21848.1|  bromelain                                            47.8    9e-04   Ananas comosus
dbj|BAA22545.1|  FB22 precursor                                       47.8    9e-04   Ananas comosus
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g           47.8    0.001   Phaseolus vulgaris [French bean]
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a             47.8    0.001   Fragaria vesca subsp. vesca
gb|KJB63901.1|  hypothetical protein B456_010G022700                  47.8    0.001   Gossypium raimondii
gb|AFP73361.1|  cysteine protease                                     47.8    0.001   Solanum chilense
ref|XP_004506025.1|  PREDICTED: vignain-like                          47.8    0.001   
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1           47.8    0.001   
gb|AFP73332.1|  cysteine protease                                     47.8    0.001   
gb|AGV15823.1|  cysteine protease CP15                                47.8    0.001   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  47.8    0.001   



>gb|KHG12401.1| hypothetical protein F383_03889 [Gossypium arboreum]
Length=497

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE+N KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKNQKVYRQAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>gb|AAO18731.1| cysteine protease [Gossypium hirsutum]
Length=389

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>gb|KJB66816.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=457

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>gb|KJB66817.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=484

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>gb|KJB66815.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=496

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>gb|KJB66818.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
 gb|KJB66819.1| hypothetical protein B456_010G159600 [Gossypium raimondii]
Length=497

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+VL +F++WKE++ KVYR  EE E+RF+NFKGNLKY+ E+    + ++WE  VGLN
Sbjct  40   LSEERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADMSNE  107



>ref|XP_007025363.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao]
 gb|EOY27985.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao]
Length=501

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
             VFLI+A+  C   S   +   +      F+ +E+V+ +F +WKE++ KVY+  EE E+R
Sbjct  10   FVFLILASRTCLSSSLPTEYSILEHDLDAFLSDERVVEIFRQWKEKHQKVYKHVEEAEKR  69

Query  332  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            F+NFKGNLKY+ E+    + +    +VGLNKFAD  NE
Sbjct  70   FENFKGNLKYILERNAKRKSTEGGHRVGLNKFADMSNE  107



>ref|XP_010999738.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=508

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+E ++ +F+ W++R+ KVY+  EE E+RF NFK NLKY+ EKT  G+ +    KVGLNK
Sbjct  47   PDESIIEIFQRWRDRHQKVYKHAEEAEKRFGNFKRNLKYIIEKT--GKETTLRHKVGLNK  104

Query  425  FADSRNE  445
            FAD  NE
Sbjct  105  FADLSNE  111



>gb|ABQ10203.1| cysteine protease Cp5 [Actinidia deliciosa]
Length=509

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V+ LF++W E++GKVY+  +E E++FQNF+ NL+YV EK  G RG+     VGLN
Sbjct  42   IAEERVVELFKKWTEKHGKVYKHGQEVEKKFQNFRDNLRYVMEKN-GERGASGGHLVGLN  100

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  101  KFADMSNE  108



>ref|XP_002305743.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa]
 gb|EEE86254.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa]
Length=506

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+E ++ +F++W++R+ K Y+  EE E+RF NFK NLKY+ EKT  G+ +    +VGLNK
Sbjct  47   PDESIIEIFQQWRDRHQKAYKHAEEAEKRFGNFKRNLKYIIEKT--GKETTLRHRVGLNK  104

Query  425  FADSRNE  445
            FAD  NE
Sbjct  105  FADLSNE  111



>emb|CDO96804.1| unnamed protein product [Coffea canephora]
Length=506

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V  +F+EWKE++GKVY+  +E E+RFQNF+ NLKY+ EK    R S     VGLN
Sbjct  46   LSEERVAEIFQEWKEKHGKVYKHVQEAEKRFQNFRKNLKYIVEKN-SMRQSNSGHVVGLN  104

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  105  KFADMSNE  112



>ref|XP_002317417.2| hypothetical protein POPTR_0011s07300g [Populus trichocarpa]
 gb|EEE98029.2| hypothetical protein POPTR_0011s07300g [Populus trichocarpa]
Length=498

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
              +FL++A + C       +   ++      + EE +  +F+ WKE++ KVY+  EE E 
Sbjct  10   LFIFLLLAPLACLSSGLPGEYSTVSNDLHEGLTEEGITEVFKLWKEKHQKVYKHAEEAER  69

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R  NFK NLKY+ EK  G R S  E KVGLNKFAD  NE
Sbjct  70   RIGNFKRNLKYIIEKN-GKRKSGLEHKVGLNKFADLSNE  107



>ref|XP_008225294.1| PREDICTED: cysteine proteinase COT44-like [Prunus mume]
Length=513

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRG---SRWEGKVGL  418
            EE+V+ LF  WK+++GKVYR  EE E RF+NFK NLK+V EKT   R    +    +VGL
Sbjct  46   EERVVELFRLWKQKHGKVYRHAEESERRFENFKRNLKFVLEKTAKKRAANNAHDSQRVGL  105

Query  419  NKFADSRNE  445
            N+FAD  NE
Sbjct  106  NRFADMSNE  114



>ref|XP_007211825.1| hypothetical protein PRUPE_ppa004381mg [Prunus persica]
 gb|EMJ13024.1| hypothetical protein PRUPE_ppa004381mg [Prunus persica]
Length=513

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRG---SRWEGKVGL  418
            EE+V+ LF  WK+++GKVYR  EE E RF+NFK NLK+V EKT   R    +    +VGL
Sbjct  46   EERVVELFRLWKQKHGKVYRQAEESERRFENFKRNLKFVLEKTAKKRAANNAHDSQRVGL  105

Query  419  NKFADSRNE  445
            N+FAD  NE
Sbjct  106  NRFADMSNE  114



>ref|XP_009613580.1| PREDICTED: low-temperature-induced cysteine proteinase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=502

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            +PEE++ +LF+EWK++ GKVY++E+E E R + F+ N+KY+ EK    R S  +  VGL 
Sbjct  41   LPEERIFQLFQEWKQKQGKVYKNEKEEEMRLEKFRRNVKYIVEKN-SKRKSDSDHLVGLT  99

Query  422  KFADSRNE  445
             FAD  NE
Sbjct  100  NFADMSNE  107



>ref|XP_011039435.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=501

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
              +FL++A + C       +   ++      + EE +  +F+ WKE++ KVY+  EE E 
Sbjct  10   LFIFLLLAPLACLSSGLPGENSTVSSDLHEGLTEEGITEVFKLWKEKHRKVYKHAEEAER  69

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R  NFK NLKY+ EK   G+ S +E KVGLNKFAD  NE
Sbjct  70   RIGNFKRNLKYIIEKNGKGK-SGFEHKVGLNKFADLSNE  107



>ref|XP_004293953.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Fragaria 
vesca subsp. vesca]
Length=519

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 3/101 (3%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
            L F I A++ C   S   +   +      F  EE+V+ LF  W+E++ KVY+  EE+E+R
Sbjct  10   LAFFICASLACLSYSLPTEYSIVGSETVNFPAEERVVELFRLWREKHRKVYKHAEEHEKR  69

Query  332  FQNFKGNLKYVKEKTVGGRGS---RWEGKVGLNKFADSRNE  445
            F+NFK NL++V EK    + +       KVGLNKFAD  NE
Sbjct  70   FENFKRNLRFVLEKHAQKKAAANKHDTQKVGLNKFADLSNE  110



>ref|XP_002533962.1| cysteine protease, putative [Ricinus communis]
 gb|EEF28418.1| cysteine protease, putative [Ricinus communis]
Length=417

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             ++FL+V  + C   +   +   +       + EE+V  LF++WKE++ KVY+  EE E+
Sbjct  9    LIIFLLVGPLTCLSFTLPDEYSIVGNDLHELLSEERVKELFQQWKEKHRKVYKHVEEAEK  68

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            R +NF+ NLKYV EK    +       VGLNKFAD  N
Sbjct  69   RLENFRRNLKYVVEKNQKKKNLGSAHTVGLNKFADMSN  106



>gb|KHN28613.1| P34 putative thiol protease [Glycine soja]
Length=294

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = +2

Query  128  CSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfV----PEEKVLRLFEEWKERNG  295
            C L+   FL+F+    VW       YD  +        +     EE V+ LF+ WKE N 
Sbjct  3    CQLKTHLFLLFI----VWGSWSFLCYDLPSEYSILALEIDKFPSEEGVVELFQRWKEENK  58

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K+YR+ EE + RF+NFK NLKY+ EK    R S +   +GLN+FAD  NE
Sbjct  59   KIYRNPEEEKLRFENFKRNLKYIVEKN-SKRISPYGQSLGLNQFADMSNE  107



>ref|XP_004233043.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
lycopersicum]
Length=480

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V +LF+EWK+++GK+Y++E+E E R +NFK N+KY+ +K    R S  +  VGLN
Sbjct  45   LTEERVFQLFQEWKQKHGKIYKNEKEEERRLENFKRNVKYIVDKN-SKRRSESDHLVGLN  103

Query  422  KFADSRNE  445
             FAD  NE
Sbjct  104  NFADMSNE  111



>ref|XP_006362442.1| PREDICTED: uncharacterized protein LOC102602011 [Solanum tuberosum]
Length=1047

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + +E V +LF+EWK+++GKVY+DE+E E R + F+ N+KY+ EK    R S  E  VGL 
Sbjct  116  ISDESVFQLFQEWKQKHGKVYKDEKEEEMRLEKFRWNVKYIVEKN-SERKSASEHFVGLT  174

Query  422  KFADSRNE  445
             FAD  NE
Sbjct  175  NFADMSNE  182



>ref|XP_006362441.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=628

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V +LF+EWK+++GK+Y++E+E E R +NFK N+KY+ +K    R S  +  VGLN
Sbjct  187  LSEERVFQLFQEWKQKHGKIYKNEKEEEMRLENFKRNVKYIVDKN-SKRRSESDHLVGLN  245

Query  422  KFADSRNE  445
             FAD  NE
Sbjct  246  NFADMSNE  253



>gb|KDO77866.1| hypothetical protein CISIN_1g043774mg [Citrus sinensis]
Length=485

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  89   KFADMSNE  96



>ref|XP_006449509.1| hypothetical protein CICLE_v10015066mg [Citrus clementina]
 gb|ESR62749.1| hypothetical protein CICLE_v10015066mg [Citrus clementina]
Length=485

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  89   KFADMSNE  96



>ref|XP_006467643.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=485

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            V EE+V  LF+ WK+++GK Y+  EE E RF+NFK NL+YV EK     G      VGLN
Sbjct  33   VSEERVFELFQRWKDKHGKAYKHTEEAERRFRNFKNNLEYVVEKKNNPGGHV----VGLN  88

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  89   KFADMSNE  96



>gb|KHN08431.1| Xylem cysteine proteinase 1 [Glycine soja]
Length=424

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 60/108 (56%), Gaps = 5/108 (5%)
 Frame = +2

Query  128  CSLQGCGFLVFLIVAA--VWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  301
            C L+   FL+FL+  +    C G+   Y   A+         EE V+ LF+ WKE N K+
Sbjct  3    CQLKTQLFLLFLVWGSWTFLCYGLPSEYSILALEIDKFPS--EEGVIELFQRWKEENKKI  60

Query  302  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            YR  ++ + RF+NFK NLKY+ EK    R S +   +GLN+FAD  NE
Sbjct  61   YRSPDQEKLRFENFKRNLKYIAEKN-SKRISPYGQSLGLNRFADMSNE  107



>ref|XP_010277012.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nelumbo 
nucifera]
Length=495

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V  LF  W+E++GKVYR  EE E RF+NFK NLKYV EK    R S     VGLN F
Sbjct  43   EERVSELFGRWREKHGKVYRHAEELERRFENFKRNLKYVMEKNSKRRSSG--HLVGLNGF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADMSNE  106



>ref|XP_002317418.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa]
 gb|EEE98030.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa]
Length=503

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            V EE ++ +F++W++R+ KVY    E E+R++NFK NLKY+ EK  G + +     VGLN
Sbjct  41   VSEESIIEIFQQWRDRHQKVYEHAAESEKRYRNFKRNLKYIIEKA-GKKTAALGHSVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADLSNE  107



>gb|ABK95906.1| unknown [Populus trichocarpa]
Length=498

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE +  +F+ WKE++ KVY+  EE E R  NFK NLKY+ EK  G R S  E KVGLN
Sbjct  41   LTEEGITEVFKLWKEKHQKVYKHAEEAERRIGNFKRNLKYIIEKN-GKRKSGLEHKVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADLSNE  107



>ref|XP_010052188.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Eucalyptus 
grandis]
Length=521

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 55/103 (53%), Gaps = 5/103 (5%)
 Frame = +2

Query  149  FLVFLIVAAVW----CGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEE  316
             LVFLI A+V        +   Y            + E +VL LF  WKE++ KVY+   
Sbjct  16   ILVFLIWASVLYLSSTSNLPSKYSIVGGENPESSLLSESRVLELFRRWKEKHNKVYKHAA  75

