BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS099E06

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13052.1|  unnamed protein product                                159   9e-41   Coffea canephora [robusta coffee]
ref|XP_003612850.1|  ABC transporter B family member                    156   8e-40   Medicago truncatula
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    156   9e-40   Cicer arietinum [garbanzo]
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    154   3e-39   Sesamum indicum [beniseed]
gb|KHN04865.1|  ABC transporter B family member 2                       154   3e-39   Glycine soja [wild soybean]
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    154   4e-39   Glycine max [soybeans]
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    154   4e-39   Glycine max [soybeans]
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    152   1e-38   Prunus mume [ume]
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             152   2e-38   Prunus persica
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    152   2e-38   
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                151   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_003628784.1|  ABC transporter B family member                    147   5e-38   
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    150   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    150   7e-38   Solanum tuberosum [potatoes]
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    150   1e-37   Fragaria vesca subsp. vesca
ref|XP_010055294.1|  PREDICTED: ABC transporter B family member 2...    150   1e-37   Eucalyptus grandis [rose gum]
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             150   1e-37   Phaseolus vulgaris [French bean]
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    150   1e-37   Solanum lycopersicum
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    150   1e-37   
ref|XP_010096959.1|  ABC transporter B family member 2                  148   3e-37   
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    149   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      149   3e-37   Camelina sativa [gold-of-pleasure]
ref|NP_172538.1|  ABC transporter B family member 10                    149   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892589.1|  P-glycoprotein 10                                  149   3e-37   Arabidopsis lyrata subsp. lyrata
gb|EPS64351.1|  hypothetical protein M569_10429                         148   4e-37   Genlisea aurea
gb|KHN30010.1|  ABC transporter B family member 2                       148   5e-37   Glycine soja [wild soybean]
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    148   5e-37   Glycine max [soybeans]
gb|KJB21123.1|  hypothetical protein B456_003G183800                    148   5e-37   Gossypium raimondii
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             148   5e-37   Phaseolus vulgaris [French bean]
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             148   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    148   6e-37   Nicotiana tomentosiformis
gb|AAF23176.1|AF216497_1  P-glycoprotein                                148   6e-37   Gossypium hirsutum [American cotton]
gb|KJB51627.1|  hypothetical protein B456_008G225400                    148   7e-37   Gossypium raimondii
gb|KJB21124.1|  hypothetical protein B456_003G183800                    148   7e-37   Gossypium raimondii
ref|XP_002277547.1|  PREDICTED: ABC transporter B family member 2       147   7e-37   Vitis vinifera
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    147   7e-37   Nicotiana sylvestris
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    147   7e-37   Tarenaya hassleriana [spider flower]
gb|AAF17668.1|AC009398_17  F20B24.12                                    147   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             147   1e-36   Capsella rubella
ref|XP_002869639.1|  multidrug resistance protein 2                     147   1e-36   
emb|CDY37953.1|  BnaC05g08210D                                          147   1e-36   Brassica napus [oilseed rape]
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    147   1e-36   Arabis alpina [alpine rockcress]
emb|CAA71277.1|  P-glycoprotein-2                                       147   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20507.1|  P-glycoprotein-2                                        147   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21121.1|  hypothetical protein B456_003G183800                    147   1e-36   Gossypium raimondii
ref|XP_007040642.1|  Multidrug/pheromone exporter, MDR family, AB...    147   1e-36   
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             147   2e-36   
emb|CDX93393.1|  BnaA06g06550D                                          146   2e-36   
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       146   2e-36   
ref|XP_010538383.1|  PREDICTED: ABC transporter B family member 2...    146   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      146   2e-36   Brassica rapa
gb|KDO53158.1|  hypothetical protein CISIN_1g0008302mg                  136   2e-36   Citrus sinensis [apfelsine]
ref|XP_006432794.1|  hypothetical protein CICLE_v100000601mg            136   2e-36   
ref|NP_194326.2|  P-glycoprotein 2                                      146   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21122.1|  hypothetical protein B456_003G183800                    145   3e-36   Gossypium raimondii
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             145   4e-36   Eutrema salsugineum [saltwater cress]
gb|EMS51604.1|  ABC transporter B family member 2                       145   5e-36   Triticum urartu
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    145   7e-36   Arabis alpina [alpine rockcress]
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       144   8e-36   Brassica rapa
ref|XP_011018530.1|  PREDICTED: ABC transporter B family member 2...    144   9e-36   Populus euphratica
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    144   1e-35   Camelina sativa [gold-of-pleasure]
emb|CDX89380.1|  BnaA01g15130D                                          144   1e-35   
emb|CDX94395.1|  BnaC01g17890D                                          144   1e-35   
ref|XP_002304346.1|  P-glycoprotein                                     143   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    143   2e-35   Phoenix dactylifera
ref|XP_011018529.1|  PREDICTED: ABC transporter B family member 2...    143   2e-35   Populus euphratica
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    143   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    142   4e-35   Elaeis guineensis
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    142   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC73824.1|  hypothetical protein OsI_08549                          142   5e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001047803.1|  Os02g0693700                                       142   5e-35   
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    142   6e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    142   6e-35   Populus euphratica
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    142   9e-35   Citrus sinensis [apfelsine]
ref|XP_011018527.1|  PREDICTED: ABC transporter B family member 2...    141   1e-34   Populus euphratica
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    141   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006385671.1|  hypothetical protein POPTR_0003s09320g             140   2e-34   
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    140   2e-34   Populus euphratica
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    140   2e-34   Oryza brachyantha
ref|XP_002527657.1|  multidrug resistance protein 1, 2, putative        140   2e-34   
gb|AFW63453.1|  hypothetical protein ZEAMMB73_169648                    131   3e-34   
ref|XP_002299180.2|  P-glycoprotein                                     140   4e-34   
gb|EMT33461.1|  ABC transporter B family member 2                       140   4e-34   
emb|CDX92739.1|  BnaC07g39970D                                          139   6e-34   
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    138   1e-33   Setaria italica
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    138   2e-33   Nelumbo nucifera [Indian lotus]
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       137   2e-33   Cucumis sativus [cucumbers]
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    137   3e-33   Cucumis melo [Oriental melon]
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          137   4e-33   Sorghum bicolor [broomcorn]
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    136   7e-33   
emb|CDY42770.1|  BnaA03g47690D                                          135   1e-32   Brassica napus [oilseed rape]
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    135   2e-32   Brassica rapa
gb|ABG75919.1|  MDR-like ABC transporter                                135   2e-32   Ginkgo biloba [ginkgo]
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          135   2e-32   Amborella trichopoda
gb|KHN38940.1|  ABC transporter B family member 2                       130   1e-30   Glycine soja [wild soybean]
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    124   1e-28   Cicer arietinum [garbanzo]
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    123   2e-28   Elaeis guineensis
ref|XP_004509740.1|  PREDICTED: ABC transporter B family member 2...    122   6e-28   
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    117   4e-26   Phoenix dactylifera
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             112   2e-24   
ref|XP_002965566.1|  ATP-binding cassette transporter                   111   3e-24   
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    110   5e-24   
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             108   3e-23   
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    105   4e-22   
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    103   2e-21   
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    103   2e-21   
ref|XP_002877137.1|  P-glycoprotein 19                                  102   3e-21   Arabidopsis lyrata subsp. lyrata
dbj|BAC41846.1|  putative P-glycoprotein                                102   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189528.1|  ABC transporter B family member 19                    102   6e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAN28720.2|  MDR-like p-glycoprotein                                 101   6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    101   8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    101   8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      101   9e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             101   1e-20   Capsella rubella
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             100   1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative      99.8    3e-20   Ricinus communis
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19    99.0    5e-20   Brassica rapa
ref|XP_002893495.1|  P-glycoprotein 13                                99.0    5e-20   Arabidopsis lyrata subsp. lyrata
emb|CDX86408.1|  BnaA06g31250D                                        99.0    6e-20   
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                  98.6    6e-20   Arabis alpina [alpine rockcress]
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg           98.6    7e-20   Eutrema salsugineum [saltwater cress]
emb|CDY65012.1|  BnaCnng45670D                                        98.2    9e-20   Brassica napus [oilseed rape]
ref|XP_009113714.1|  PREDICTED: ABC transporter B family member 14    98.2    1e-19   Brassica rapa
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...  98.2    1e-19   
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...  97.8    1e-19   
ref|NP_174122.1|  ABC transporter B family member 14                  97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDP07374.1|  unnamed protein product                              97.4    2e-19   Coffea canephora [robusta coffee]
ref|NP_174115.1|  ABC transporter B family member 13                  97.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581           97.1    3e-19   
ref|XP_006368377.1|  P-glycoprotein                                   97.1    3e-19   
ref|XP_002973102.1|  ATP-binding cassette transporter                 96.7    3e-19   
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...  96.7    3e-19   Sesamum indicum [beniseed]
gb|KDP36900.1|  hypothetical protein JCGZ_08191                       96.7    3e-19   Jatropha curcas
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                  96.3    4e-19   Arabis alpina [alpine rockcress]
ref|XP_002969904.1|  ATP-binding cassette transporter                 96.3    4e-19   
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...  96.3    4e-19   Camelina sativa [gold-of-pleasure]
emb|CDP02220.1|  unnamed protein product                              95.9    6e-19   Coffea canephora [robusta coffee]
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19    95.9    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_010527726.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  95.1    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19    94.7    2e-18   Sesamum indicum [beniseed]
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg           94.4    2e-18   Prunus persica
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...  94.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_011459839.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  94.4    2e-18   Fragaria vesca subsp. vesca
emb|CDY00109.1|  BnaC09g01920D                                        94.4    2e-18   
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...  94.0    3e-18   Prunus mume [ume]
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180        94.0    3e-18   
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1     94.0    3e-18   
gb|KJB33609.1|  hypothetical protein B456_006G021600                  93.6    3e-18   Gossypium raimondii
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg           93.6    3e-18   Eutrema salsugineum [saltwater cress]
gb|KHG20565.1|  ABC transporter B family member 19                    93.6    3e-18   Gossypium arboreum [tree cotton]
ref|XP_002890755.1|  P-glycoprotein 14                                93.2    4e-18   Arabidopsis lyrata subsp. lyrata
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                  93.2    4e-18   Arabis alpina [alpine rockcress]
emb|CDY20012.1|  BnaA09g02390D                                        93.2    4e-18   Brassica napus [oilseed rape]
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...  93.2    5e-18   Brassica rapa
ref|XP_007032498.1|  ATP binding cassette subfamily B19 isoform 2     92.8    6e-18   
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...  92.8    7e-18   
gb|EPS72310.1|  hypothetical protein M569_02448                       87.0    7e-18   Genlisea aurea
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19    92.8    7e-18   Prunus mume [ume]
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg           92.4    8e-18   Prunus persica
ref|XP_008348224.1|  PREDICTED: ABC transporter B family member 1...  87.0    8e-18   
ref|XP_007017851.1|  P-glycoprotein 13                                92.4    8e-18   
gb|KHG22495.1|  ABC transporter B family member 19                    92.4    9e-18   Gossypium arboreum [tree cotton]
gb|KJB11390.1|  hypothetical protein B456_001G256100                  92.4    9e-18   Gossypium raimondii
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg           92.4    1e-17   Citrus clementina [clementine]
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19    92.0    1e-17   Vitis vinifera
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...  92.0    1e-17   Citrus sinensis [apfelsine]
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                 92.0    1e-17   Citrus sinensis [apfelsine]
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...  92.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_009113724.1|  PREDICTED: ABC transporter B family member 1...  92.0    1e-17   Brassica rapa
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...  92.0    1e-17   Populus euphratica
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...  92.0    1e-17   Brassica rapa
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19    91.7    1e-17   Populus euphratica
ref|XP_002323847.1|  multidrug resistance P-glycoprotein              91.7    1e-17   Populus trichocarpa [western balsam poplar]
emb|CBI22189.3|  unnamed protein product                              91.7    1e-17   Vitis vinifera
ref|XP_002301961.1|  multidrug resistance P-glycoprotein              91.7    1e-17   
emb|CDY27639.1|  BnaA09g27680D                                        91.7    1e-17   Brassica napus [oilseed rape]
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative      91.7    1e-17   Ricinus communis
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...  91.7    2e-17   Glycine max [soybeans]
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310        91.7    2e-17   Amborella trichopoda
emb|CDX84896.1|  BnaC05g21590D                                        91.3    2e-17   
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g           91.3    2e-17   Phaseolus vulgaris [French bean]
ref|NP_001234209.1|  L04                                              91.3    2e-17   Solanum lycopersicum
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...  91.3    2e-17   Solanum tuberosum [potatoes]
gb|ABX82929.1|  LO4                                                   91.3    2e-17   Solanum pennellii
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...  91.3    2e-17   Glycine max [soybeans]
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19    90.9    3e-17   
ref|XP_010108971.1|  ABC transporter B family member 19               90.9    3e-17   Morus notabilis
gb|AAP72956.1|  putative MDR-like P-glycoprotein                      90.5    3e-17   Lactuca sativa [cultivated lettuce]
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...  90.5    4e-17   Glycine max [soybeans]
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19    90.5    4e-17   Nicotiana sylvestris
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19    90.5    4e-17   Nicotiana tomentosiformis
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19    90.1    5e-17   Nelumbo nucifera [Indian lotus]
gb|KEH24996.1|  ABC transporter B family protein                      90.1    5e-17   Medicago truncatula
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...  90.1    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19    90.1    5e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...  90.1    5e-17   Cicer arietinum [garbanzo]
gb|AIU41631.1|  ABC transporter family protein                        90.1    6e-17   Hevea brasiliensis [jebe]
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g           89.7    6e-17   Phaseolus vulgaris [French bean]
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...  89.7    8e-17   Glycine max [soybeans]
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  89.4    1e-16   
dbj|BAD07905.1|  putative MDR-like ABC transporter                    88.6    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19    89.0    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_010501626.1|  PREDICTED: ABC transporter B family member 1...  89.0    1e-16   
ref|XP_010480688.1|  PREDICTED: ABC transporter B family member 14    88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...  88.6    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...  88.2    2e-16   
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19    88.2    2e-16   Cucumis melo [Oriental melon]
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                   88.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19    88.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg           88.2    2e-16   Capsella rubella
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                 87.8    3e-16   Citrus sinensis [apfelsine]
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg           87.8    3e-16   Citrus clementina [clementine]
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 19    87.8    3e-16   Fragaria vesca subsp. vesca
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...  87.4    4e-16   Citrus sinensis [apfelsine]
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19    87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN52452.1|  Multidrug resistance protein 1, 2                     87.4    5e-16   Cucumis sativus [cucumbers]
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...  87.0    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK05967.1|  predicted protein                                    87.0    5e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN71068.1|  hypothetical protein VITISV_031708                   87.0    6e-16   Vitis vinifera
gb|KDP45498.1|  hypothetical protein JCGZ_09747                       86.7    6e-16   Jatropha curcas
gb|KJB63497.1|  hypothetical protein B456_010G002700                  86.7    7e-16   Gossypium raimondii
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...  86.3    8e-16   
ref|XP_004173028.1|  PREDICTED: ABC transporter B family member 1...  85.9    9e-16   
ref|XP_002962569.1|  ATP-binding cassette transporter                 86.3    1e-15   
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...  86.3    1e-15   Vitis vinifera
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...  85.5    2e-15   Oryza brachyantha
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  85.5    2e-15   Elaeis guineensis
dbj|BAD12940.1|  putative P-glycoprotein 1                            85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052982.1|  Os04g0459000                                     85.5    2e-15   
gb|EEE69159.1|  hypothetical protein OsJ_28307                        85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84043.1|  hypothetical protein OsI_30303                        85.5    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008788471.1|  PREDICTED: ABC transporter B family member 1...  85.1    2e-15   
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860        85.1    2e-15   Sorghum bicolor [broomcorn]
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg           85.1    3e-15   