Query  317  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            E E+R +NFK NL+YV EK+   + S    +VGLNKFAD  NE
Sbjct  76   EAEKRLENFKRNLRYVIEKSSNLK-SPTTPRVGLNKFADLSNE  117



>gb|KCW76106.1| hypothetical protein EUGRSUZ_D00484 [Eucalyptus grandis]
Length=512

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 55/103 (53%), Gaps = 5/103 (5%)
 Frame = +2

Query  149  FLVFLIVAAVW----CGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEE  316
             LVFLI A+V        +   Y            + E +VL LF  WKE++ KVY+   
Sbjct  7    ILVFLIWASVLYLSSTSNLPSKYSIVGGENPESSLLSESRVLELFRRWKEKHNKVYKHAA  66

Query  317  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            E E+R +NFK NL+YV EK+   + S    +VGLNKFAD  NE
Sbjct  67   EAEKRLENFKRNLRYVIEKSSNLK-SPTTPRVGLNKFADLSNE  108



>ref|XP_009613579.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=505

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V +LF+EWK+R+GKVY++E+E E R   FK N+KY+ EK    + S  +  VGL 
Sbjct  44   LSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKN-SKKKSDSDHLVGLT  102

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  103  KFADMSNE  110



>gb|KDP21101.1| hypothetical protein JCGZ_21572 [Jatropha curcas]
Length=508

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E+V+ LF++WK  + K+Y+  EE E+R +NF+ NLKYV EK           KVGLNKFA
Sbjct  45   ERVIELFQQWKLEHKKIYKHAEEAEKRLENFRRNLKYVIEKNAKNAEMGTGFKVGLNKFA  104

Query  431  DSRNE  445
            D  NE
Sbjct  105  DLSNE  109



>ref|XP_003542981.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=517

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 60/108 (56%), Gaps = 5/108 (5%)
 Frame = +2

Query  128  CSLQGCGFLVFLIVAA--VWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  301
            C L+   FL+FL+  +    C G+   Y   A+         EE V+ LF+ WKE N K+
Sbjct  3    CQLKTQLFLLFLVWGSWTFLCYGLPSEYSILALEIDKFPS--EEGVIELFQRWKEENKKI  60

Query  302  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            YR  ++ + RF+NFK NLKY+ EK    R S +   +GLN+FAD  NE
Sbjct  61   YRSPDQEKLRFENFKRNLKYIAEKN-SKRISPYGQSLGLNRFADMSNE  107



>gb|AGV15822.1| cysteine protease CP14 [Nicotiana tabacum]
Length=505

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE+V +LF+EWK+R+GKVY++E+E E R   FK N+KY+ EK    + S  +  VGL 
Sbjct  44   LSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKN-SKKKSDSDHFVGLT  102

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  103  KFADMSNE  110



>ref|XP_006852404.1| hypothetical protein AMTR_s00021p00031000 [Amborella trichopoda]
 gb|ERN13871.1| hypothetical protein AMTR_s00021p00031000 [Amborella trichopoda]
Length=501

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             LVFL   A+      C +            + EE++  LFE W++R+GK+YR +EE E 
Sbjct  4    LLVFLATFALSLTSSECSFSITGYDPKD---LSEERLSSLFETWRQRHGKIYRHQEERER  60

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ F+ NL ++ + T     S+   +VGLNKFAD  N
Sbjct  61   RFQAFRENLLFI-DATNRNTSSKSRHRVGLNKFADMTN  97



>ref|XP_011039436.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus 
euphratica]
Length=499

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            V EE ++ +F +W++R+ KVY    E E+R++NFK NLKY+ EK  G + +    +VGLN
Sbjct  41   VSEENIIEIFRQWRDRHQKVYEHAAESEKRYRNFKRNLKYIIEK-AGKKTAALGHRVGLN  99

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  100  KFADLSNE  107



>ref|XP_009797427.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=502

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE++ +LF+EWK+++GK+Y +E+E E R + F+ N+KY+ EK    R S  +  VGL  F
Sbjct  43   EERIFQLFQEWKQKHGKLYNNEKEEEMRLEKFRRNVKYIVEKN-SKRKSDSDHLVGLTNF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADMSNE  107



>ref|XP_004233038.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
lycopersicum]
Length=500

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + EE V +LF+EWK+++GKVY +++E E + +NFK N+KY+ EK    R S  +  VGL 
Sbjct  44   LSEETVFQLFQEWKQKHGKVYMNKKEEEMKLENFKRNVKYIVEKN-SKRKSDSDYLVGLT  102

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  103  KFADMSNE  110



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 4/110 (4%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            MGT  SL     +V   V AV                   G+  +E+V+ ++EEW  ++G
Sbjct  1    MGTNRSLMATILIVLFTVLAVSSALDMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHG  60

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            KVY   EE E+RFQ FK NL +++E     R      KVGLN+F+D  NE
Sbjct  61   KVYNAVEEKEKRFQIFKDNLNFIEEHNAVNRTY----KVGLNRFSDLSNE  106



>ref|XP_010317333.1| PREDICTED: xylem cysteine proteinase 2-like, partial [Solanum 
lycopersicum]
Length=607

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + +E V +LF+EWK+++GKVY+DE+E E R + F+ N+KY+ EK    R S  E  VGL 
Sbjct  40   ISDESVFQLFQEWKQKHGKVYKDEKEEEMRLEKFRWNVKYIVEKN-SERKSASEHFVGLT  98

Query  422  KFADSRNE  445
             FAD  NE
Sbjct  99   NFADMSNE  106



>ref|XP_010279138.1| PREDICTED: histone-lysine N-methyltransferase SETD1B-like [Nelumbo 
nucifera]
Length=809

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNK  424
            EEKV  LF +W+E++GKVY+ E E + RF NF+ NL+YV EK    R +   G+ VGLNK
Sbjct  42   EEKVFELFGQWREKHGKVYKHEGELQWRFLNFRKNLQYVIEKNSERRST---GRFVGLNK  98

Query  425  FADSRNE  445
            FAD  NE
Sbjct  99   FADMSNE  105



>ref|XP_008371471.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=512

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (54%), Gaps = 4/102 (4%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRDEEEYEE  328
            L  LI A++ C   S   +   +        P EE+V+ LF  WK+++ KVYR   E+E 
Sbjct  10   LALLIWASLACLSSSLPSEYSIVGQEIVEHFPAEERVVELFRLWKQKHRKVYRHAGEHER  69

Query  329  RFQNFKGNLKYVKEKTV---GGRGSRWEGKVGLNKFADSRNE  445
            RF++FK NLK+V EK       + +    +VGLN FAD  NE
Sbjct  70   RFEHFKKNLKFVLEKNAKKRDAKNAHRSQRVGLNGFADMSNE  111



>ref|XP_009797432.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=505

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V ++F+EWK+++GK Y++E+E E R + FK N+KY+  K    R    +  VGL KF
Sbjct  46   EERVFQIFQEWKQKHGKFYKNEKEEEMRLEIFKTNVKYIVGKN-SKRKPDSDHLVGLTKF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADMSNE  110



>ref|XP_009350090.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=514

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  418
            EE+V+ LF  WK+++ KVYR   E+E RF++FK NLK+V EK       + +    +VGL
Sbjct  43   EERVVELFRLWKQKHRKVYRHAGEHERRFEHFKKNLKFVLEKNARKRDAKNAHRSQRVGL  102

Query  419  NKFADSRNE  445
            N FAD  NE
Sbjct  103  NGFADMSNE  111



>gb|AHM88211.1| CAC1 protein [Malus hybrid cultivar]
Length=511

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV---GGRGSRWEGKVGL  418
            EE+V+ LF  WK+++ KVYR   E+E RF++FK NLK+V EK       + +    +VGL
Sbjct  43   EERVVELFRLWKQKHRKVYRHAGEHERRFEHFKKNLKFVLEKNAKKRDAKNAHRSQRVGL  102

Query  419  NKFADSRNE  445
            N FAD  NE
Sbjct  103  NGFADMSNE  111



>ref|XP_008789986.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=496

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV-GGRGSRWEGKVGLNKF  427
            E  L LFE+W+ ++GKVYR   E   RF+NF  NL+Y++E+    G  S     VGLNKF
Sbjct  42   EHGLELFEQWRTKHGKVYRHPAEKARRFENFLRNLEYIRERNARRGTASPPGHIVGLNKF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADLSNE  107



>ref|XP_010915506.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Elaeis 
guineensis]
Length=492

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNKF  427
            E  L+LFE+W+ ++GKVY+   E   RF+NF  NL+Y++E+      S  +G  VGLNKF
Sbjct  42   EHGLKLFEQWRAKHGKVYQHPAEKARRFENFLKNLEYIRERNARRGMSSPKGHVVGLNKF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADLSNE  107



>ref|XP_002266308.2| PREDICTED: low-temperature-induced cysteine proteinase-like [Vitis 
vinifera]
Length=501

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
              EE+V  LF  WKER+ +VY+  EE  +RF+ FK NLKYV E+   G        +G+N
Sbjct  37   ASEERVRELFHLWKERHKRVYKHAEETAKRFEIFKENLKYVIERNSKGH----RHTLGMN  92

Query  422  KFADSRNE  445
            KFAD  NE
Sbjct  93   KFADMSNE  100



>ref|NP_001241331.1| uncharacterized protein LOC100811719 precursor [Glycine max]
 gb|ACU23360.1| unknown [Glycine max]
Length=362

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 4/105 (4%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            SLQ      F IV   +    +C       +     F  EE+V +LF+ W++ + + Y +
Sbjct  3    SLQRTKLFPFFIVLVSF----TCSLSLAMSSNQLEQFASEEEVFQLFQAWQKEHKREYGN  58

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            +EE  +RFQ F+ NL+Y+ E     +    + ++GLNKFAD   E
Sbjct  59   QEEKAKRFQIFQSNLRYINEMNAKRKSPTTQHRLGLNKFADMSPE  103



>gb|KDO36580.1| hypothetical protein CISIN_1g037262mg, partial [Citrus sinensis]
Length=107

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            MG   S     FL+FL   +         YD    + +      +E V+ +FE W  ++G
Sbjct  1    MGLFRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDE-VMAMFEAWLVKHG  59

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K Y    E E+RF+ FK NL+++ E     R      KVGLN+FAD  NE
Sbjct  60   KAYNALGEKEKRFEIFKENLRFIDEHNSENRTY----KVGLNRFADLTNE  105



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V+ ++EEW  ++GKVY   EE E+RFQ FK NL +++E     R      KVGLN+F
Sbjct  38   DEEVMSIYEEWLVKHGKVYNAVEEKEKRFQIFKDNLNFIEEHNAVNRTY----KVGLNRF  93

Query  428  ADSRNE  445
            +D  NE
Sbjct  94   SDLSNE  99



>ref|XP_003590277.1| Cysteine protease [Medicago truncatula]
Length=514

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  45   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERN-AMRNSPVGHHLGLNRF  103

Query  428  ADSRNE  445
            AD  NE
Sbjct  104  ADMSNE  109



>gb|KEH36599.1| papain family cysteine protease [Medicago truncatula]
Length=490

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  44   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERN-AMRNSPVGHHLGLNRF  102

Query  428  ADSRNE  445
            AD  NE
Sbjct  103  ADMSNE  108



>ref|XP_003636796.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH36607.1| papain family cysteine protease [Medicago truncatula]
Length=475

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V+ LF++WK+ + K Y   EE   R +NFK NLKY+ E+    R S     +GLN+F
Sbjct  44   EEQVVELFQQWKKEHQKFYIHPEEAALRLENFKRNLKYIVERN-AMRNSPVGHHLGLNRF  102

Query  428  ADSRNE  445
            AD  NE
Sbjct  103  ADMSNE  108



>gb|KJB69616.1| hypothetical protein B456_011G034300 [Gossypium raimondii]
Length=341

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 14/99 (14%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            +L  L +  +W    S               +PE  +   FE+W    G+VY+D  E ++
Sbjct  7    YLALLFILGIWVSQAS------------SRSIPEVSMSDRFEQWMASYGRVYQDPSEKDK  54

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK N++Y++    G    ++  K+G+N+F D  NE
Sbjct  55   RFQIFKENVEYIESHNAGHTAKKY--KLGVNEFTDLTNE  91



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 11/105 (10%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            S     F  F+I A +  G  +C         A    +PE  +    E+W  + G+VY+D
Sbjct  19   STTNMAFKHFMIAALILLGAWAC--------QATSRTLPEASMFERHEQWMIQYGRVYKD  70

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            E E   RFQ F  N+K+++E    GR S    K+ +N+FAD  NE
Sbjct  71   EAEKSVRFQIFMDNVKFIEEFNKDGRQSY---KLAVNEFADQTNE  112



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + +E +LR  E+W  + G+VY+D  E E RFQ F+GN +Y+  +++   G R + K+GLN
Sbjct  15   IADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYI--ESINRAGDR-KYKLGLN  71

Query  422  KFADSRNE  445
            +FAD  NE
Sbjct  72   QFADMTNE  79



>gb|KHN48002.1| P34 putative thiol protease [Glycine soja]
Length=336

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V +LF+ W++ + + Y ++EE  +RFQ F+ NL+Y+ E     +    + ++GLNKF
Sbjct  12   EEEVFQLFQAWQKEHKREYGNQEEKAKRFQIFQSNLRYINEMNAKSKSPTTQHRLGLNKF  71