ref|NP_001169660.1|  uncharacterized protein LOC100383541             85.1    3e-15   Zea mays [maize]
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...  84.7    3e-15   Setaria italica
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...  84.7    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19    84.7    4e-15   Elaeis guineensis
ref|XP_004304461.2|  PREDICTED: ABC transporter B family member 1     84.7    4e-15   Fragaria vesca subsp. vesca
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...  84.3    4e-15   Eucalyptus grandis [rose gum]
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...  84.3    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...  84.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010234205.1|  PREDICTED: ABC transporter B family member 1     84.0    5e-15   Brachypodium distachyon [annual false brome]
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...  84.0    6e-15   Sesamum indicum [beniseed]
ref|XP_004494063.1|  PREDICTED: ABC transporter B family member 1...  83.6    7e-15   
gb|AFP44695.1|  hypothetical protein                                  83.6    7e-15   Eragrostis tef [tef]
gb|KEH42187.1|  ABC transporter B family protein                      83.6    7e-15   Medicago truncatula
ref|XP_006660395.1|  PREDICTED: ABC transporter B family member 1...  83.6    8e-15   
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...  83.6    8e-15   
gb|KGN60047.1|  hypothetical protein Csa_3G873270                     83.2    9e-15   Cucumis sativus [cucumbers]
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...  83.2    9e-15   Setaria italica
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...  83.2    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...  83.2    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  82.8    1e-14   
gb|KDO84910.1|  hypothetical protein CISIN_1g000851mg                 82.4    1e-14   Citrus sinensis [apfelsine]
gb|AFP44681.1|  hypothetical protein                                  82.8    1e-14   Eragrostis tef [tef]
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...  82.8    1e-14   
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...  82.8    2e-14   Phoenix dactylifera
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19    82.8    2e-14   Phoenix dactylifera
dbj|BAJ96840.1|  predicted protein                                    82.4    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006843046.1|  hypothetical protein AMTR_s00076p00195870        82.4    2e-14   Amborella trichopoda
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...  82.4    2e-14   
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350        82.4    2e-14   Sorghum bicolor [broomcorn]
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...  82.4    2e-14   Zea mays [maize]
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...  82.4    2e-14   
dbj|BAG91391.1|  unnamed protein product                              81.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAD59582.1|  MDR-like ABC transporter                             82.0    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1     82.0    3e-14   Pyrus x bretschneideri [bai li]
emb|CAC09461.2|  H0423H10.7                                           82.0    3e-14   Oryza sativa [red rice]
ref|XP_004974253.1|  PREDICTED: ABC transporter B family member 1...  81.6    3e-14   Setaria italica
gb|KHN02316.1|  ABC transporter B family member 1                     81.6    3e-14   Glycine soja [wild soybean]
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...  81.6    3e-14   
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...  81.6    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1     81.3    4e-14   Pyrus x bretschneideri [bai li]
gb|EPS60666.1|  hypothetical protein M569_14136                       75.5    5e-14   Genlisea aurea
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...  81.3    5e-14   Brachypodium distachyon [annual false brome]
ref|NP_001288986.1|  ABC transporter B family member 1                81.3    5e-14   Brassica rapa
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...  81.3    5e-14   Glycine max [soybeans]
gb|EMT07148.1|  ABC transporter B family member 19                    81.3    5e-14   
ref|XP_010101619.1|  ABC transporter B family member 1                81.3    5e-14   
emb|CDY46744.1|  BnaA03g16880D                                        80.9    5e-14   
ref|XP_002445666.1|  hypothetical protein SORBIDRAFT_07g023730        80.9    6e-14   
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg           80.9    6e-14   
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1     80.9    6e-14   
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1     80.9    6e-14   
emb|CAD59580.1|  MDR-like ABC transporter                             80.9    6e-14   
emb|CDX79704.1|  BnaC03g20400D                                        80.9    6e-14   
ref|XP_008241411.1|  PREDICTED: ABC transporter B family member 1     80.9    6e-14   
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg           80.9    6e-14   
gb|KHN09525.1|  ABC transporter B family member 1                     80.9    6e-14   
gb|AES71643.2|  transporter ABC domain protein                        80.9    6e-14   
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  80.9    6e-14   
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...  80.9    6e-14   
ref|NP_001054045.1|  Os04g0642000                                     80.1    6e-14   
dbj|BAJ99824.1|  predicted protein                                    80.5    7e-14   
gb|AAR10387.1|  P-glycoprotein 1                                      80.5    7e-14   
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1     80.5    8e-14   
gb|EMT32511.1|  ABC transporter B family member 19                    80.5    9e-14   
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g           80.5    9e-14   
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1     80.1    9e-14   
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...  80.1    9e-14   
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                  80.1    1e-13   
gb|AES81895.2|  ABC transporter B family protein                      80.1    1e-13   
ref|NP_181228.1|  ABC transporter B family member 1                   80.1    1e-13   
gb|AAM98246.1|  putative ABC transporter                              80.1    1e-13   
ref|XP_008645880.1|  PREDICTED: uncharacterized protein LOC100384...  80.1    1e-13   
gb|AAR00316.1|  PGP1                                                  80.1    1e-13   
gb|KHG13479.1|  ABC transporter B family member 13                    80.1    1e-13   
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g           80.1    1e-13   
ref|XP_002879630.1|  ATPGP1                                           80.1    1e-13   
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...  80.1    1e-13   
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...  80.1    1e-13   
ref|XP_003625677.1|  ABC transporter-like protein                     79.3    1e-13   
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...  79.7    1e-13   
emb|CDY18472.1|  BnaA04g21150D                                        79.3    1e-13   
gb|KJB16771.1|  hypothetical protein B456_002G246800                  79.7    1e-13   
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg              79.7    1e-13   
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...  79.7    2e-13   
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1     79.7    2e-13   
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...  79.7    2e-13   
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...  79.3    2e-13   
gb|KDP29159.1|  hypothetical protein JCGZ_16548                       79.3    2e-13   
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...  79.3    2e-13   
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg           79.3    2e-13   
gb|AIU41628.1|  ABC transporter family protein                        79.3    2e-13   
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...  79.3    2e-13   
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...  79.3    2e-13   
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...  79.0    2e-13   
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1     79.0    2e-13   
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...  79.0    3e-13   
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...  78.6    3e-13   
gb|KHG30028.1|  ABC transporter B family member 1                     78.6    3e-13   
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1     78.6    4e-13   
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...  78.6    4e-13   
ref|XP_010095132.1|  ABC transporter B family member 9                78.6    4e-13   
gb|KHG25987.1|  ABC transporter B family member 1                     78.2    4e-13   
emb|CAD59581.1|  MDR-like ABC transporter                             78.2    4e-13   
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg              78.2    5e-13   
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g           78.2    5e-13   
gb|KGN58982.1|  Multidrug resistance protein 1, 2                     77.8    5e-13   
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1     77.8    5e-13   
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1     77.8    6e-13   
gb|KJB36509.1|  hypothetical protein B456_006G163000                  77.8    6e-13   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...  77.8    6e-13   
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...  77.4    7e-13   
gb|KHN39417.1|  ABC transporter B family member 13                    77.4    8e-13   
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1     77.4    8e-13   
ref|XP_006381407.1|  P glycoprotein1                                  77.4    8e-13   
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...  77.4    9e-13   
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...  77.0    1e-12   
ref|XP_002323485.2|  P glycoprotein1                                  77.0    1e-12   
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1      77.0    1e-12   
ref|XP_008442711.1|  PREDICTED: ABC transporter B family member 1...  73.6    1e-12   
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1     76.6    1e-12   
gb|KHN45005.1|  ABC transporter B family member 11                    76.6    1e-12   
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...  76.6    1e-12   
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative      76.6    1e-12   
ref|XP_010271028.1|  PREDICTED: ABC transporter B family member 2...  76.6    2e-12   
gb|KJB36510.1|  hypothetical protein B456_006G163000                  76.3    2e-12   
ref|XP_008442707.1|  PREDICTED: ABC transporter B family member 1...  73.2    2e-12   
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g           76.3    2e-12   
emb|CDY27649.1|  BnaA09g27580D                                        76.3    2e-12   
gb|KHN12634.1|  ABC transporter B family member 13                    75.9    2e-12   
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3     75.9    2e-12   
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg           75.9    3e-12   
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                 75.9    3e-12   
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                 75.9    3e-12   
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...  75.5    3e-12   
ref|XP_003550577.1|  PREDICTED: ABC transporter B family member 1...  75.5    3e-12   
ref|XP_004508078.1|  PREDICTED: ABC transporter B family member 2...  75.5    4e-12   
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...  75.5    4e-12   
ref|NP_001062529.2|  Os08g0564300                                     75.1    4e-12   
ref|NP_001275319.1|  P-glycoprotein                                   75.1    4e-12   
emb|CBI19899.3|  unnamed protein product                              75.1    4e-12   
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1     75.1    4e-12   
ref|XP_006594001.1|  PREDICTED: ABC transporter B family member 2...  75.1    4e-12   
gb|KHN45006.1|  ABC transporter B family member 11                    75.1    5e-12   
ref|XP_003601392.1|  ABC transporter B family member                  74.7    5e-12   
ref|XP_004173771.1|  PREDICTED: ABC transporter B family member 1...  73.6    5e-12   
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1     74.7    5e-12   
gb|KHN45492.1|  ABC transporter B family member 19                    74.7    5e-12   
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...  74.7    6e-12   
ref|XP_008673955.1|  PREDICTED: ABC transporter B family member 2...  74.7    6e-12   
tpg|DAA48547.1|  TPA: hypothetical protein ZEAMMB73_189648            74.3    6e-12   
ref|XP_010095529.1|  ABC transporter B family member 13               73.9    8e-12   
ref|XP_006844278.1|  hypothetical protein AMTR_s00145p00075460        73.6    1e-11   
ref|XP_002519337.1|  multidrug resistance protein 1, 2, putative      73.2    2e-11   
gb|AAW56857.1|  unknown protein                                       70.5    3e-11   
ref|XP_002457701.1|  hypothetical protein SORBIDRAFT_03g011860        72.0    4e-11   
emb|CDP05476.1|  unnamed protein product                              72.0    4e-11   
ref|XP_010938901.1|  PREDICTED: ABC transporter B family member 4...  72.0    4e-11   
ref|XP_002986365.1|  ATP-binding cassette transporter                 71.6    5e-11   
ref|XP_010690905.1|  PREDICTED: ABC transporter B family member 1...  71.6    6e-11   
ref|XP_008654439.1|  PREDICTED: uncharacterized protein LOC100194...  71.6    6e-11   
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  71.6    7e-11   
ref|XP_001757698.1|  ATP-binding cassette transporter, subfamily ...  71.6    7e-11   
gb|ABG56413.1|  MDR-like ABC transporter                              71.2    8e-11   
emb|CAD59590.1|  MDR-like ABC transporter                             71.2    8e-11   
gb|EAY96476.1|  hypothetical protein OsI_18374                        71.2    9e-11   
ref|XP_003567552.1|  PREDICTED: ABC transporter B family member 2...  70.9    9e-11   
ref|XP_010938828.1|  PREDICTED: ABC transporter B family member 2...  70.9    1e-10   
ref|XP_004963620.1|  PREDICTED: ABC transporter B family member 4...  70.9    1e-10   
ref|XP_007154481.1|  hypothetical protein PHAVU_003G122500g           70.9    1e-10   
ref|XP_003609885.1|  ABC transporter B family member                  70.5    1e-10   
ref|XP_002123097.1|  PREDICTED: multidrug resistance protein 1A-like  70.1    2e-10   
gb|KEH32389.1|  ABC transporter B family protein                      70.1    2e-10   
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079           70.1    2e-10   
emb|CAD59586.1|  MDR-like ABC transporter                             70.1    2e-10   
gb|EAY75483.1|  hypothetical protein OsI_03383                        70.1    2e-10   
ref|XP_001757900.1|  ATP-binding cassette transporter, subfamily ...  69.7    2e-10   
ref|XP_002872874.1|  P-glycoprotein 5                                 69.7    2e-10   
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662           69.7    2e-10   
ref|XP_003566602.1|  PREDICTED: ABC transporter B family member 4     69.7    2e-10   
ref|XP_002519336.1|  multidrug resistance protein 1, 2, putative      69.7    2e-10   
ref|XP_003607429.1|  ABC transporter B family member                  69.7    3e-10   
ref|XP_010688391.1|  PREDICTED: ABC transporter B family member 1...  69.7    3e-10   
gb|AES73698.2|  transporter ABC domain protein                        69.3    3e-10   
ref|XP_006355579.1|  PREDICTED: ABC transporter B family member 9...  69.3    3e-10   
ref|XP_004967616.1|  PREDICTED: ABC transporter B family member 2...  69.3    3e-10   
ref|XP_008778177.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  69.3    3e-10   
dbj|BAA96612.1|  putative CjMDR1                                      69.3    4e-10   
ref|XP_010091424.1|  ABC transporter B family member 11               69.3    4e-10   
ref|XP_003603447.1|  ABC transporter B family member                  68.9    4e-10   
ref|XP_002519759.1|  multidrug resistance protein 1, 2, putative      68.9    4e-10   
ref|XP_004166183.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  68.9    4e-10   
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...  68.9    4e-10   
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg           68.9    4e-10   
gb|AES64094.2|  ABC transporter B family protein                      68.9    4e-10   
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9     68.9    4e-10   
ref|XP_009385386.1|  PREDICTED: ABC transporter B family member 4...  68.9    5e-10   
ref|XP_010098744.1|  ABC transporter B family member 11               68.9    5e-10   
ref|XP_009385385.1|  PREDICTED: ABC transporter B family member 4...  68.9    5e-10   
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  68.9    5e-10   
gb|AES59767.2|  ABC transporter B family protein                      68.6    5e-10   
ref|XP_010045610.1|  PREDICTED: ABC transporter B family member 1...  68.6    5e-10   
ref|XP_003593843.1|  ABC transporter B family member                  68.6    5e-10   
ref|XP_003589516.1|  ABC transporter B family member                  68.6    6e-10   
ref|XP_010938829.1|  PREDICTED: ABC transporter B family member 4...  68.6    6e-10   
ref|XP_008445963.1|  PREDICTED: ABC transporter B family member 4...  68.6    6e-10   
ref|XP_004508079.1|  PREDICTED: ABC transporter B family member 2...  68.6    6e-10   
gb|KEH30666.1|  ABC transporter B family protein                      68.2    6e-10   
ref|XP_004508080.1|  PREDICTED: ABC transporter B family member 2...  68.6    6e-10   
ref|XP_004969643.1|  PREDICTED: ABC transporter B family member 4...  68.2    7e-10   
emb|CDP17032.1|  unnamed protein product                              68.2    7e-10   
gb|KFK34765.1|  hypothetical protein AALP_AA5G190700                  68.2    7e-10   
gb|EMS57842.1|  ABC transporter B family member 19                    68.2    7e-10   
ref|XP_004135527.1|  PREDICTED: ABC transporter B family member 4...  68.2    8e-10   
ref|XP_010241472.1|  PREDICTED: ABC transporter B family member 1...  67.8    8e-10   
ref|XP_010241454.1|  PREDICTED: ABC transporter B family member 1...  68.2    8e-10   
ref|XP_002960848.1|  ATP-binding cassette transporter                 68.2    9e-10   
ref|XP_002519757.1|  multidrug resistance protein 1, 2, putative      67.8    9e-10   
ref|XP_003591310.1|  ABC transporter B family member                  67.8    9e-10   
ref|XP_002967165.1|  hypothetical protein SELMODRAFT_169170           67.8    9e-10   
ref|XP_011040252.1|  PREDICTED: ABC transporter B family member 1...  67.8    9e-10   
ref|XP_010667802.1|  PREDICTED: ABC transporter B family member 9     67.8    1e-09   
ref|XP_009121075.1|  PREDICTED: ABC transporter B family member 5...  67.8    1e-09   
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...  67.8    1e-09   
ref|XP_004364058.2|  multidrug resistance protein 1                   67.8    1e-09   
ref|XP_002320939.2|  hypothetical protein POPTR_0014s10870g           67.8    1e-09   
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...  67.4    1e-09   
ref|XP_002876661.1|  P-glycoprotein 21                                67.4    1e-09   
ref|XP_006402405.1|  hypothetical protein EUTSA_v10005750mg           67.4    1e-09   
emb|CDX67881.1|  BnaA07g19210D                                        67.4    1e-09   
ref|XP_007159375.1|  hypothetical protein PHAVU_002G233000g           67.4    1e-09   
ref|XP_002515186.1|  multidrug resistance protein 1, 2, putative      67.4    1e-09   
ref|NP_191774.2|  ABC transporter B family member 21                  67.4    1e-09   
gb|EPS68527.1|  hypothetical protein M569_06241                       66.2    1e-09   
emb|CAB71875.1|  P-glycoprotein-like proetin                          67.4    1e-09   
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...  67.0    2e-09   
ref|XP_009414924.1|  PREDICTED: ABC transporter B family member 1...  67.0    2e-09   
gb|EAZ32166.1|  hypothetical protein OsJ_16371                        67.0    2e-09   
ref|XP_009104372.1|  PREDICTED: ABC transporter B family member 21    67.0    2e-09   
ref|XP_011027347.1|  PREDICTED: ABC transporter B family member 20    67.0    2e-09   
ref|XP_010905018.1|  PREDICTED: ABC transporter B family member 4...  67.0    2e-09   
emb|CDY25095.1|  BnaC06g18370D                                        67.0    2e-09   
gb|AES64104.2|  ABC transporter B family-like protein                 67.0    2e-09   
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608           66.6    2e-09   
ref|XP_010321859.1|  PREDICTED: ABC transporter B family member 2...  66.6    2e-09   
ref|XP_008676311.1|  PREDICTED: ABC transporter B family member 4...  66.6    2e-09   
ref|XP_009525379.1|  multidrug resistance protein ABC superfamily     66.6    2e-09   
ref|XP_007221461.1|  hypothetical protein PRUPE_ppa000313mg           66.6    2e-09   
ref|XP_008227785.1|  PREDICTED: ABC transporter B family member 1...  66.6    2e-09   
ref|XP_009417523.1|  PREDICTED: ABC transporter B family member 4...  66.2    3e-09   
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980        66.6    3e-09   
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...  66.6    3e-09   
ref|XP_006840349.1|  hypothetical protein AMTR_s00045p00108620        66.2    3e-09   
ref|XP_004240558.1|  PREDICTED: ABC transporter B family member 21    66.2    3e-09   
ref|XP_010905014.1|  PREDICTED: ABC transporter B family member 1...  66.2    3e-09   
ref|XP_010522857.1|  PREDICTED: ABC transporter B family member 1...  66.2    3e-09   
gb|KHN45007.1|  ABC transporter B family member 11                    66.2    3e-09   
ref|XP_003541331.1|  PREDICTED: ABC transporter B family member 2...  66.2    3e-09   
ref|XP_002301550.2|  hypothetical protein POPTR_0002s18850g           66.2    3e-09   
ref|XP_008798883.1|  PREDICTED: ABC transporter B family member 2...  66.2    3e-09   
ref|XP_010313352.1|  PREDICTED: ABC transporter B family member 2...  65.9    4e-09   
ref|XP_003609882.1|  ABC transporter B family member                  65.9    4e-09   
ref|XP_006355822.1|  PREDICTED: ABC transporter B family member 2...  65.9    4e-09   
ref|XP_010905016.1|  PREDICTED: ABC transporter B family member 2...  65.9    4e-09   
emb|CDP20011.1|  unnamed protein product                              65.9    4e-09   
ref|XP_008225385.1|  PREDICTED: ABC transporter B family member 9     65.9    4e-09   
gb|AES92079.2|  ABC transporter B family protein                      65.9    4e-09   