Query  428  ADSRNE  445
            AD   E
Sbjct  72   ADMSPE  77



>ref|XP_007148042.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris]
 gb|ESW20036.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris]
Length=507

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE V+ LF+ WKE + K Y   EE + R +NFK NLKY+ EK    R   +  ++GLN+F
Sbjct  56   EEGVVELFQRWKEEHLKFYNHPEEAKLRLENFKRNLKYIVEKN-AKRIYPYGHRLGLNRF  114

Query  428  ADSRNE  445
            AD  NE
Sbjct  115  ADMSNE  120



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            MG   S     FL+FL   +         YD    + +      +E V+ +FE W  ++G
Sbjct  1    MGLFRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDE-VMGMFEAWFVKHG  59

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K Y    E E+RF+ FK NL+++ E     R      KVGLN+FAD  NE
Sbjct  60   KAYNALGEKEKRFEIFKDNLRFIDEHNSENRTY----KVGLNRFADLTNE  105



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW E+NGK Y    E E RFQ FK NL+++ E     R      KV LN+F
Sbjct  44   DDEVMAIYEEWLEKNGKAYNALGEKERRFQIFKDNLRFIDEHNSENRAY----KVALNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADISNE  105



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V  L+E W  ++GK Y    E + RFQ FK NLK+V E   G R      KVGLN+F
Sbjct  40   EEQVKGLYERWLAKHGKAYNGIGEKDRRFQIFKDNLKFVDEHNSGNRTY----KVGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>gb|AGV54734.1| cysteine proteinase [Phaseolus vulgaris]
Length=385

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+VL+LF+ W++ +G+ Y + EE  +RF  F+ NL+Y+ E     R S  + ++GLNKF
Sbjct  60   EEEVLQLFQVWQKEHGREYGNPEEKTKRFHIFQRNLRYINEMN-AKRKSETQHRLGLNKF  118

Query  428  ADSRNE  445
            AD+  E
Sbjct  119  ADTSPE  124



>gb|KCW74111.1| hypothetical protein EUGRSUZ_E02751 [Eucalyptus grandis]
Length=521

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT--VGGRGSRWEGKVG  415
            V +E+ + LF  W+ ++ KVY+   E E R +NFK NL+YV E++   GG+    +  VG
Sbjct  48   VSDERAVELFRRWQAQHKKVYKHAGEAERRLENFKRNLRYVMERSRRDGGK----QHGVG  103

Query  416  LNKFADSRNE  445
            LNKFAD  NE
Sbjct  104  LNKFADLSNE  113



>ref|XP_010057104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Eucalyptus 
grandis]
 gb|KCW74112.1| hypothetical protein EUGRSUZ_E02751 [Eucalyptus grandis]
Length=521

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT--VGGRGSRWEGKVG  415
            V +E+ + LF  W+ ++ KVY+   E E R +NFK NL+YV E++   GG+    +  VG
Sbjct  48   VSDERAVELFRRWQAQHKKVYKHAGEAERRLENFKRNLRYVMERSRRDGGK----QHGVG  103

Query  416  LNKFADSRNE  445
            LNKFAD  NE
Sbjct  104  LNKFADLSNE  113



>ref|XP_004504420.1| PREDICTED: P34 probable thiol protease-like [Cicer arietinum]
Length=364

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E V  LF+ WK+ +G+ Y ++EE E RF+ FK NL+Y+ E     R S  + ++GLNKF 
Sbjct  47   EDVFELFQMWKKEHGREYGNKEEMENRFEIFKSNLRYINEMN-AKRNSPLQHRLGLNKFG  105

Query  431  DSRNE  445
            D   E
Sbjct  106  DMSPE  110



>gb|AAQ55450.1| 34 kDa maturing seed vacuolar thiol protease precursor [Glycine 
max]
Length=165

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct  37   QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF  95

Query  428  AD  433
            AD
Sbjct  96   AD  97



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 9/115 (8%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVS---CYYDgfai--agagggfVPEEKVLRLFEEW  280
            MG +        L  L+++A+ C  +      YD      + +      +++V+ +FE W
Sbjct  1    MGNRVRSSAMAVLTVLLLSAIACSALDNSIISYDNTHPDKSSSSPNMRSDDEVMSMFESW  60

Query  281  KERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
               +GK Y    E E+RFQ FK NL+++ E     R      K+GLNKFAD  NE
Sbjct  61   LVHHGKNYNALGEKEKRFQVFKDNLRFIDEHNSEERSY----KLGLNKFADLSNE  111



>ref|XP_004486273.1| PREDICTED: P34 probable thiol protease-like [Cicer arietinum]
Length=375

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F++F  +    C G+   Y              +E + +LF++W++ +G+VY+D EE  +
Sbjct  13   FIIFTTLCLSSCYGIPTKYSSILGPNLDKLPTQQEAI-QLFQQWRKDHGRVYKDLEEMSK  71

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD-SRNE  445
            +F  F  NLKY+ E T   R S     +GL  F+D S NE
Sbjct  72   KFDIFYSNLKYITE-TNAKRKSPHGFLLGLTSFSDWSTNE  110



>ref|XP_007159458.1| hypothetical protein PHAVU_002G239300g [Phaseolus vulgaris]
 gb|ESW31452.1| hypothetical protein PHAVU_002G239300g [Phaseolus vulgaris]
Length=368

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+VL+LF+ W++ +G+ Y + EE  +RF  F+ NL+Y+ E     R S  + ++GLNKF
Sbjct  43   EEEVLQLFQVWQKEHGREYGNPEEKAKRFHIFQRNLRYINEMN-AKRKSGTQHRLGLNKF  101

Query  428  ADSRNE  445
            AD+  E
Sbjct  102  ADTSPE  107



>ref|XP_006849993.1| hypothetical protein AMTR_s00022p00166050 [Amborella trichopoda]
 gb|ERN11574.1| hypothetical protein AMTR_s00022p00166050 [Amborella trichopoda]
Length=350

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E ++ LF+ W  ++GKVYRD EE   RF+ FK N+K++ E     + S W   +GLN+F
Sbjct  40   DEGLISLFQSWASKHGKVYRDFEEKLRRFETFKDNIKHIDETNRKNK-SYW---LGLNEF  95

Query  428  ADSRNE  445
            AD  +E
Sbjct  96   ADMSHE  101



>gb|KJB69615.1| hypothetical protein B456_011G034200 [Gossypium raimondii]
Length=342

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 48/98 (49%), Gaps = 14/98 (14%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
            L  L V  +W   VS               +PE  +   FE+W    G+VY+D  E ++R
Sbjct  8    LALLFVLGIWAFQVS------------SRSIPEVSMSDKFEQWMASYGRVYQDAFEKDKR  55

Query  332  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            FQ FK N++Y++    G    ++  K+G+N+F D  NE
Sbjct  56   FQIFKENVEYIESHNAGHTAKKY--KLGVNEFTDLTNE  91



>gb|EPS62067.1| cysteine proteinase, partial [Genlisea aurea]
Length=309

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            PE++   +FE W  ++ K Y D ++   RF+ FK NLKYV+E+   G       K+GLN+
Sbjct  2    PEDETKSMFESWAAKHKKSYADSDQKARRFEIFKDNLKYVEERNAAGDRKY---KLGLNR  58

Query  425  FADSRNE  445
            F+D  NE
Sbjct  59   FSDLTNE  65



>ref|XP_003580684.2| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon]
Length=486

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   NG+ Y    E E RF+ F+ NL+YV +            ++GLN+F
Sbjct  65   EEEVRRMYVEWMAENGRTYNAIGEEERRFEVFRDNLRYVDQHNAAADAGLHSFRLGLNRF  124

Query  428  ADSRNE  445
            AD  NE
Sbjct  125  ADLTNE  130



>ref|NP_001054087.2| Os04g0650000 [Oryza sativa Japonica Group]
 dbj|BAF16001.2| Os04g0650000 [Oryza sativa Japonica Group]
Length=158

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>gb|KJB14608.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=341

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  ++GK Y    E E RFQ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFIDEHNADESQSF---KVGLNRF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADLTNE  106



>gb|EEE61807.1| hypothetical protein OsJ_16426 [Oryza sativa Japonica Group]
Length=459

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  34   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  93

Query  428  ADSRNE  445
            AD  NE
Sbjct  94   ADLTNE  99



>gb|KHN47997.1| P34 putative thiol protease [Glycine soja]
Length=380

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct  37   QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF  95

Query  428  AD  433
            AD
Sbjct  96   AD  97



>sp|P25776.2|ORYA_ORYSJ RecName: Full=Oryzain alpha chain; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABB30151.1| oryzain alpha [Oryza sativa Japonica Group]
Length=458

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa Japonica Group]
Length=458

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>dbj|BAA14402.1| oryzain alpha precursor [Oryza sativa Japonica Group]
Length=458

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>ref|XP_008796668.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=473

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V RL++ WK R+ + Y   +E E RF+ F+ NL+++ +         +  ++GL +F
Sbjct  45   EEEVRRLYQAWKARHSRSYNALDEDERRFEIFRDNLRFIDQHNAAADAGEYSFRLGLTRF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADLTNE  110



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 50/98 (51%), Gaps = 15/98 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F + L+V  VW  G +               + +E +    E+W  +NG+VY D  E E 
Sbjct  32   FELALMVLGVWVSGATA------------RGIADEPMRTKHEQWMAQNGRVYTDAAEKER  79

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ F+ N +Y+  K+V   G R + K+GLN+FAD  N
Sbjct  80   RFQIFRDNYEYI--KSVNRAGDR-KYKLGLNQFADLTN  114



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 50/98 (51%), Gaps = 15/98 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F + L+V  VW  G +               + +E +    E+W  +NG+VY D  E E 
Sbjct  6    FELALMVLGVWVSGATA------------RGIADEPMRTKHEQWMAQNGRVYTDAAEKER  53

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ F+ N +Y+  K+V   G R + K+GLN+FAD  N
Sbjct  54   RFQIFRDNYEYI--KSVNRAGDR-KYKLGLNQFADLTN  88



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E + LRL+E W   +GK Y    E E RF+ FK NLK+V +    G  S    K+GLNKF
Sbjct  53   EAETLRLYEMWLVEHGKAYNALGEKERRFEIFKDNLKFVDQHNSVGNPSY---KLGLNKF  109

Query  428  ADSRNE  445
            AD  NE
Sbjct  110  ADLSNE  115



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W  ++GKVY    E E+RFQ FK NL+++ E     R      K+GLN+F
Sbjct  44   DDEVMAIYEAWLVKHGKVYNALGEKEKRFQIFKDNLRFIDEHNAQDR----PYKLGLNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADLTNE  105



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLV-FLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERN  292
            MG++ S+     L+ F + +A     +S  YD      +   +  +++V+ ++EEW  ++
Sbjct  1    MGSQGSVMAMLLLMMFTLSSASDMSIIS--YDETHPDKSTSSWRTDDEVMAMYEEWLVKH  58

Query  293  GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            GK Y    E E RFQ FK NL+++ E       S    KVGLN+FAD  NE
Sbjct  59   GKTYNGLGEKERRFQIFKDNLRFIDEHNADESQSF---KVGLNRFADLTNE  106



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E +V+ L+E W  ++GK Y    E E+RF+ FK NLK++ E     R      K+GLN+F
Sbjct  43   ENEVMALYESWLAKHGKAYNAIGEKEKRFEIFKDNLKFIDEHNSADRSY----KLGLNRF  98

Query  428  ADSRNE  445
            AD  NE
Sbjct  99   ADLTNE  104



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  ++GK Y    E E RFQ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFIDEHNADESQSF---KVGLNRF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADLTNE  106



>gb|AAL14614.1|AF417109_1 cysteine proteinase precursor [Vasconcellea cundinamarcensis]
Length=179

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 54/107 (50%), Gaps = 8/107 (7%)
 Frame = +2

Query  125  KCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVY  304
            + SL     ++F + +A+    VS  YD      +      +++V+ ++E W  ++GKVY
Sbjct  33   RSSLSLVLLMIFTVSSAIDMSIVS--YDQKHADKSSWRT--DDEVMAMYEAWLVKHGKVY  88

Query  305  RDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
                E E+RF  FK NL+++ E            ++GLN+FAD  NE
Sbjct  89   NALGEKEKRFDIFKDNLRFIDEHN----SQNLTYRLGLNRFADLTNE  131



>ref|XP_006595983.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=250

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 8/98 (8%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F+VF + +A+    +S  +D      A      +++V+ +FEEW  ++ KVY    E E+
Sbjct  9    FMVFAVSSALDMSIIS--HDNAHADRATRRT--DDEVMSMFEEWLVKHDKVYNALGEKEK  64

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ FK NL+++ E+    R      K+GLN FAD  N
Sbjct  65   RFQIFKNNLRFIDERNSLNRTY----KLGLNVFADLTN  98