>emb|CDP13052.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   159 bits (402),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF FAD  DY LMFVG +GACVHGASVPVFF+FFGK+ID+IG A+LFPAEASHKV K
Sbjct  34   LIKLFKFADAYDYFLMFVGAIGACVHGASVPVFFIFFGKMIDIIGLAYLFPAEASHKVGK  93

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+VILFSSWTEVACWMH
Sbjct  94   YSLDFVYLSVVILFSSWTEVACWMH  118



>ref|XP_003612850.1| ABC transporter B family member [Medicago truncatula]
 gb|AES95808.1| ABC transporter B family-like protein [Medicago truncatula]
Length=1234

 Score =   156 bits (394),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S++KLFSFAD  DYVLMF+G +GA VHGASVP+FF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  16   SMLKLFSFADSYDYVLMFIGSIGAIVHGASVPIFFIFFGKLINVIGLAYLFPKEASHKVA  75

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSWTEVACWMH
Sbjct  76   KYSLDFVYLSVAILFSSWTEVACWMH  101



>ref|XP_004512509.1| PREDICTED: ABC transporter B family member 2-like [Cicer arietinum]
Length=1237

 Score =   156 bits (394),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF+FAD  DYVLMF+G +GAC+HGASVPVFF+FFGK+I+VIG A+LFP EASH+VAK
Sbjct  18   LLKLFTFADSYDYVLMFIGSIGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHEVAK  77

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YS+DFVYLSI ILFSSWTEVACWMH
Sbjct  78   YSMDFVYLSIAILFSSWTEVACWMH  102



>ref|XP_011082358.1| PREDICTED: ABC transporter B family member 2-like [Sesamum indicum]
Length=1260

 Score =   154 bits (390),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L KLF+FADG DY LMFVG VGACVHGASVPVFF+FFG++I++IG A+LFP EASHKVA 
Sbjct  42   LRKLFAFADGYDYFLMFVGSVGACVHGASVPVFFIFFGQLINIIGLAYLFPKEASHKVAM  101

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLSIVI+FSSWTEVACWMH
Sbjct  102  YSLDFVYLSIVIMFSSWTEVACWMH  126



>gb|KHN04865.1| ABC transporter B family member 2 [Glycine soja]
Length=1246

 Score =   154 bits (390),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLSI ILFSSWTEVACWMH
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMH  111



>ref|XP_003517674.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1246

 Score =   154 bits (389),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLSI ILFSSWTEVACWMH
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMH  111



>ref|XP_003533440.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1245

 Score =   154 bits (389),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLSI ILFSSWTEVACWMH
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMH  111



>ref|XP_008238211.1| PREDICTED: ABC transporter B family member 2-like [Prunus mume]
Length=1271

 Score =   152 bits (385),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  49   SLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVA  108

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSWTEVACWMH
Sbjct  109  KYSLDFVYLSVAILFSSWTEVACWMH  134



>ref|XP_007210429.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
 gb|EMJ11628.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
Length=1267

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  48   SLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVA  107

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSWTEVACWMH
Sbjct  108  KYSLDFVYLSVAILFSSWTEVACWMH  133



>ref|XP_008373592.1| PREDICTED: ABC transporter B family member 2-like [Malus domestica]
Length=1261

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY+LM VG VGACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVA
Sbjct  42   SLLKLFSFADSYDYLLMAVGSVGACVHGASVPIFFIFFGKLINIIGXAYLFPKEASSKVA  101

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSWTEVACWMH
Sbjct  102  KYSLDFVYLSVAILFSSWTEVACWMH  127



>gb|EYU34148.1| hypothetical protein MIMGU_mgv1a000301mg [Erythranthe guttata]
Length=1278

 Score =   151 bits (382),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL KLF+FAD  DY+LMFVG +GACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVA
Sbjct  46   SLGKLFAFADSYDYLLMFVGSIGACVHGASVPIFFIFFGKLINIIGLAYLFPKEASSKVA  105

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
             YSLDFVYLSIVI+FSSWTEVACWMH
Sbjct  106  MYSLDFVYLSIVIMFSSWTEVACWMH  131



>ref|XP_003628784.1| ABC transporter B family member [Medicago truncatula]
 gb|AET03260.1| ABC transporter transmembrane region protein [Medicago truncatula]
Length=488

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM VG VGAC+HGASVPVFF+FFGKII+V+G A+LFP EASH+VAK
Sbjct  13   LLKLFSFADFYDYVLMAVGSVGACIHGASVPVFFIFFGKIINVVGLAYLFPKEASHQVAK  72

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+LDFVYLSI+ILFSSW EVACWMH
Sbjct  73   YALDFVYLSIIILFSSWAEVACWMH  97



>ref|XP_009371200.1| PREDICTED: ABC transporter B family member 2-like [Pyrus x bretschneideri]
Length=1261

 Score =   150 bits (380),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DY+LM VG VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAK
Sbjct  43   LLKLFSFADSYDYLLMAVGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVAK  102

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSWTEVACWMH
Sbjct  103  YSLDFVYLSVAILFSSWTEVACWMH  127



>ref|XP_006352948.1| PREDICTED: ABC transporter B family member 2-like [Solanum tuberosum]
Length=1257

 Score =   150 bits (380),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY+LM +G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHKVA
Sbjct  39   SLLKLFSFADSYDYLLMILGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKVA  98

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  99   KYSLDFVYLSVVILFSSWIEVACWMH  124



>ref|XP_004301784.1| PREDICTED: ABC transporter B family member 2-like [Fragaria vesca 
subsp. vesca]
Length=1261

 Score =   150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D VLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAK
Sbjct  47   LLKLFSFADSYDCVLMAIGSVGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASSKVAK  106

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLSI ILFSSWTEVACWMH
Sbjct  107  YSLDFVYLSIAILFSSWTEVACWMH  131



>ref|XP_010055294.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW71762.1| hypothetical protein EUGRSUZ_E00260 [Eucalyptus grandis]
Length=1255

 Score =   150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM VG VGACVHG SVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  38   SLLKLFSFADFYDCVLMAVGSVGACVHGVSVPVFFIFFGKLINVIGMAYLFPKEASHKVA  97

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  98   KYSLDFVYLSVAILFSSWIEVACWMH  123



>ref|XP_007158282.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
 gb|ESW30276.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
Length=1245

 Score =   150 bits (378),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S++KLFSFAD  D VLM +G VGAC+HGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  24   SILKLFSFADFYDCVLMTIGSVGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLSI ILFSSW EVACWMH
Sbjct  84   KYSLDFVYLSIAILFSSWAEVACWMH  109



>ref|XP_004245909.2| PREDICTED: ABC transporter B family member 2-like [Solanum lycopersicum]
Length=1257

 Score =   150 bits (378),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY+LMF+G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHK+A
Sbjct  39   SLLKLFSFADSYDYLLMFLGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKIA  98

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILF+SW EVACWMH
Sbjct  99   KYSLDFVYLSVVILFASWIEVACWMH  124



>ref|XP_007040641.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
 gb|EOY25142.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
Length=1251

 Score =   150 bits (378),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>ref|XP_010096959.1| ABC transporter B family member 2 [Morus notabilis]
 gb|EXB66536.1| ABC transporter B family member 2 [Morus notabilis]
Length=945

 Score =   148 bits (374),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLF+FAD  D VLM +G +GAC+HGASVP+FF+FFG++I+VIG A+LFP EASHKVA
Sbjct  33   SLLKLFTFADFYDCVLMAIGSIGACIHGASVPIFFIFFGQLINVIGMAYLFPKEASHKVA  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLSI ILFSSWTEVACWMH
Sbjct  93   KYSLDFVYLSIAILFSSWTEVACWMH  118



>ref|XP_010458427.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1226

 Score =   149 bits (376),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVA  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  85   KYSLDFVYLSVVILFSSWIEVACWMH  110



>ref|XP_010491749.1| PREDICTED: ABC transporter B family member 10 [Camelina sativa]
Length=1226

 Score =   149 bits (376),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVA  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  85   KYSLDFVYLSVVILFSSWIEVACWMH  110



>ref|NP_172538.1| ABC transporter B family member 10 [Arabidopsis thaliana]
 sp|Q9SGY1.2|AB10B_ARATH RecName: Full=ABC transporter B family member 10; Short=ABC transporter 
ABCB.10; Short=AtABCB10; AltName: Full=Multidrug 
resistance protein 10; AltName: Full=P-glycoprotein 10 [Arabidopsis 
thaliana]
 gb|AEE28628.1| ABC transporter B family member 10 [Arabidopsis thaliana]
Length=1227

 Score =   149 bits (375),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  85   KYSLDFVYLSVVILFSSWLEVACWMH  110



>ref|XP_002892589.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68848.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
Length=1229

 Score =   149 bits (375),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  26   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  86   KYSLDFVYLSVVILFSSWLEVACWMH  111



>gb|EPS64351.1| hypothetical protein M569_10429, partial [Genlisea aurea]
Length=1241

 Score =   148 bits (374),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S++KLFSFADG D +LMF+G +GACVHGASVPVFFVFFGKII++IG A+LFP EA+ +VA
Sbjct  16   SILKLFSFADGYDCLLMFLGSIGACVHGASVPVFFVFFGKIINIIGLAYLFPKEAAPQVA  75

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYS+DFVYLS VIL SSWTEVACWMH
Sbjct  76   KYSIDFVYLSAVILLSSWTEVACWMH  101



>gb|KHN30010.1| ABC transporter B family member 2 [Glycine soja]
Length=1253

 Score =   148 bits (374),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  D VLM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+K
Sbjct  22   FLKLFSFADFYDCVLMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSK  81

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+LDFVYLSI ILFSSWTEVACWMH
Sbjct  82   YALDFVYLSIAILFSSWTEVACWMH  106



>ref|XP_006585887.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1254

 Score =   148 bits (374),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  D VLM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+K
Sbjct  22   FLKLFSFADFYDCVLMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSK  81

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+LDFVYLSI ILFSSWTEVACWMH
Sbjct  82   YALDFVYLSIAILFSSWTEVACWMH  106



>gb|KJB21123.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1219

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>ref|XP_007156412.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
 gb|ESW28406.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
Length=1235

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D VLM VG VGACVHGASVPVFFVFFGKII+VIG A+L P EASH+VAK
Sbjct  13   LLKLFSFADWYDCVLMGVGSVGACVHGASVPVFFVFFGKIINVIGFAYLSPKEASHEVAK  72

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+LDFVYLSIVILFSSWTEVACWMH
Sbjct  73   YALDFVYLSIVILFSSWTEVACWMH  97



>ref|XP_006417431.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
 gb|ESQ35784.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
Length=1226

 Score =   148 bits (373),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVA
Sbjct  21   SVFKLFSFADFYDCVLMVLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQQASHKVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVVILFSSWLEVACWMH  106



>ref|XP_009595706.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
tomentosiformis]
Length=1256

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY LMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVA
Sbjct  28   SLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVA  87

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KY+LDFVYLS+V+LFSSW EVACWMH
Sbjct  88   KYALDFVYLSVVVLFSSWIEVACWMH  113



>gb|AAF23176.1|AF216497_1 P-glycoprotein [Gossypium hirsutum]
Length=1249

 Score =   148 bits (373),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>gb|KJB51627.1| hypothetical protein B456_008G225400 [Gossypium raimondii]
Length=1248

 Score =   148 bits (373),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I+V G A+LFP EASHKVAK
Sbjct  31   LLKLFSFADIYDYVLMGLGSIGACVHGASVPVFFIFFGKLINVAGMAYLFPKEASHKVAK  90

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  91   YSLDFVYLSVAILFSSWIEVACWMH  115



>gb|KJB21124.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1249

 Score =   148 bits (373),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>ref|XP_002277547.1| PREDICTED: ABC transporter B family member 2 [Vitis vinifera]
 emb|CBI33860.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   147 bits (372),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF+FAD  D  LM VG VGAC+HGASVPVFF+FFGK+ID+IG A+LFPA ASHKVAK
Sbjct  25   LLKLFAFADLYDCFLMAVGSVGACIHGASVPVFFIFFGKLIDIIGLAYLFPAAASHKVAK  84

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+VILFSSW EVACWMH
Sbjct  85   YSLDFVYLSLVILFSSWAEVACWMH  109



>ref|XP_009764894.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
sylvestris]
Length=1260

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DY LMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVA
Sbjct  32   SLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVA  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KY+LDFVYLS+V+LFSSW EVACWMH
Sbjct  92   KYALDFVYLSVVVLFSSWIEVACWMH  117



>ref|XP_010540773.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1250

 Score =   147 bits (372),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EAS +VA
Sbjct  30   SLVKLFSFADFYDYVLMAIGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPKEASPQVA  89

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   KYSLDFVYLSVAILFSSWIEVACWMH  115



>gb|AAF17668.1|AC009398_17 F20B24.12 [Arabidopsis thaliana]
Length=1316

 Score =   147 bits (372),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  85   KYSLDFVYLSVVILFSSWLEVACWMH  110



>ref|XP_006303653.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
 gb|EOA36551.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
Length=1229

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G + AC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  26   SFLKLFSFADLYDCVLMALGSIAACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  86   KYSLDFVYLSVVILFSSWIEVACWMH  111



>ref|XP_002869639.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45898.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=1233

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMH  106



>emb|CDY37953.1| BnaC05g08210D [Brassica napus]
Length=1225

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMH  109



>gb|KFK43347.1| hypothetical protein AALP_AA1G113900 [Arabis alpina]
Length=1230

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+ KLFSFAD  D +LM +G +GAC+HGASVPVFF+FFGK+I++IG A+ FP EASHKVA
Sbjct  24   SMFKLFSFADFYDCILMALGSIGACIHGASVPVFFIFFGKLINIIGLAYFFPQEASHKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+V+LFSSW EVACWMH
Sbjct  84   KYSLDFVYLSVVVLFSSWIEVACWMH  109



>emb|CAA71277.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAA71276.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAB39661.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
 emb|CAB79451.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
Length=1233

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMH  106



>gb|AAM20507.1| P-glycoprotein-2 [Arabidopsis thaliana]
Length=1233

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMH  106



>gb|KJB21121.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1281

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  62   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  121

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  122  YSLDFVYLSVAILFSSWIEVACWMH  146



>ref|XP_007040642.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
 gb|EOY25143.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
Length=1075

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>ref|XP_006282856.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
 gb|EOA15754.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
Length=1239

 Score =   147 bits (370),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  29   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  88

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  89   KYSLDFVYLSVAILFSSWLEVACWMH  114



>emb|CDX93393.1| BnaA06g06550D [Brassica napus]
Length=1225

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMH  109



>ref|XP_010436379.1| PREDICTED: ABC transporter B family member 2 [Camelina sativa]
Length=1222

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  19   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  78

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  79   KYSLDFVYLSVAILFSSWLEVACWMH  104



>ref|XP_010538383.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1256

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  DYVLM VG +GACVHGASVPVFF+FFGK+I++IG A+LFP +AS +VA
Sbjct  32   SLVKLFSFADFYDYVLMAVGSMGACVHGASVPVFFIFFGKLINIIGIAYLFPKQASPQVA  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  92   KYSLDFVYLSVAILFSSWIEVACWMH  117



>ref|XP_009148411.1| PREDICTED: ABC transporter B family member 10 [Brassica rapa]
Length=1225

 Score =   146 bits (369),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMH  109



>gb|KDO53158.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53159.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53160.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
Length=179

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EV+CWM+
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMY  127



>ref|XP_006432794.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
 gb|ESR46034.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
Length=179

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EV+CWM+
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMY  127



>ref|NP_194326.2| P-glycoprotein 2 [Arabidopsis thaliana]
 sp|Q8LPK2.3|AB2B_ARATH RecName: Full=ABC transporter B family member 2; Short=ABC transporter 
ABCB.2; Short=AtABCB2; AltName: Full=Multidrug resistance 
protein 2; AltName: Full=P-glycoprotein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAE99138.1| P-glycoprotein-2 [Arabidopsis thaliana]
 gb|AEE85137.1| P-glycoprotein 2 [Arabidopsis thaliana]
Length=1273

 Score =   146 bits (368),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  61   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  120

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  121  KYSLDFVYLSVAILFSSWLEVACWMH  146



>gb|KJB21122.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=938

 Score =   145 bits (366),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMH  114



>ref|XP_006413247.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
 gb|ESQ54700.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
Length=1239

 Score =   145 bits (366),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVAK
Sbjct  26   LLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPHQASHKVAK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYLS+ ILFSSW EVACWMH
Sbjct  86   YSLDFVYLSVAILFSSWLEVACWMH  110



>gb|EMS51604.1| ABC transporter B family member 2 [Triticum urartu]
Length=1214

 Score =   145 bits (366),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             MKLFSFAD  DYVLM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAK
Sbjct  200  FMKLFSFADRWDYVLMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAK  259

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL +VILFSSWTEVACWMH
Sbjct  260  YSLDFVYLGVVILFSSWTEVACWMH  284



>gb|KFK29108.1| hypothetical protein AALP_AA7G090300 [Arabis alpina]
Length=1235

 Score =   145 bits (365),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP E SH+VA
Sbjct  22   SLLKLFSFADFYDCVLMALGSIGACIHGASVPIFFIFFGKLINIIGVAYLFPKETSHQVA  81

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EV+CWMH
Sbjct  82   KYSLDFVYLSVAILFSSWLEVSCWMH  107



>ref|XP_009139729.1| PREDICTED: ABC transporter B family member 2 [Brassica rapa]
Length=1234

 Score =   144 bits (364),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMH  106



>ref|XP_011018530.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1182

 Score =   144 bits (364),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF+FAD  D+VLM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAK  94

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDF+YLS+ +LFSSWTEVACWMH
Sbjct  95   YSLDFLYLSVAMLFSSWTEVACWMH  119



>ref|XP_010475946.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1224

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G  GAC+HGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  24   SFLKLFSFADFYDCVLMALGSTGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASPKVA  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  84   KYSLDFVYLSVVILFSSWIEVACWMH  109



>emb|CDX89380.1| BnaA01g15130D [Brassica napus]
Length=1275

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  62   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVA  121