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E + LRL+E W  + GK Y    E E RF+ FK NLK+V +    G  S    K+GLNKF
Sbjct  42   EAETLRLYEMWLVKYGKAYNALGEKERRFEIFKDNLKFVDQHNSVGNPSY---KLGLNKF  98

Query  428  ADSRNE  445
            AD  NE
Sbjct  99   ADLSNE  104



>gb|ABI30276.1| VXH-C [Vasconcellea x heilbornii]
Length=282

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M T  S+     L+F+    +   G+S + D   +  +       EK +RLFE W  ++ 
Sbjct  1    MATPFSISK---LIFVATCLIVRAGLS-FADFSIVGYSQDDLTSIEKSIRLFESWMLKHD  56

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            KVY+  EE   RF+ FK NL Y+ E T     S W   +GLN+FAD  ++
Sbjct  57   KVYKSMEEKINRFEIFKDNLMYIDE-TNKKNNSYW---LGLNEFADLTHD  102



>gb|EEC78138.1| hypothetical protein OsI_17694 [Oryza sativa Indica Group]
Length=458

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKNYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>ref|XP_004485897.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=492

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E++V+ LF++WK+ + K Y   EE   R ++F+ NLKYV E+    R S    ++GLN+F
Sbjct  40   EDQVVELFQQWKKDHKKFYIHPEEAALRLESFRRNLKYVIERN-SMRNSTLGHRLGLNRF  98

Query  428  ADSRNE  445
            AD  N+
Sbjct  99   ADMSND  104



>emb|CAJ86180.1| H0212B02.7 [Oryza sativa Indica Group]
Length=470

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct  33   EEEARRLYAEWKAEHGKNYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF  92

Query  428  ADSRNE  445
            AD  NE
Sbjct  93   ADLTNE  98



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F VF + +A+    +S  YD      A      EE+++ ++E+W  ++GKVY    E E+
Sbjct  22   FTVFAVSSALDMSIIS--YDSAHADKAATLRT-EEELMSMYEQWLVKHGKVYNALGEKEK  78

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL+++ +       +    K+GLN+FAD  NE
Sbjct  79   RFQIFKDNLRFIDDHNSAEDRTY---KLGLNRFADLTNE  114



>ref|XP_003547166.1| PREDICTED: P34 probable thiol protease-like [Glycine max]
Length=369

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+ ++LF+ WK+ +G+VYRD EE  ++F+ F  N+K + E     R S     +GLN+F
Sbjct  49   QEEAMQLFQLWKKEHGRVYRDLEEMAKKFEIFVSNVKNIIESN-AKRSSPSSYLLGLNQF  107

Query  428  AD  433
            AD
Sbjct  108  AD  109



>dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  257  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADS  436
            V+ ++E W  ++GK Y    E E+RFQ FK NL+++ +   GG  +     VGLN+FAD 
Sbjct  56   VMAVYESWLAKHGKAYNALGEKEKRFQVFKDNLRFIDDHNAGGDRTY---TVGLNQFADL  112

Query  437  RNE  445
             NE
Sbjct  113  TNE  115



>emb|CAQ00105.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87864.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>ref|XP_002519955.1| cysteine protease, putative [Ricinus communis]
 gb|EEF42559.1| cysteine protease, putative [Ricinus communis]
Length=321

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + E+ ++   E+W  R+G+ Y+D EE E RFQ FK NL+Y+       + S    ++GLN
Sbjct  30   INEDALVEKHEQWMARHGRTYQDSEEKERRFQIFKSNLEYIDNFN---KASNQTYQLGLN  86

Query  422  KFADSRNE  445
             FAD  +E
Sbjct  87   NFADLSHE  94



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  257  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADS  436
            V+ ++E W  ++GK Y    E E+RFQ FK NL+++ +   GG  +     VGLN+FAD 
Sbjct  56   VMAVYESWLAKHGKAYNALGEKEKRFQVFKDNLRFIDDHNAGGDRTY---TVGLNQFADL  112

Query  437  RNE  445
             NE
Sbjct  113  TNE  115



>gb|KHN18913.1| P34 putative thiol protease [Glycine soja]
Length=354

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+ ++LF+ WK+ +G+VYRD EE  ++F+ F  N+K + E     R S     +GLN+F
Sbjct  34   QEEAMQLFQLWKKEHGRVYRDLEEMAKKFEIFVSNVKNIIESN-AKRSSPSSYLLGLNQF  92

Query  428  AD  433
            AD
Sbjct  93   AD  94



>dbj|BAA25899.1| Bd 30K [Glycine max]
 gb|ABC56139.1| 34 kDa maturing seed protein [Glycine max]
 gb|ACG59282.1| major allergen Gly m Bd 30K [Glycine max]
 gb|ACM89583.1| maturing seed protein [Glycine max]
 gb|ACO55749.1| Gly m Bd 30K allergen [Glycine max]
 gb|ADW08728.1| P34 allergen [Glycine max]
 gb|ADW08729.1| P34 allergen [Glycine max]
 gb|ADW08730.1| P34 allergen [Glycine max]
 gb|ADW08731.1| P34 allergen [Glycine max]
 gb|KHN47996.1| P34 putative thiol protease [Glycine soja]
Length=379

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
              +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLN  93

Query  422  KFAD  433
            KFAD
Sbjct  94   KFAD  97



>dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   +G  Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQHNAAADAGVHSFRLGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>gb|ABK26996.1| unknown [Picea sitchensis]
Length=367

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = +2

Query  257  VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADS  436
            ++RLF+ W  R+GK+Y   EE   R Q F+ NL+Y+       + S    ++GLNKFAD 
Sbjct  39   LVRLFDRWLGRHGKLYGSHEEKARRLQIFRTNLQYIHAHN---KNSNSSFRLGLNKFADL  95

Query  437  RNE  445
             NE
Sbjct  96   TNE  98



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
            + E  ++   E+W  ++GKVY+D+EE   RFQ FK N+++++     G  S     +G+N
Sbjct  30   LHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKNNVEFIESSNAAGNNSY---MLGIN  86

Query  422  KFADSRNE  445
            +FAD  NE
Sbjct  87   RFADLTNE  94



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 54/110 (49%), Gaps = 21/110 (19%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M ++C      F++ LIV  VW    +               + +  +    E+W  R G
Sbjct  3    MASQC------FVLKLIVLGVWVSAAT------------ARGIADVPISTRHEQWMARYG  44

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            +VY+D  E E RFQ FK N  Y+  ++V   G+R + K+GLN+FAD  NE
Sbjct  45   RVYKDAVEKERRFQIFKDNHNYI--ESVNRAGNR-KYKLGLNQFADMTNE  91



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E+V+ ++EEW  ++ KVY    E ++RF+ FK NL ++ E         +  KVGLNKFA
Sbjct  29   EEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEH----NAQNYTYKVGLNKFA  84

Query  431  DSRNE  445
            D+ NE
Sbjct  85   DTTNE  89



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E++VL L+EEW  ++GKVY    E ++RF  FK NLK++ E  V     R    +GL +F
Sbjct  47   EKEVLTLYEEWLVKHGKVYNGLGEKDKRFDIFKDNLKFIDEHNVLNSTYR----LGLTRF  102

Query  428  ADSRNE  445
            AD  NE
Sbjct  103  ADLTNE  108



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E++VL L+EEW  ++GKVY    E ++RF  FK NLK++ E  V     R    +GL +F
Sbjct  47   EKEVLTLYEEWLVKHGKVYNGLGEKDKRFDIFKDNLKFIDEHNVLNSTYR----LGLTRF  102

Query  428  ADSRNE  445
            AD  NE
Sbjct  103  ADLTNE  108



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 48/105 (46%), Gaps = 6/105 (6%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            SL     L+ L   A     +  Y D   +        PE K L  +E W  ++GK Y  
Sbjct  3    SLACMALLILLPXVAAMDVSIIDYNDKHGMTTPSDRTEPEAKAL--YESWLIKHGKNYNA  60

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
              E E RF+ FK NL+++ E  +  R      KVGLN+FAD  NE
Sbjct  61   LGEKERRFEIFKDNLRFIDEHNLQSRTY----KVGLNRFADLTNE  101



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E V+ ++E W  ++GK Y    E E RFQ FK NL+++ E     R      KVGLN+F
Sbjct  44   DEDVMAVYEAWLAKHGKSYNALGEKERRFQIFKDNLRFIDEHNAENRTY----KVGLNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADLTNE  105



>gb|EAY87283.1| hypothetical protein OsI_08685 [Oryza sativa Indica Group]
Length=357

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
            ++FL++  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  7    MLFLLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKR  66

Query  332  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            ++ FK NL+++ E T    GS W   +GLN FAD  +E
Sbjct  67   YEIFKRNLRHIVE-TNRRNGSYW---LGLNHFADIAHE  100



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E V+ ++E W  ++GK Y    E E RFQ FK NL+++ E     R      KVGLN+F
Sbjct  46   DEDVMAVYEAWLAKHGKSYNALGEKERRFQIFKDNLRFIDEHNAENRTY----KVGLNRF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADLTNE  107



>ref|NP_001047923.1| Os02g0715000 [Oryza sativa Japonica Group]
 dbj|BAD09165.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF09837.1| Os02g0715000 [Oryza sativa Japonica Group]
 dbj|BAG96580.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87483.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57683.1| hypothetical protein OsJ_08138 [Oryza sativa Japonica Group]
Length=366

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
            ++FL++  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  16   MLFLLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKR  75

Query  332  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            ++ FK NL+++ E T    GS W   +GLN FAD  +E
Sbjct  76   YEIFKRNLRHIVE-TNRRNGSYW---LGLNHFADIAHE  109



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLV-FLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERN  292
            MG++ S      LV F + +A+    +S  YD      +   +  +++V+ ++EEW  ++
Sbjct  1    MGSQRSTMAMLLLVMFTLSSALDMSIIS--YDEGHPDKSKSIWRTDDEVMAMYEEWLVKH  58

Query  293  GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            GK Y    E E RF+ FK NL+++ E       S    KVGLN+FAD  NE
Sbjct  59   GKAYNGLGEKERRFEIFKDNLRFIDEHNADDSHSF---KVGLNRFADLTNE  106



>gb|AAU81594.1| cysteine proteinase, partial [Petunia x hybrida]
Length=167

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++++ L+E W  ++GK Y   +E ++RFQ FK NL Y+ E+      S    K+GL KF
Sbjct  73   DDEIMSLYEAWLVQHGKSYNGLQEKDKRFQIFKDNLNYIDEQNSVPNKSY---KLGLTKF  129

Query  428  ADSRNE  445
            AD  NE
Sbjct  130  ADLTNE  135



>gb|KEH36581.1| papain family cysteine protease [Medicago truncatula]
Length=361

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 52/106 (49%), Gaps = 6/106 (6%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCY---YDgfaiagagggfVPEE-KVLRLFEEWKERNGK  298
            SL    FL+ +I     C   S Y       +I G     +P + K + LF+ W + +G+
Sbjct  2    SLTSNPFLLIIIFTIFLCLSSSTYGIPTKYSSILGPKLDKLPTQNKTIELFQIWMKDHGR  61

Query  299  VYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEG-KVGLNKFAD  433
            VY+D EE  ++F  F  NLKY+ E   G R S   G  +GL  FAD
Sbjct  62   VYKDLEEKAKKFDIFVSNLKYITESN-GNRKSSPHGFLLGLTNFAD  106



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  + GKVY    E E+RFQ FK NL+++ E     R      K+GLN F
Sbjct  45   DDEVMAIYEEWLVKQGKVYNALGEREKRFQVFKDNLRFIDEHNSENRTY----KLGLNGF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADLTNE  106



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F VF + +A+    +S  YD    A A      EE+++ ++E+W  ++GKVY    E E+
Sbjct  10   FTVFAVSSALDMSIIS--YDNAHAATAATLRT-EEELMSMYEQWLVKHGKVYNALGEKEK  66

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL+++ +       +    K+GLN+FAD  NE
Sbjct  67   RFQIFKDNLRFIDDHNSQEDRTY---KLGLNRFADLTNE  102



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEK-TVGGRGSRWEGKVGLNK  424
             ++V+ ++E W  ++GK Y    E E RF+ FK NL+Y+ E+  +GGR      K+GLN+
Sbjct  46   HDEVMSMYESWLMKHGKSYNALGEKERRFEIFKDNLRYIDEQNALGGRTY----KLGLNR  101

Query  425  FADSRNE  445
            FAD  NE
Sbjct  102  FADLTNE  108



>ref|XP_010091715.1| hypothetical protein L484_001478 [Morus notabilis]
 gb|EXB44999.1| hypothetical protein L484_001478 [Morus notabilis]
Length=353

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 16/100 (16%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLR-LFEEWKERNGKVYRDEEEYE  325
            FL   +V  +W     C               PEE  LR   E+W  R+G+ Y+D  E E
Sbjct  11   FLALNLVLGLWASQAEC------------RKPPEEASLRESHEQWMARHGRTYKDNAEKE  58

Query  326  ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            +R + +K NL+YVK+    G  +    K+ LN+FAD  NE
Sbjct  59   QRLKIYKENLEYVKKFNSEGNQTF---KLSLNRFADLTNE  95