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  122  KYSLDFVYLSVAILFSSWLEVACWMH  147



>emb|CDX94395.1| BnaC01g17890D [Brassica napus]
Length=1234

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLYPHLASHKVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMH  106



>ref|XP_002304346.1| P-glycoprotein [Populus trichocarpa]
 gb|EEE79325.1| P-glycoprotein [Populus trichocarpa]
Length=1250

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS+VILF+SW EVACWMH
Sbjct  91   LDFVYLSVVILFASWIEVACWMH  113



>ref|XP_008800115.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1250

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLF+FAD  DY LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VAK
Sbjct  30   FLKLFAFADAWDYFLMALGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPTSVTHRVAK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL IVILFSSWTEVACWMH
Sbjct  90   YSLDFVYLGIVILFSSWTEVACWMH  114



>ref|XP_011018529.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1249

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF+FAD  D+VLM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAK  94

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDF+YLS+ +LFSSWTEVACWMH
Sbjct  95   YSLDFLYLSVAMLFSSWTEVACWMH  119



>ref|XP_003572841.1| PREDICTED: ABC transporter B family member 2-like [Brachypodium 
distachyon]
Length=1256

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP E S +VAK
Sbjct  26   FLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPTEVSGRVAK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL +VILFSSWTEVACWMH
Sbjct  86   YSLDFVYLGVVILFSSWTEVACWMH  110



>ref|XP_010908483.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1249

 Score =   142 bits (359),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S  KLF+FAD  DY LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VA
Sbjct  29   SFFKLFAFADAWDYFLMALGSIGACVHGASVPVFFIFFGKLINIIGVAYLFPTSVTHRVA  88

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYL IVILFSSW EVACWMH
Sbjct  89   KYSLDFVYLGIVILFSSWIEVACWMH  114



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   142 bits (359),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLF+FAD  DY LM +G +GAC HGASVPVFF+FFGK+I++IG AFLFP   SH+VAK
Sbjct  25   FLKLFAFADTWDYFLMALGSIGACAHGASVPVFFIFFGKLINIIGVAFLFPTTVSHRVAK  84

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL I ILFSSWTEVACWMH
Sbjct  85   YSLDFVYLGIAILFSSWTEVACWMH  109



>gb|EEC73824.1| hypothetical protein OsI_08549 [Oryza sativa Indica Group]
Length=1264

 Score =   142 bits (359),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  37   FLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  96

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL IVILFSSWTEVACWMH
Sbjct  97   YSLDFVYLGIVILFSSWTEVACWMH  121



>ref|NP_001047803.1| Os02g0693700 [Oryza sativa Japonica Group]
 emb|CAD59583.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07906.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07706.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09717.1| Os02g0693700 [Oryza sativa Japonica Group]
 gb|EEE57613.1| hypothetical protein OsJ_08005 [Oryza sativa Japonica Group]
Length=1264

 Score =   142 bits (359),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  37   FLKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  96

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL IVILFSSWTEVACWMH
Sbjct  97   YSLDFVYLGIVILFSSWTEVACWMH  121



>ref|XP_010677330.1| PREDICTED: ABC transporter B family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=1256

 Score =   142 bits (358),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLF+FAD +DY+LMF G +GA  HGASVPVFF+FFGK+I++IG A+LFP E SH VA
Sbjct  40   SFLKLFTFADSLDYLLMFFGTIGAIAHGASVPVFFIFFGKLINLIGVAYLFPRETSHDVA  99

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWM 
Sbjct  100  KYSLDFVYLSVVILFSSWVEVACWMQ  125



>ref|XP_011028150.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1250

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+VAKYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVAKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS+VILF+SW EVACWMH
Sbjct  91   LDFVYLSVVILFASWIEVACWMH  113



>ref|XP_006471591.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006471592.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Citrus sinensis]
Length=1265

 Score =   142 bits (357),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EV+CWM+
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMY  127



>ref|XP_011018527.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1193

 Score =   141 bits (356),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS VILF+SW EVACWMH
Sbjct  91   LDFVYLSAVILFASWIEVACWMH  113



>ref|XP_010240898.1| PREDICTED: ABC transporter B family member 2-like [Nelumbo nucifera]
Length=1246

 Score =   141 bits (356),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD  DYVLMF+G VGACVHGASVPVFF+FFGK+I++IG  +LFP   SHKV KYS
Sbjct  31   KLFSFADFWDYVLMFLGSVGACVHGASVPVFFIFFGKLINIIGIGYLFPELVSHKVGKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLSIV+LFSSW EV CWMH
Sbjct  91   LDFVYLSIVMLFSSWIEVGCWMH  113



>ref|XP_006385671.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
 gb|ERP63468.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
Length=922

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS+VILF+SW EVACWMH
Sbjct  91   LDFVYLSVVILFASWIEVACWMH  113



>ref|XP_011018526.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1253

 Score =   140 bits (354),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS VILF+SW EVACWMH
Sbjct  91   LDFVYLSAVILFASWIEVACWMH  113



>ref|XP_006647720.1| PREDICTED: ABC transporter B family member 2-like [Oryza brachyantha]
Length=1261

 Score =   140 bits (354),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  DYVLM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  36   FLKLFSFADRWDYVLMAMGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  95

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL +VILFSSWTEVACWMH
Sbjct  96   YSLDFVYLGVVILFSSWTEVACWMH  120



>ref|XP_002527657.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF34728.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1156

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+KLF+FAD  DYVLM +G V A  HGASVPVFF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  37   SLLKLFAFADLYDYVLMGLGSVAAIAHGASVPVFFIFFGKMINIIGLAYLFPQQASHRVA  96

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  97   KYSLDFVYLSVAILFSSWIEVACWMH  122



>gb|AFW63453.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=208

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  352  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  531
            +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  32   LKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  91

Query  532  SLDFVYLSIVILFSSWTEVACWMH  603
            SLDFVYL IVI FSSWTEVACWMH
Sbjct  92   SLDFVYLGIVIFFSSWTEVACWMH  115



>ref|XP_002299180.2| P-glycoprotein [Populus trichocarpa]
 gb|EEE83985.2| P-glycoprotein [Populus trichocarpa]
Length=1285

 Score =   140 bits (352),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLS VILF+SW EVACWMH
Sbjct  91   LDFVYLSAVILFASWIEVACWMH  113



>gb|EMT33461.1| ABC transporter B family member 2 [Aegilops tauschii]
Length=1322

 Score =   140 bits (352),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  DY+LM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAK
Sbjct  38   FLKLFSFADRWDYLLMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAK  97

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL +VILFSSWTEVACWMH
Sbjct  98   YSLDFVYLGVVILFSSWTEVACWMH  122



>emb|CDX92739.1| BnaC07g39970D [Brassica napus]
Length=1241

 Score =   139 bits (350),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGTAYMDRHQASHKVA  82

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+VILFSSW EVACWMH
Sbjct  83   KYSLDFVYLSVVILFSSWIEVACWMH  108



>ref|XP_004953524.1| PREDICTED: ABC transporter B family member 2-like [Setaria italica]
Length=1257

 Score =   138 bits (348),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  29   FLKLFSFADQWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  88

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL IVILFSSWTEVACWMH
Sbjct  89   YSLDFVYLGIVILFSSWTEVACWMH  113



>ref|XP_010274279.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Nelumbo nucifera]
Length=1252

 Score =   138 bits (347),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLF+FAD  DYVLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP   SHKVA Y+
Sbjct  31   KLFAFADSWDYVLMLLGSVGACVHGASVPVFFIFFGKLINIIGVAYLFPTLVSHKVAMYA  90

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            LDFVYLSIV++FSSW EV+CWM+
Sbjct  91   LDFVYLSIVVMFSSWIEVSCWMY  113



>gb|KGN60362.1| hypothetical protein Csa_3G901080 [Cucumis sativus]
Length=1272

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  KLF+FAD  DYVLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVA
Sbjct  54   AFYKLFAFADFYDYVLMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVA  113

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDF+YLS+ ILFSSW EVACWMH
Sbjct  114  KYSLDFLYLSVAILFSSWAEVACWMH  139



>ref|XP_008465999.1| PREDICTED: ABC transporter B family member 2-like [Cucumis melo]
Length=1237

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  KLF+FAD  DY+LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVA
Sbjct  19   AFYKLFAFADFYDYILMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVA  78

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDF+YLS+ ILFSSW EVACWMH
Sbjct  79   KYSLDFLYLSVAILFSSWAEVACWMH  104



>ref|XP_002452712.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
 gb|EES05688.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
Length=1260

 Score =   137 bits (345),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  34   FLKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  93

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL +VILFSSWTEVACWMH
Sbjct  94   YSLDFVYLGVVILFSSWTEVACWMH  118



>ref|XP_008676453.1| PREDICTED: uncharacterized protein LOC100191944 isoform X1 [Zea 
mays]
 gb|ACN33264.1| unknown [Zea mays]
 gb|AFW63454.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=1262

 Score =   136 bits (343),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
             +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  31   FLKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAK  90

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL IVI FSSWTEVACWMH
Sbjct  91   YSLDFVYLGIVIFFSSWTEVACWMH  115