>gb|KDP47124.1| hypothetical protein JCGZ_22120 [Jatropha curcas]
Length=242

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = +2

Query  245  PEEK----VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKV  412
            PEE+    V R++E W  ++GK Y    E E+RFQ FK NLK++ E     R      K+
Sbjct  39   PEERTDANVRRIYEMWLVKHGKAYNALGEKEKRFQIFKDNLKFIDEHNSVNRSY----KL  94

Query  413  GLNKFADSRNE  445
            GLN+FAD  NE
Sbjct  95   GLNRFADLSNE  105



>gb|KDP21086.1| hypothetical protein JCGZ_21557 [Jatropha curcas]
Length=151

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 18/101 (18%)
 Frame = +2

Query  149  FLVFLI-VAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYE  325
            FLVF++ +  +W     C              + EE +L+  EEW+ ++G+VY+D  E +
Sbjct  10   FLVFVLNILTIWATHTVC------------RPLNEEYMLKRHEEWRAQHGRVYKDTAEKQ  57

Query  326  ERFQNFKGNLKYVKEKTVG-GRGSRWEGKVGLNKFADSRNE  445
            +++  FK NL+ ++    G  RG     K+GLNKFAD  +E
Sbjct  58   KKYLVFKDNLERIESFNNGVDRGY----KLGLNKFADLTDE  94



>ref|XP_010919166.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=221

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE++  L+E W  ++G+ Y   EE E RF+ FK N++++              ++GLN+F
Sbjct  98   EEQMRLLYEGWLAKHGRTYNALEEKERRFEIFKDNVRFIDAHNAAADSGHHSFRLGLNRF  157

Query  428  ADSRNE  445
            AD  NE
Sbjct  158  ADITNE  163



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E+++ R++E W  R+G+ Y    E E RF+ FK NL +V          R   ++GLN+F
Sbjct  45   EDEMRRIYEGWLARHGRAYNALGEKEARFEVFKDNLHFVDGHNAAADAGRQRFRLGLNRF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADLTNE  110



>gb|KHN22490.1| Cysteine proteinase RD21a [Glycine soja]
Length=355

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 8/98 (8%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F+VF + +A+    +S  +D      A      +++V+ +FEEW  ++ KVY    E E+
Sbjct  9    FMVFAVSSALDMSIIS--HDNAHADRATRRT--DDEVMSMFEEWLVKHDKVYNALGEKEK  64

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ FK NL+++ E+    R      K+GLN FAD  N
Sbjct  65   RFQIFKNNLRFIDERNSLNRTY----KLGLNVFADLTN  98



>gb|ACU18172.1| unknown [Glycine max]
Length=355

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 8/98 (8%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F+VF + +A+    +S  +D      A      +++V+ +FEEW  ++ KVY    E E+
Sbjct  9    FMVFAVSSALDMSIIS--HDNAHADRATRRT--DDEVMSMFEEWLVKHDKVYNALGEKEK  64

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRN  442
            RFQ FK NL+++ E+    R      K+GLN FAD  N
Sbjct  65   RFQIFKNNLRFIDERNSLNRTY----KLGLNVFADLTN  98



>ref|XP_006362397.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=496

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V +LF+EWK+++GKVY+ E+E E + +NFK N+KY+ EK    R S  +  VGL KF
Sbjct  46   EERVFQLFQEWKQKHGKVYKKEKEEEVKLENFKRNVKYIVEKN-SKRKSDSDYLVGLTKF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADMSNE  110



>ref|XP_009796444.1| PREDICTED: xylem cysteine proteinase 1-like [Nicotiana sylvestris]
Length=355

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            S+     LV   ++ + C   S   D   +  +       +K++ LFE W +++GK+Y+ 
Sbjct  5    SISKLSLLVLFSISLLAC--TSFARDHSIVGYSSDDLTCIDKLINLFEHWMDKHGKIYKS  62

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
             EE   RF+ FK NLK++ E T     + W   +GLN+FAD  ++
Sbjct  63   IEEKLHRFEIFKDNLKHIDE-TNKIVSNYW---LGLNEFADLSHD  103



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V+ +++ W  ++GK Y    E E+RF+ FK NLK++ E     R      KVGLN+F
Sbjct  39   EEEVMGMYQWWMAKHGKAYNGLGEKEKRFEIFKDNLKFIDEHNAQNRTY----KVGLNRF  94

Query  428  ADSRNE  445
            AD  NE
Sbjct  95   ADLTNE  100



>ref|XP_006849990.1| hypothetical protein AMTR_s00022p00165270 [Amborella trichopoda]
 gb|ERN11571.1| hypothetical protein AMTR_s00022p00165270 [Amborella trichopoda]
Length=347

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E ++ LF+ W  ++GKVYRD EE   RF+ FK N+K++ E     + S W   +GLN+F
Sbjct  39   DEGLISLFQSWASKHGKVYRDFEEKLRRFEIFKDNIKWIDETNRENK-SYW---LGLNEF  94

Query  428  ADSRNE  445
            AD  +E
Sbjct  95   ADMSHE  100



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V+ ++ EW  ++GK Y    E E RF+ FK NLK+V E     R      KVGLN+F
Sbjct  40   DEEVMGIYAEWLAKHGKAYNGIGERERRFEIFKDNLKFVDEHNSENRSY----KVGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  ++GK Y    E E RF+ FK NL+++ E  V    S    KVGLN+F
Sbjct  44   DDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFIDEHNVDESHSF---KVGLNRF  100

Query  428  ADSRNE  445
            AD  N+
Sbjct  101  ADLTND  106



>ref|XP_010911312.1| PREDICTED: senescence-specific cysteine protease SAG39-like, 
partial [Elaeis guineensis]
Length=211

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 15/99 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F++ L+V  VW  G                 + +  V   FE+W  + G++Y D  E E 
Sbjct  6    FVIALLVFGVWSSGA------------MARAIGDAPVQAKFEQWMAKYGRLYMDATEQER  53

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK N +Y++      R      ++GLN FAD  +E
Sbjct  54   RFQIFKDNYEYIESVN---RAGNLTYRLGLNHFADMTDE  89



>dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus]
Length=365

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V   +E W  R+GK Y    E E RF+ F  NLK++ E  + G  S    KVGLN+F
Sbjct  29   DEEVRNTYELWLARHGKTYNALGEKESRFRIFADNLKFIDEHNLSGNRSY---KVGLNQF  85

Query  428  ADSRNE  445
            AD  NE
Sbjct  86   ADLTNE  91



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  ++GK Y    E E RF+ FK NL+++ E  V    S    KVGLN+F
Sbjct  44   DDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFIDEHNVDESHSF---KVGLNRF  100

Query  428  ADSRNE  445
            AD  N+
Sbjct  101  ADLTND  106



>gb|KEH30224.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRD-EEEY  322
             L FLI+ ++ C   +   +    +         +E+V  LF+ WK+ +G+ Y + EEE 
Sbjct  10   ILSFLILISITCLSFALSSEYSISSHGKLDKFSSDEEVFELFQMWKKEHGRDYANSEEEN  69

Query  323  EERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
             +RF+ FK N KY+ E     R S+ + ++ LNKFAD   E
Sbjct  70   AKRFEIFKTNFKYINEMN-AKRKSQTQHRLSLNKFADMSPE  109



>ref|XP_008796470.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=466

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V  L++ WK R  + Y   +E E RF+ F+ NL+Y+ +         +  ++GL +F
Sbjct  37   EEEVRGLYQAWKARRARSYNALDEDERRFEIFRDNLRYIDQHNAAADAGEYSFRLGLTRF  96

Query  428  ADSRNE  445
            AD  NE
Sbjct  97   ADLTNE  102



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLV-FLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERN  292
            MG++ S+     L+ F + +A     +S  YD      +   +  +++V+ ++EEW  ++
Sbjct  1    MGSQGSVMAMLLLMMFTLSSASDMSIIS--YDEAHPDKSTSSWRTDDEVMAMYEEWLVKH  58

Query  293  GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            GK Y    E E R Q FK NL+++ E       S    KVGLN+FAD  NE
Sbjct  59   GKTYNGLGEKERRLQIFKDNLRFIDEHNADESHSF---KVGLNRFADLTNE  106



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 3/110 (3%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M    +      L+FLI+++      +   D  A          + +V+ ++E W  R+G
Sbjct  1    MAITTAPTVLAALLFLILSSAALSDPASIIDYAAKGRTASAPRTDGEVVEMYELWLARHG  60

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K Y    E E RFQ FK NL+++ E       +     +GLNKFAD  N+
Sbjct  61   KAYNGLGEREMRFQVFKDNLRFIDEHNSSQNRTY---TLGLNKFADLTND  107



>gb|AHA62772.1| papain-like cysteine protease [Solanum stoloniferum]
Length=343

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHEQWMSRHGRVYKDEVEKRERFMIFKENMKFIESINKAGNLSY---KLGINE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 14/99 (14%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL FL++ A W   ++C                +E +L+  EEW  ++G+VY D +E E+
Sbjct  11   FLPFLLILAAWATKIAC-----------RPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R+  FK N++ ++       GS    K+G+NKFAD  NE
Sbjct  60   RYLIFKENIERIEAFN---NGSDRGYKLGVNKFADLTNE  95



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             ++F + +A+    +S  YD      +   +  +++V+ ++EEW  ++GK Y    E E 
Sbjct  13   LMMFTLSSALDMSIIS--YDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLGEKER  70

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RF+ FK NL+++ E  V    S    KVGLN+FAD  N+
Sbjct  71   RFKIFKDNLRFIDEHNVDESHSF---KVGLNRFADLTND  106



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V  L+EEW  ++GK+Y    E ++RFQ FK NL+++ ++    R      K+GLN+F
Sbjct  44   DEEVNSLYEEWLVKHGKLYNALGEKDKRFQIFKDNLRFIDQQNAENRTY----KLGLNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADLTNE  105



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W  ++GK Y    E E+RFQ FK NL+++ E     R      KVGLN+F
Sbjct  39   DDEVMAMYESWLVKHGKSYNAIGEKEKRFQIFKDNLRFIDEHNAESRTY----KVGLNRF  94

Query  428  ADSRNE  445
            AD  N+
Sbjct  95   ADLTND  100



>ref|XP_004171356.1| PREDICTED: cysteine proteinase RD21a-like, partial [Cucumis sativus]
Length=168

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+E+V  L+E W   +GK Y    E E RF+ FK NL+++ E     R SR   KVGL +
Sbjct  54   PDEEVAALYESWLVHHGKAYNAIGEKERRFEIFKDNLRFIDEHN---RESRTY-KVGLTR  109

Query  425  FADSRNE  445
            FAD  NE
Sbjct  110  FADLTNE  116



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 15/99 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F++ LIV  VW  G +               + +  +    E+W  + G+VY+D  E E 
Sbjct  8    FVLKLIVLGVWVSGAT------------ARGIADVPMSTRHEQWMAQYGRVYKDAVEKER  55

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK N  Y+  ++V   G+R + K+GLN+FAD  NE
Sbjct  56   RFQIFKDNSNYI--ESVNRAGNR-KYKLGLNQFADMTNE  91



>gb|ACU13684.1| unknown [Glycine max]
Length=229

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL F +  A+    ++ Y D               +V+ ++EEW  ++ KVY    E ++
Sbjct  14   FLSFTLSCAIDTSTITNYTD--------------NEVMTMYEEWLVKHQKVYNGLREKDK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL +++E       +    K+GLN+FAD  NE
Sbjct  60   RFQVFKDNLGFIQEHNNNQNNTY---KLGLNQFADMTNE  95



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E+V+ ++EEW  ++ KVY    E ++RF+ FK NL ++ E         +  KVGLNKFA
Sbjct  29   EEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEH----NAQNYTYKVGLNKFA  84

Query  431  DSRNE  445
            D  NE
Sbjct  85   DMTNE  89



>ref|XP_008782844.1| PREDICTED: xylem cysteine proteinase 1-like [Phoenix dactylifera]
Length=347

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
             +K++ LFE W  ++ KVY+  EE   RF+ FK NLK++ E T   R S W   +GLN+F
Sbjct  39   HDKLIELFESWMSKHSKVYKSFEEKLRRFEVFKDNLKHIDE-TNKKRSSYW---LGLNEF  94

Query  428  AD  433
            AD
Sbjct  95   AD  96



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V  L+EEW  ++GK+Y    E ++RFQ FK NL+++ ++    R      K+GLN+F
Sbjct  33   DEEVNSLYEEWLVKHGKLYNALGEKDKRFQIFKDNLRFIDQQNAENRTY----KLGLNRF  88

Query  428  ADSRNE  445
            AD  NE
Sbjct  89   ADLTNE  94



>ref|XP_003559142.1| PREDICTED: oryzain alpha chain-like [Brachypodium distachyon]
Length=106

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
             EE+  R+F EW   +GK Y    E E R+  FKGNL+ + +            ++GLN 
Sbjct  34   SEEETRRMFLEWMATHGKTYSSAGEEERRYAVFKGNLRLIDQHNAAADAGVHSYRLGLNS  93

Query  425  FADSRNE  445
            F+D  +E
Sbjct  94   FSDLTHE  100



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT-VGGRGSRWEGKVGLNK  424
            +++   LFE W   +GK Y    E E+RFQ FK NL+Y+ E+  V  RG     K+GLNK
Sbjct  38   DDEATTLFESWLVTHGKSYNALGEEEKRFQIFKNNLRYIDEQNLVEDRGF----KLGLNK  93

Query  425  FADSRNE  445
            FAD  NE
Sbjct  94   FADLTNE  100



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ L+E W   +GK Y   +E ++RFQ FK NL+Y+ E+      S    K+GL KF
Sbjct  47   DDEVMSLYESWLLEHGKSYNALDEKDKRFQIFKDNLRYIDEQNSVPNKSY---KLGLTKF  103

Query  428  ADSRNE  445
            AD  NE
Sbjct  104  ADLTNE  109



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (51%), Gaps = 15/99 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F++ LIV  VW  G                 + +  +    E+W  + G+VY+D  E E 
Sbjct  6    FVLALIVLGVWVFGA------------MARGIADVPMSTRHEQWMAQYGRVYKDAAEKER  53

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK N  Y+  ++V   G+R + K+GLN+FAD  NE
Sbjct  54   RFQIFKDNCNYI--ESVNRAGNR-KYKLGLNQFADMTNE  89



>emb|CAA53377.1| cysteine protease [Vicia sativa]
Length=368

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            ++V+ ++EEW  ++ KVY    E ++RFQ FK NL ++ E         +   VGLNKFA
Sbjct  33   DEVMTMYEEWLVKHQKVYNGLREKDQRFQIFKDNLNFIDEH----NAQNYTYIVGLNKFA  88

Query  431  DSRNE  445
            D  NE
Sbjct  89   DMTNE  93



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V+ ++E W  ++GK Y    E E+RF+ FK NL+Y++E+      +    K+GLN+F
Sbjct  48   DEEVMSMYESWMVKHGKSYNALGEKEKRFEIFKDNLRYIEEQNAMPNRTY---KLGLNRF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADLSNE  110



>gb|AFJ15103.1| mexicain-like cystein protease, partial [Jacaratia mexicana]
Length=348

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M T CS+    F+   ++  V   G+S   D   +  +       E+++RLFE W  ++ 
Sbjct  1    MTTICSISKLIFVATCLIVHV---GLSSA-DFSIVGYSQDDLTSTERLIRLFESWMLKHD  56

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            +VY + EE   RF+ FK NL Y+ E T     S W   +GLN+F D  ++
Sbjct  57   RVYNNIEEKIHRFEIFKDNLMYIDE-TNKKNNSYW---LGLNEFVDLTHD  102



>ref|XP_009599970.1| PREDICTED: xylem cysteine proteinase 1-like [Nicotiana tomentosiformis]
Length=355

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            S+     LV   ++ + C   S   D   +  +       +K++ LFE W +++GK+Y+ 
Sbjct  5    SISKLSLLVLFSISLLAC--TSFARDHSIVGYSSDDLTCIDKLINLFEHWMDKHGKIYKS  62

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
             EE   RF+ FK NLK++ E T     + W   +GLN+FAD  ++
Sbjct  63   IEEKLRRFEIFKDNLKHIDE-TNKIVSNYW---LGLNEFADLSHD  103



>gb|AHA62773.1| papain-like cysteine protease [Solanum demissum]
 gb|AHA62775.1| papain-like cysteine protease [Solanum verrucosum]
Length=344

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  32   PKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSY---KLGINE  88

Query  425  FADSRNE  445
            FAD  +E
Sbjct  89   FADITSE  95



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+E+V  L+E W   +GK Y    E E RF+ FK NL+++ E     R SR   KVGL +
Sbjct  54   PDEEVAALYESWLVHHGKAYNAIGEKERRFEIFKDNLRFIDEHN---RESRTY-KVGLTR  109

Query  425  FADSRNE  445
            FAD  NE
Sbjct  110  FADLTNE  116



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E+W  ++GK Y    E E RF+ FK NL+++ E     R  R    VGLN+F
Sbjct  35   DDEVMAIYEDWLVKHGKAYNSLGEKERRFEVFKDNLRFIDEHNSENRTYR----VGLNRF  90

Query  428  ADSRNE  445
            AD  NE
Sbjct  91   ADLTNE  96



>gb|KHN27075.1| Cysteine proteinase RD21a [Glycine soja]
Length=368

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL F +  A+    ++ Y D               +V+ ++EEW  ++ KVY    E ++
Sbjct  14   FLSFTLSCAIDTSTITNYTD--------------NEVMTMYEEWLVKHQKVYNGLGEKDK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL +++E       +    K+GLNKFAD  NE
Sbjct  60   RFQVFKDNLGFIQEHNNNQNNTY---KLGLNKFADMTNE  95



>gb|AHA62774.1| papain-like cysteine protease [Solanum demissum]
Length=344

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  32   PKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSY---KLGINE  88

Query  425  FADSRNE  445
            FAD  +E
Sbjct  89   FADITSE  95



>ref|XP_003550041.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=366

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL F +  A+    ++ Y D               +V+ ++EEW  ++ KVY    E ++
Sbjct  14   FLSFTLSCAIDTSTITNYTD--------------NEVMTMYEEWLVKHQKVYNGLGEKDK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL +++E       +    K+GLNKFAD  NE
Sbjct  60   RFQVFKDNLGFIQEHNNNQNNTY---KLGLNKFADMTNE  95



>ref|XP_006362429.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSY---KLGINE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 5/99 (5%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL+FL   +         YD    + +      +E V+ +FE W  ++GK Y    E E+
Sbjct  12   FLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDE-VMAMFEAWLVKHGKAYNALGEKEK  70

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RF+ FK NL+++ E     R      KVGLN+FAD  NE
Sbjct  71   RFEIFKENLRFIDEHNSENRTY----KVGLNRFADLTNE  105



>gb|AHA62776.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K++      G  S    K+G+N+
Sbjct  31   PKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIDSINKAGNLSY---KLGINE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>sp|O23791.1|BROM1_ANACO RecName: Full=Fruit bromelain; AltName: Allergen=Ana c 2; Flags: 
Precursor [Ananas comosus]
 dbj|BAA21849.1| bromelain [Ananas comosus]
Length=351

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 18/106 (17%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M +K  L      +FL + A+W    +   D            P + +++ FEEW    G
Sbjct  1    MASKVQL----VFLFLFLCAMWASPSAASRDE-----------PNDPMMKRFEEWMAEYG  45

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  433
            +VY+D++E   RFQ FK N+K++  +T   R       +G+N+F D
Sbjct  46   RVYKDDDEKMRRFQIFKNNVKHI--ETFNSRNEN-SYTLGINQFTD  88



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W   +GK Y    E E RFQ FK NL+Y+ E+           K+GLN+F
Sbjct  47   DDEVMSMYEGWLAEHGKAYNALGEKERRFQIFKDNLRYIDEQ----NSKNLSYKLGLNRF  102

Query  428  ADSRNE  445
            AD  NE
Sbjct  103  ADLSNE  108



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 5/99 (5%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F +F + +A+    +S Y D   +  +   +  +E+V+ ++E W  ++GK Y    E E 
Sbjct  15   FAIFTLSSALDMSIIS-YDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLGEKER  73

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL+Y+ +            K+GLN+FAD  N+
Sbjct  74   RFQIFKDNLRYIDDH----NAKNLSYKLGLNRFADLSND  108



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W   +GK Y    E E RFQ FK NL+Y+ E+           K+GLN+F
Sbjct  49   DDEVMSIYEGWLAEHGKAYNALGEKERRFQIFKDNLRYIDEQ----NSKNLSYKLGLNRF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADLSNE  110



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEK-TVGGRGSRWEGKVGLNK  424
            E ++ R++E W  ++GK Y    E E+RF+ FK NLK+++E  +V G       KVGLN+
Sbjct  153  ETQIRRMYETWLVKHGKAYNGLGEKEKRFEIFKDNLKFIEEHNSVNG-----TYKVGLNR  207

Query  425  FADSRNE  445
            FAD  NE
Sbjct  208  FADLTNE  214



>ref|XP_006647791.1| PREDICTED: xylem cysteine proteinase 1-like [Oryza brachyantha]
Length=369

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +2

Query  152  LVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEER  331
            ++FL +  V C   + ++D   +  +        K++ LF  W  ++ K+Y   +E  +R
Sbjct  17   MLFLFLCFVACVATASHHDPSVVGYSQEDLALPNKLVDLFTSWSVKHRKIYGSPKEKVKR  76

Query  332  FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            ++ FK NLK++ E T    GS W   +GLN+FAD  +E
Sbjct  77   YEIFKQNLKHIVE-TNRRNGSYW---LGLNQFADIAHE  110



>ref|XP_010927504.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=468

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V RL++ WK R  +     +E E RF+ F+ NL+++ +         +  ++GLN+F
Sbjct  41   EEEVRRLYQAWKARYSRSNNALDEDERRFEIFRDNLRFIDQHNAAADAGVYSFRLGLNRF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADLTNE  106



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 5/99 (5%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F +F + +A+    +S Y D   +  +   +  +E+V+ ++E W  ++GK Y    E E 
Sbjct  15   FAIFTLSSALDMSIIS-YDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLGEKER  73

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL+Y+ +            K+GLN+FAD  N+
Sbjct  74   RFQIFKDNLRYIDDH----NAKNLSYKLGLNRFADLSND  108



>dbj|BAH11164.1| cysteine protease [Hordeum vulgare]
Length=462

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   +   Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  35   EEEVRRMYAEWMAEHHSTYNPIGEEERRFEAFRNNLRYIDQHNAAADAGVHSFRLGLNRF  94

Query  428  ADSRNE  445
            AD  NE
Sbjct  95   ADLTNE  100



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E +   L+E W  ++GK Y    E E RF+ FK NL+++ E  +  R S    KVGLN+F
Sbjct  34   ETEAKALYESWLIKHGKNYNALGEKERRFEIFKDNLRFIDEHNIQSRTS----KVGLNRF  89

Query  428  ADSRNE  445
            AD  NE
Sbjct  90   ADLTNE  95



>ref|NP_001275606.1| fruit bromelain-like precursor [Solanum tuberosum]
 gb|AHA62777.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E+W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSY---KLGVNE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>gb|KHN30007.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL F +  A+    ++ Y D               +V+ ++EEW  ++ KVY    E ++
Sbjct  14   FLSFTLSCAIDTSTITNYTD--------------NEVMTMYEEWLVKHQKVYNGLREKDK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL +++E       +    K+GLN+FAD  NE
Sbjct  60   RFQVFKDNLGFIQEHNNNQNNTY---KLGLNQFADMTNE  95



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 7/69 (10%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEE---EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGL  418
            +++V+ ++EEW  +NGK + +     E E RFQ FK NL+++ E     R      KVGL
Sbjct  44   DDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRFIDEHNSENRSY----KVGL  99

Query  419  NKFADSRNE  445
            N+FAD  NE
Sbjct  100  NRFADLTNE  108



>ref|XP_003293312.1| hypothetical protein DICPUDRAFT_41833 [Dictyostelium purpureum]
 gb|EGC30167.1| hypothetical protein DICPUDRAFT_41833 [Dictyostelium purpureum]
Length=352

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +2

Query  266  LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            LF  W ++NGK+Y   EE+E+RF NFK NLK ++      +G   +   G+NK++D   E
Sbjct  38   LFHHWTKQNGKIYETSEEFEKRFSNFKTNLKKIENLNNLHKG---KASFGMNKYSDLSEE  94



>ref|XP_010436251.1| PREDICTED: xylem cysteine proteinase 1-like, partial [Camelina 
sativa]
Length=306

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 6/106 (6%)
 Frame = +2

Query  128  CSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYR  307
             SL     L+ +  +A+ C  ++  +D   +          EK+L LFE W   + K Y 
Sbjct  2    ASLTKFSLLIAISASALLCSALA--HDFSIVGYTPEHLTSTEKLLELFESWMSEHSKAYN  59

Query  308  DEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
              EE   RF+ F+ NL ++ ++      S W   +GLN+FAD  +E
Sbjct  60   SVEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLSHE  101



>gb|AES64023.2| papain family cysteine protease [Medicago truncatula]
Length=374

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 5/103 (5%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCY---YDgfaiagagggfVP-EEKVLRLFEEWKERNGKVYRDEE  316
            FL+F+I   + C   S Y       +I G     +P ++K + +F+ W + +G+VY+D +
Sbjct  9    FLIFIIFTTILCLPSSTYGIPTKYSSIMGPNLDKLPTQDKTIEIFQLWMKEHGRVYKDLD  68

Query  317  EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            E  ++F  F  NLKY+ E T   R S     +GL  F D  +E
Sbjct  69   EMAKKFDIFISNLKYITE-TNAKRKSSNGFLLGLTNFTDWSSE  110



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W   +GK Y    E E RFQ FK NL+Y+ E+           K+GLN+F
Sbjct  50   DDEVMSIYEGWLXEHGKAYNALGEKERRFQIFKDNLRYIDEQ----NSKNLSYKLGLNRF  105

Query  428  ADSRNE  445
            AD  NE
Sbjct  106  ADLSNE  111



>ref|XP_003547817.1| PREDICTED: cysteine proteinase RD21a [Glycine max]
Length=366

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            FL F +  A+    ++ Y D               +V+ ++EEW  ++ KVY    E ++
Sbjct  14   FLSFTLSCAIDTSTITNYTD--------------NEVMTMYEEWLVKHQKVYNGLREKDK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL +++E       +    K+GLN+FAD  NE
Sbjct  60   RFQVFKDNLGFIQEHNNNQNNTY---KLGLNQFADMTNE  95



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W  ++GK Y    E E+RFQ FK NL+++ E       S    KVGLN+F
Sbjct  43   DDEVMAMYESWLVKHGKSYNALGEKEKRFQIFKDNLRFIDEHNAEENLSY---KVGLNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADLTNE  105



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V  L+E W  ++GK Y    E + RF  FK NLK+V +   G R      +VGLNKF
Sbjct  38   DEQVKGLYESWLAKHGKAYNGIGEKDRRFDIFKDNLKFVDDHNSGNRTY----EVGLNKF  93

Query  428  ADSRNE  445
            AD  NE
Sbjct  94   ADLTNE  99



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ L+E W   +GK Y   +E ++RFQ FK NL+Y+ E+      S    K+GL KF
Sbjct  43   DDEVMSLYESWLVEHGKSYNALDEKDKRFQIFKENLRYIDEQNSVPNKSY---KLGLTKF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADLTNE  105



>ref|XP_007212679.1| hypothetical protein PRUPE_ppa018439mg, partial [Prunus persica]
 gb|EMJ13878.1| hypothetical protein PRUPE_ppa018439mg, partial [Prunus persica]
Length=153

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E+ + + FEEW  ++G+VY+D +E E R+  FK N+++++       G ++   + +NKF
Sbjct  25   EKNMFQRFEEWMTKHGRVYKDAQEKELRYDIFKSNVEFIEAFNKNKDGRKY--TLSINKF  82

Query  428  ADSRNE  445
            AD +NE
Sbjct  83   ADRKNE  88



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (56%), Gaps = 9/99 (9%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F VF + +A+    +S  YD    A +      +E+++ ++E+W  ++GKVY    E E+
Sbjct  45   FTVFAVSSALDMSIIS--YDNAHAATSRS----DEELMSMYEQWLVKHGKVYNALGEKEK  98

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK NL+++ +       +    K+GLN+FAD  NE
Sbjct  99   RFQIFKDNLRFIDDHNSQEDRTY---KLGLNRFADLTNE  134



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++EEW  ++GK Y    E E RF+ FK NL+++ E       S    KVGLN+F
Sbjct  44   DDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFIDEHNANESHSF---KVGLNRF  100

Query  428  ADSRNE  445
            AD  N+
Sbjct  101  ADLTND  106



>ref|XP_002869093.1| hypothetical protein ARALYDRAFT_491113 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45352.1| hypothetical protein ARALYDRAFT_491113 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (49%), Gaps = 6/105 (6%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            SL     LV +  +A+ C  ++   D   +          EK+L LFE W   + KVY+ 
Sbjct  7    SLTKFSLLVAISASALLCSALA--RDFSIVGYTPEQLTSTEKLLELFESWMSEHSKVYKS  64

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
             EE   RF+ F+ NL ++ ++      S W   +GLN+FAD  +E
Sbjct  65   VEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFADLTHE  105



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            + +V+ L+E W  ++GK Y    E E RF  FK NL+++ E   G R       +GLN+F
Sbjct  46   DAEVMALYESWLVKHGKAYNALGEKERRFDIFKDNLRFIDEHNSGNRTY----TLGLNRF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADLTNE  107



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            + +V+ L+E W  ++GK Y    E E RF  FK NL+++ E   G R       +GLN+F
Sbjct  46   DAEVMALYESWLVKHGKAYNALGEKERRFDIFKDNLRFIDEHNSGNRTY----TLGLNRF  101

Query  428  ADSRNE  445
            AD  NE
Sbjct  102  ADLTNE  107



>ref|XP_010928427.1| PREDICTED: xylem cysteine proteinase 2-like [Elaeis guineensis]
Length=351

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+++ LFE W  ++ K Y + EE   RF+ FK NLK++ E T   R S W   +GLN+F
Sbjct  38   QERLIDLFETWMAKHSKSYANLEEKLRRFEIFKDNLKHIDE-TNKKRSSYW---LGLNEF  93

Query  428  ADSRNE  445
            AD  +E
Sbjct  94   ADMSHE  99



>ref|XP_010091714.1| Fruit bromelain [Morus notabilis]
 gb|EXB44998.1| Fruit bromelain [Morus notabilis]
Length=621

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 49/105 (47%), Gaps = 14/105 (13%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRD  310
            +L+G    + L+V  +W     C              + E  +    E+W  R+G+VY+D
Sbjct  4    TLEGTTIFLALLVLGIWASQADC-----------RRPLDEASIRAKHEQWMARHGRVYKD  52

Query  311  EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
              E EER + FK N++YVK        +    K+ +N+FAD  N+
Sbjct  53   NAEKEERLKIFKENMEYVKNFNSQKNQTF---KLSINRFADLTNK  94



>ref|NP_001149658.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG36262.1| cysteine protease 1 precursor [Zea mays]
Length=469

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  R++ EW   +G+ Y    E E RF+ F+ NL+YV              ++GLN+F
Sbjct  39   EEEARRMYAEWMAAHGRTYNAVGEEERRFEVFRDNLRYVDAHNAAADAGVHSFRLGLNRF  98

Query  428  ADSRNE  445
            AD  N+
Sbjct  99   ADLTND  104



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +E+V+ L+EEW  ++GK Y    E ++RF+ FK NL+Y+ E+      SR   ++GLN+F
Sbjct  40   DEEVMALYEEWLVKHGKSYNGLGEKDKRFEIFKDNLRYIDEQN--SLPSRTY-QLGLNRF  96

Query  428  ADSRNE  445
            AD  NE
Sbjct  97   ADLSNE  102



>gb|AFP73359.1| cysteine protease, partial [Solanum chilense]
Length=345

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            PE  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE  87

Query  425  FADSRNE  445
            FAD  ++
Sbjct  88   FADITSQ  94



>gb|AFW59668.1| LOW QUALITY PROTEIN: cysteine protease 1 [Zea mays]
Length=469

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  R++ EW   +G+ Y    E E RF+ F+ NL+YV              ++GLN+F
Sbjct  39   EEEARRMYAEWMAAHGRTYNAVGEEERRFEVFRDNLRYVDAHNAAADAGVHSFRLGLNRF  98

Query  428  ADSRNE  445
            AD  N+
Sbjct  99   ADLTND  104



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ L+E W   + KVY    E ++RFQ FK NLKY+ E       S    K+GL KF
Sbjct  47   DDEVMSLYESWLVEHKKVYNALGEKDKRFQIFKDNLKYIDEHNAMPEKSY---KLGLTKF  103

Query  428  ADSRNE  445
            AD  NE
Sbjct  104  ADLTNE  109



>emb|CDP18154.1| unnamed protein product [Coffea canephora]
Length=352

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            +K++ LFE W +++GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  42   DKLINLFESWIQKHGKIYESIEEKLHRFEIFKDNLKHIDERN-KDIANYW---LGLNEFA  97

Query  431  DSRNE  445
            D  +E
Sbjct  98   DLSHE  102



>gb|AFP73362.1| cysteine protease [Solanum chilense]
Length=344

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            PE  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE  87

Query  425  FADSRNE  445
            FAD  ++
Sbjct  88   FADITSQ  94



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (53%), Gaps = 14/99 (14%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F+ FL++ A W   ++C                +E +L+  EEW  ++G+VY D +E E+
Sbjct  11   FVPFLLILAAWATKIAC-----------RPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEK  59

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R+  FK N++ ++       GS    K+G+NKFAD  NE
Sbjct  60   RYLIFKENIERIEAFN---NGSDRGYKLGVNKFADLTNE  95



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E++V  +FE W  ++GK Y   +E ++RF+ F+ NLKY+ EK      S    K+GLN+F
Sbjct  43   EDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSY---KLGLNRF  99

Query  428  ADSRNE  445
            AD  NE
Sbjct  100  ADITNE  105



>ref|XP_010276986.1| PREDICTED: ervatamin-B-like [Nelumbo nucifera]
Length=360

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE V  +FE W E++GKVY   EE + RF+ F+ NL Y+       + S  +  +GLN+F
Sbjct  46   EEGVALIFERWTEKHGKVYTSTEEKDRRFKIFQSNLAYIINWN--SKRSPTDHTMGLNQF  103

Query  428  AD  433
            +D
Sbjct  104  SD  105



>gb|AFP73327.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            PE  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE  87

Query  425  FADSRNE  445
            FAD  ++
Sbjct  88   FADITSQ  94



>sp|P00784.1|PAPA1_CARPA RecName: Full=Papain; AltName: Full=Papaya proteinase I; Short=PPI; 
AltName: Allergen=Car p 1; Flags: Precursor [Carica papaya]
 gb|AAB02650.1| papain precursor [Carica papaya]
 gb|AAA72774.1| papain [synthetic construct]
 prf||1303270A papain
Length=345

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E++++LFE W  ++ K+Y++ +E   RF+ FK NLKY+ E T     S W   +GLN FA
Sbjct  42   ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDE-TNKKNNSYW---LGLNVFA  97

Query  431  DSRNE  445
            D  N+
Sbjct  98   DMSND  102



>ref|XP_010928804.1| PREDICTED: xylem cysteine proteinase 1-like [Elaeis guineensis]
Length=347

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
             ++++ LFE W  ++ KVY+  EE   RF+ FK NLK++ E T   + S W   +GLN+F
Sbjct  38   HDRLIELFESWMSKHSKVYKSFEEKLRRFEVFKDNLKHIDE-TNKKKSSYW---LGLNEF  93

Query  428  ADSRNE  445
            AD  +E
Sbjct  94   ADLSHE  99



>gb|AAP41846.1| cysteine protease [Anthurium andraeanum]
Length=502

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  266  LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNKFADSRN  442
            LFE W E++ KVY    E   R+ NF  NL +V+++   GR +   G+ VG+N FAD  N
Sbjct  50   LFERWMEKHRKVYAHPGEKARRYANFLSNLAFVRKRNAEGRRAPSSGQGVGMNVFADLSN  109

Query  443  E  445
            E
Sbjct  110  E  110



>sp|P22895.1|P34_SOYBN RecName: Full=P34 probable thiol protease; Flags: Precursor [Glycine 
max]
Length=379

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
              +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMN-ANRKSPHSHRLGLN  93

Query  422  KFAD  433
            KFAD
Sbjct  94   KFAD  97



>ref|NP_001238219.1| P34 probable thiol protease precursor [Glycine max]
 gb|AAB09252.1| 34 kDa maturing seed vacuolar thiol protease precursor [Glycine 
max]
Length=379

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +2

Query  242  VPEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN  421
              +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLN
Sbjct  35   TTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMN-ANRKSPHSHRLGLN  93

Query  422  KFAD  433
            KFAD
Sbjct  94   KFAD  97



>ref|XP_007136708.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
Length=373

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 5/111 (5%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCG-GVSCYYDgfaiagagggfVPEEKVLRLFEEWKERN  292
            MG   S      +VF  V AV     +S                 +E+V  ++EEW  ++
Sbjct  1    MGKSRSSTPTILIVFFTVLAVSSALDMSIISYDRTTHADKTERRSDEEVRSIYEEWLVKH  60

Query  293  GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            GKV       E+RFQ FK NLK++ +     R      KVGLN+FAD  N+
Sbjct  61   GKVPSTLALKEKRFQIFKDNLKFIDDHNAENRTY----KVGLNRFADLSND  107



>ref|XP_010099370.1| hypothetical protein L484_004796 [Morus notabilis]
 gb|EXB78095.1| hypothetical protein L484_004796 [Morus notabilis]
Length=91

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 14/98 (14%)
 Frame = +2

Query  155  VFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEERF  334
            +F I+A   C   S               V E  +    E+W  R GKVY D  E E RF
Sbjct  1    MFFILAICTCQEAS-------------RKVLEASMAERHEQWMLRYGKVYNDAAEKERRF  47

Query  335  QNFKGNLKYVKEKTVGGRGSRWEG-KVGLNKFADSRNE  445
              F+ N+++++     GR +R    K+ +N+FAD  N+
Sbjct  48   NIFRENVEFIESFNADGRPNRPRSYKLSINEFADQTNQ  85



>gb|EMS56635.1| Oryzain alpha chain [Triticum urartu]
Length=483

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  34   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  93

Query  428  ADSRNE  445
            AD  NE
Sbjct  94   ADLTNE  99



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E   + ++E W  ++GK Y    E E+RFQ FK NL +V+E     R      KVG+N+F
Sbjct  39   EGDAMAMYESWLVKHGKAYNAIGEKEKRFQIFKDNLMFVEEHNSADR----PYKVGMNRF  94

Query  428  ADSRNE  445
            AD  NE
Sbjct  95   ADLTNE  100



>gb|KCW74083.1| hypothetical protein EUGRSUZ_E02722 [Eucalyptus grandis]
Length=134

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 18/99 (18%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             L+  + AA W   V+                P    L  FE+W   +G++Y+D  E  +
Sbjct  1    MLMLWLCAAAWTSAVT----------------PPNSTLAEFEQWMAHHGRIYKDNLEKAK  44

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R+  F   L+++K+     + +    KVGLN+F+D   E
Sbjct  45   RYGIFLETLRFIKD--FNSKAASQNYKVGLNQFSDLTTE  81



>sp|P05994.3|PAPA4_CARPA RecName: Full=Papaya proteinase 4; AltName: Full=Glycyl endopeptidase; 
AltName: Full=Papaya peptidase B; AltName: Full=Papaya 
proteinase IV; Short=PPIV; Flags: Precursor [Carica papaya]
 emb|CAA54974.1| proteinase IV [Carica papaya]
Length=348

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = +2

Query  143  CGFLVFLIVAAVWCGGVSCYY-DgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEE  319
            C F   L VA    G +S  Y D   +  +       E++++LF  W  ++ K Y++ +E
Sbjct  5    CSFSKLLFVAICLFGHMSLSYCDFSIVGYSQDDLTSTERLIQLFNSWMLKHNKNYKNVDE  64

Query  320  YEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
               RF+ FK NLKY+ E+     G  W   +GLN+F+D  N+
Sbjct  65   KLYRFEIFKDNLKYIDERNKMING-YW---LGLNEFSDLSND  102



>ref|XP_010913142.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=339

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 15/99 (15%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
            F++ L+V  VW  G                 + +  V   FE+W  + G++Y D  E E 
Sbjct  6    FVIALLVFGVWSSGA------------MARAIGDAPVQAKFEQWMAKYGRLYMDATEQER  53

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            RFQ FK N +Y++      R      ++G+N FAD  +E
Sbjct  54   RFQIFKDNYEYIESVN---RAGNLTYRLGINHFADMTDE  89



>gb|AFW59666.1| hypothetical protein ZEAMMB73_680472 [Zea mays]
Length=181

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  R++ EW   +G+ Y    E E RF+ F+ NL+YV              ++GLN+F
Sbjct  39   EEEARRMYAEWMAAHGRTYNAVGEEERRFEVFRDNLRYVDAHNAAADAGVHSFRLGLNRF  98

Query  428  ADSRNE  445
            AD  N+
Sbjct  99   ADLTND  104



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 50/108 (46%), Gaps = 19/108 (18%)
 Frame = +2

Query  131  SLQGCGFLVFLIVAAVWCG---GVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKV  301
            +LQ     V L+V  +W     G + + D                +    E+W  R G+ 
Sbjct  4    TLQKTSIFVSLLVLGMWAALANGRALHEDA-------------NSMSERHEQWMARYGRT  50

Query  302  YRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            Y+D+ E E+RFQ FK N++Y++     G       K+G+N+FAD  NE
Sbjct  51   YKDDSEKEKRFQIFKSNVEYIESVNKAGNKPY---KLGINEFADQTNE  95



>dbj|BAF02546.1| triticain alpha [Triticum aestivum]
 gb|AFK80346.1| cysteine endopeptidase EP alpha [Secale cereale x Triticum turgidum 
subsp. durum]
Length=461

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  34   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  93

Query  428  ADSRNE  445
            AD  NE
Sbjct  94   ADLTNE  99



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +2

Query  272  EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            E+W  R G+ Y+D+ E E+RFQ FK N++Y++     G       K+G+N+FAD  NE
Sbjct  41   EQWMARYGRTYKDDSEKEKRFQIFKSNVEYIESVNKAGNKPY---KLGINEFADQTNE  95



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = +2

Query  242  VPEE-KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGL  418
            VPE   +L   EEW ER G+VY++EEE   R++ FK N+++++     G       K+G+
Sbjct  28   VPERLAMLERHEEWMERYGRVYKNEEEKMMRYKIFKDNVEFIEAFNAAGTRPY---KLGI  84

Query  419  NKFADSRNE  445
            N FAD  NE
Sbjct  85   NAFADQTNE  93



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E +  R++E W  ++G+ Y    E E RF+ FK NLK++ E    G  S    K+GLNKF
Sbjct  42   EAETRRIYEMWLVKHGRAYNALGEKERRFEIFKDNLKFIDEHNSVGNPSY---KLGLNKF  98

Query  428  ADSRNE  445
            AD  N+
Sbjct  99   ADLSND  104



>ref|XP_010059008.1| PREDICTED: ananain-like [Eucalyptus grandis]
Length=146

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 18/99 (18%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             L+  + AA W   V+                P    L  FE+W   +G++Y+D  E  +
Sbjct  13   MLMLWLCAAAWTSAVT----------------PPNSTLAEFEQWMAHHGRIYKDNLEKAK  56

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R+  F   L+++K+     + +    KVGLN+F+D   E
Sbjct  57   RYGIFLETLRFIKD--FNSKAASQNYKVGLNQFSDLTTE  93



>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant 
Of Papain At 2.6 Angstroem Resolution
 pdb|3TNX|C Chain C, Structure Of The Precursor Of A Thermostable Variant 
Of Papain At 2.6 Angstroem Resolution
 pdb|3USV|A Chain A, Structure Of The Precursor Of A Thermostable Variant 
Of Papain At 3.8 A Resolution From A Crystal Soaked At Ph 4
 pdb|3USV|C Chain C, Structure Of The Precursor Of A Thermostable Variant 
Of Papain At 3.8 A Resolution From A Crystal Soaked At Ph 4
Length=363

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            E++++LFE W  ++ K+Y++ +E   RF+ FK NLKY+ E T     S W   +GLN FA
Sbjct  60   ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDE-TNKKNNSYW---LGLNVFA  115

Query  431  DSRNE  445
            D  N+
Sbjct  116  DMSND  120



>gb|EMT10408.1| Oryzain alpha chain [Aegilops tauschii]
Length=463

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+V R++ EW   + + Y    E E RF+ F+ NL+Y+ +            ++GLN+F
Sbjct  36   EEEVRRMYAEWMSEHRRTYNAIGEEERRFEVFRDNLRYIDQHNAAADAGLHSFRLGLNRF  95

Query  428  ADSRNE  445
            AD  NE
Sbjct  96   ADLTNE  101



>ref|XP_003522988.1| PREDICTED: xylem cysteine proteinase 2-like [Glycine max]
Length=349

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            +K++ LFE W  R+GK+Y+  EE   RF  FK NLK++ E+      + W   +GLN+FA
Sbjct  41   DKLIELFESWMSRHGKIYQSIEEKLHRFDIFKDNLKHIDERN-KVVSNYW---LGLNEFA  96

Query  431  DSRNE  445
            D  ++
Sbjct  97   DLSHQ  101



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V  L+E W   +GK Y    E E RF+ FK NL+++ E   G R      KVGLN+F
Sbjct  49   DQEVRGLYESWLVTHGKAYNALGEKERRFEIFKDNLRFIDEHNSGNRTY----KVGLNRF  104

Query  428  ADSRNE  445
            AD  N+
Sbjct  105  ADLTND  110



>ref|XP_008799257.1| PREDICTED: xylem cysteine proteinase 1-like [Phoenix dactylifera]
Length=351

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = +2

Query  254  KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD  433
            +++ LFE W  ++ K Y D EE   RF+ FK NLK++ E T   R S W   +GLN+FAD
Sbjct  40   RLIDLFETWMAKHSKSYADLEEKLRRFEIFKDNLKHIDE-TNKERSSYW---LGLNEFAD  95

Query  434  SRNE  445
              +E
Sbjct  96   MSHE  99



>gb|AFP73358.1| cysteine protease, partial [Solanum habrochaites]
Length=345

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=463

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 0/62 (0%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            EE+  R++ EW   +G+ Y    E E R+Q FK NL+Y+              ++GLN+F
Sbjct  36   EEETRRMYAEWMATHGRTYNAIGEEERRYQVFKDNLRYIDAHNAAADAGVHSFRLGLNRF  95

Query  428  AD  433
            AD
Sbjct  96   AD  97



>ref|XP_003527269.1| PREDICTED: xylem cysteine proteinase 2-like [Glycine max]
Length=350

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  251  EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA  430
            +K++ LFE W  R+GK+Y+  EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct  42   DKLIELFESWISRHGKIYQSIEEKLHRFEIFKDNLKHIDERN-KVVSNYW---LGLNEFA  97

Query  431  DSRNE  445
            D  ++
Sbjct  98   DLSHQ  102



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V  L+E W  ++GK Y    E + RFQ FK NL+++ E   G        K+GLNKF
Sbjct  45   DDEVNALYESWLVKHGKTYNALGEKDRRFQIFKDNLRFIDEHNSGDHTY----KLGLNKF  100

Query  428  ADSRNE  445
            AD  NE
Sbjct  101  ADLTNE  106



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            +++V+ ++E W   + KVY    E ++RFQ FK NLKY+ E       S    K+GL KF
Sbjct  48   DDEVMSMYESWLVEHKKVYNALGEKDKRFQIFKDNLKYIDEHNAMPEKSY---KLGLTKF  104

Query  428  ADSRNE  445
            AD  NE
Sbjct  105  ADLTNE  110



>gb|AFP73357.1| cysteine protease [Solanum habrochaites]
Length=344

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (42%), Gaps = 4/110 (4%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M T         LVFL   +                     +  +++V+ +++ W  ++G
Sbjct  1    MATASMFLAISTLVFLFFISSSSAADMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHG  60

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K        E+RFQ FK NL+++ E     R      KVGLNKFAD  NE
Sbjct  61   KTSNGMGHNEKRFQIFKDNLRFIDEHNSLNRTY----KVGLNKFADLTNE  106



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (42%), Gaps = 4/110 (4%)
 Frame = +2

Query  116  MGTKCSLQGCGFLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNG  295
            M T         LVFL   +                     +  +++V+ +++ W  ++G
Sbjct  1    MATASMFLAISTLVFLFFISSSSAADMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHG  60

Query  296  KVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            K        E+RFQ FK NL+++ E     R      KVGLNKFAD  NE
Sbjct  61   KTSNGMGHNEKRFQIFKDNLRFIDEHNSLNRTY----KVGLNKFADLTNE  106



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E  +  ++E W  ++GK Y    E E RF+ FK NLK+V E     R      KVGLNKF
Sbjct  46   ESHMRMMYEHWLVKHGKNYNALGEKERRFEIFKDNLKFVNEHNAVARTY----KVGLNKF  101

Query  428  ADSRNE  445
            AD  N+
Sbjct  102  ADLTND  107



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEK-TVGGRGSRWEGKVGLNK  424
            EE+ + L+E W   +G+ Y    E E RF+ FK NL+Y+ E+  +G R  R    +GLN+
Sbjct  43   EEEAMSLYESWIVEHGRSYNALGEKERRFEIFKDNLRYIDEQNAIGNRTYR----LGLNR  98

Query  425  FADSRNE  445
            FAD  N+
Sbjct  99   FADLTNK  105



>gb|KCW74081.1| hypothetical protein EUGRSUZ_E02719 [Eucalyptus grandis]
Length=138

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 18/99 (18%)
 Frame = +2

Query  149  FLVFLIVAAVWCGGVSCYYDgfaiagagggfVPEEKVLRLFEEWKERNGKVYRDEEEYEE  328
             L+ L+    W   V+                P    L  FE+W  R+G++Y+D  E  +
Sbjct  1    MLMVLLCVGAWTSAVT----------------PTNSTLAKFEQWMARHGRIYKDNLEKAK  44

Query  329  RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADSRNE  445
            R+  F   L+++++     + +    KVGLN+F+D   E
Sbjct  45   RYGIFLETLRFIED--FNSKAANHSYKVGLNQFSDLTTE  81



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E  +  ++E W  ++GK Y    E E RF+ FK NLK+V E     R      KVGLNKF
Sbjct  39   ESHMRMMYEHWLVKHGKNYNALGEQERRFEIFKDNLKFVNEHNAVARTY----KVGLNKF  94

Query  428  ADSRNE  445
            AD  N+
Sbjct  95   ADLTND  100



>gb|AFP73348.1| cysteine protease [Solanum lycopersicoides]
Length=343

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  245  PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK  424
            P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct  31   PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGINE  87

Query  425  FADSRNE  445
            FAD  +E
Sbjct  88   FADITSE  94



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 4/66 (6%)
 Frame = +2

Query  248  EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF  427
            E  +  ++E W  ++GK Y    E E RF+ FK NLK+V E     R      KVGLNKF
Sbjct  39   ESHMRMMYEHWLVKHGKNYNALGEQERRFEIFKDNLKFVNEHNAVARTY----KVGLNKF  94

Query  428  ADSRNE  445
            AD  N+
Sbjct  95   ADLTND  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880