>emb|CDY42770.1| BnaA03g47690D [Brassica napus]
Length=1135

 Score =   135 bits (341),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVA  82

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW EVACWMH
Sbjct  83   KYSLDFVYLSVAILFSSWLEVACWMH  108



>ref|XP_009137566.1| PREDICTED: ABC transporter B family member 2-like [Brassica rapa]
Length=1241

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVA  82

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLDFVYLS+ ILFSSW E ACWMH
Sbjct  83   KYSLDFVYLSVAILFSSWLEAACWMH  108



>gb|ABG75919.1| MDR-like ABC transporter [Ginkgo biloba]
Length=1279

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  KLFS+ADG DY+LM VG +GAC HGASVPVFF+FFGK+I+ IG A+L P   +H VA
Sbjct  58   AFYKLFSYADGWDYLLMAVGSIGACAHGASVPVFFIFFGKLINCIGLAYLDPPAVTHTVA  117

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
             YSLDFVYL +V+LFSSWTEVACWM+
Sbjct  118  MYSLDFVYLGVVVLFSSWTEVACWMY  143



>ref|XP_006854029.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
 gb|ERN15496.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
Length=1263

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLF+FAD  D+VLM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  37   FFKLFAFADKWDWVLMAIGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPRSVSDRVAK  96

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDFVYL I ILFSSWTEVACWM+
Sbjct  97   YSLDFVYLGIAILFSSWTEVACWMY  121



>gb|KHN38940.1| ABC transporter B family member 2 [Glycine soja]
Length=1204

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  394  MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  573
            M VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILFS
Sbjct  1    MGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILFS  60

Query  574  SWTEVACWMH  603
            SWTEVACWMH
Sbjct  61   SWTEVACWMH  70



>ref|XP_004509738.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Cicer arietinum]
Length=1229

 Score =   124 bits (311),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAK
Sbjct  15   LLKLFSFADFYDYVLMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAK  74

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDF+YLSI+ILFSSW EVACWMH
Sbjct  75   YSLDFLYLSILILFSSWAEVACWMH  99



>ref|XP_010906448.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1235

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S  KLF+F+D  DYVLM +G VGACVHGAS+PVFF+FFGK+++V   A L+PA  SHKVA
Sbjct  21   SFFKLFAFSDAWDYVLMALGSVGACVHGASLPVFFLFFGKLVNVAAVASLYPASVSHKVA  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +Y+LDF+YL    L S+W EV+CWMH
Sbjct  81   EYALDFLYLGFATLVSAWIEVSCWMH  106



>ref|XP_004509740.1| PREDICTED: ABC transporter B family member 2-like isoform X3 
[Cicer arietinum]
Length=1047

 Score =   122 bits (305),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLFSFAD  DYVLM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAK
Sbjct  15   LLKLFSFADFYDYVLMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAK  74

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSLDF+YLSI+ILFSSW EVACWMH
Sbjct  75   YSLDFLYLSILILFSSWAEVACWMH  99



>ref|XP_008777170.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1237

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLF+F+D  DYVLM +G V ACVHGASVPVF +FFGK+IDV       PA  SHKV +
Sbjct  25   FFKLFAFSDARDYVLMALGSVSACVHGASVPVFLIFFGKLIDVAAVGSSNPASVSHKVGE  84

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+LDFVYL   IL S+W EVACWMH
Sbjct  85   YALDFVYLGFGILVSAWIEVACWMH  109



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S ++LFSFAD +DYVL+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+
Sbjct  25   SYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSL FVYL +VIL ++W EV+CW +
Sbjct  85   KYSLYFVYLGLVILVAAWLEVSCWTY  110



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S ++LFSFAD +DYVL+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+
Sbjct  25   SYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSL FVYL +VIL ++W EV+CW +
Sbjct  85   KYSLYFVYLGLVILVAAWLEVSCWTY  110



>ref|XP_004136398.1| PREDICTED: ABC transporter B family member 2-like [Cucumis sativus]
Length=1232

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  KLF+FAD  DYVLM +G +GAC+HGASVPVFF+FFGK+I+++    +FP        
Sbjct  21   AFYKLFAFADFYDYVLMSIGSIGACIHGASVPVFFIFFGKLINILC-INIFP------FV  73

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +YSLDF+YLS+ ILFSSW EVACWMH
Sbjct  74   QYSLDFLYLSVAILFSSWAEVACWMH  99



>ref|XP_002976764.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
 gb|EFJ22433.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
Length=1290

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KL+SFAD +D  L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+
Sbjct  68   KLYSFADAMDLGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYA  127

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL + IL ++W EVACW +
Sbjct  128  LYFVYLGLAILVAAWLEVACWTY  150



>ref|XP_001774240.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
 gb|EDQ61016.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
Length=1236

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S +KLFSFAD VDY LMF+G +GAC HG +VP+FFVFFG++I+  G     P +   +V 
Sbjct  17   SYLKLFSFADTVDYFLMFLGSLGACAHGGAVPIFFVFFGRLINAFGFNQHHPNKLGQEVG  76

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L   YL +V++F+SW EVACW+ 
Sbjct  77   KEALSMFYLGLVVMFASWLEVACWIQ  102



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KL+SFAD  D  L+F+G +GACVHG ++PVFF+FFG++I+  GE    P   S +V+K +
Sbjct  18   KLYSFADSYDVFLIFLGTLGACVHGVAIPVFFIFFGRLINAFGEYADDPETMSTEVSKNA  77

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L F++L+IV+L ++W EVACWMH
Sbjct  78   LYFLFLAIVVLIAAWLEVACWMH  100



>ref|XP_011083466.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Sesamum indicum]
Length=1247

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S  +LF+ AD +DYVLMF+G +GAC+ GA++PVFFV FG++I+ +G   L P   S +V+
Sbjct  35   SFFRLFAVADKIDYVLMFIGSIGACLQGAALPVFFVLFGRMINTLGNLSLDPHRFSSEVS  94

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            KY+L  VYL +V+  S+WT VACW
Sbjct  95   KYALYLVYLGLVVWLSAWTGVACW  118



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V+K
Sbjct  26   FFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   102 bits (253),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  26   FFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   102 bits (253),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  26   FFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   101 bits (252),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  26   FFKLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  29   FFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  88

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL F+YL +V+ FSS+ E+ACWM+
Sbjct  89   YSLYFIYLGLVVCFSSYAEIACWMY  113



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  28   FFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  87

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL F+YL +V+ FSS+ E+ACWM+
Sbjct  88   YSLYFIYLGLVVCFSSYAEIACWMY  112



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  28   FFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  87

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL F+YL +V+ FSS+ E+ACWM+
Sbjct  88   YSLYFIYLGLVVCFSSYAEIACWMY  112



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   101 bits (251),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++
Sbjct  26   FFKLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL F+YL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFIYLGLVVCFSSYAEIACWMY  110



>ref|XP_006415715.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
 gb|ESQ34068.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
Length=1246

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD VD+ LMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKVDWFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  VACWM 
Sbjct  92   QNALYLVYLGLVNLVSAWMGVACWMQ  117



>ref|XP_002510564.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF52751.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1252

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LFS AD +DY LMF G +GAC+HGAS+PVFF+FFG++ID +G     P + S +V+
Sbjct  33   SFFALFSAADKIDYFLMFFGSLGACIHGASLPVFFIFFGRMIDSLGNLASDPQKMSTQVS  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K++L  VYL +V+  S+W  VA WM 
Sbjct  93   KHALYLVYLGLVVFVSAWIGVALWMQ  118



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  26   FFKLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  V+CWM 
Sbjct  92   QNALYLVYLGLVNLVSAWIGVSCWMQ  117



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  26   FFKLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL +V+ FSS+ E+ACWM+
Sbjct  86   YSLYFVYLGLVVCFSSYAEIACWMY  110



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM +G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  25   FFKLFSFADKFDYLLMSIGTLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHQVSK  84

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+ FSS+ E+ACWM+
Sbjct  85   YALYFVYLGLVVCFSSYAEIACWMY  109



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  29   FFKLFSFADKFDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLQQMTHEVSK  88

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+ FSS+ E+ACWM+
Sbjct  89   YALYFVYLGLVVCFSSYAEIACWMY  113



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  26   FFKLFSFADKFDYLLMITGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++ FSS+ E+ACWM+
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMY  110



>ref|XP_009113714.1| PREDICTED: ABC transporter B family member 14 [Brassica rapa]
Length=1232

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD VDY+LMF+G  G CVHG ++P+FFVFFGK++D +G         S +V+
Sbjct  21   SLMGLFSAADRVDYILMFLGTFGTCVHGGTLPLFFVFFGKMLDSLGNLSTDSTAISSRVS  80

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  VYL  V L S+W  VACWM 
Sbjct  81   KNALYLVYLGFVNLVSAWMGVACWMQ  106



>ref|XP_001751653.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
 gb|EDQ83970.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
Length=1264

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD VDYVLM VG   A +HGA+VPVFF++F ++I+ +G +   P + + +V++YS
Sbjct  43   KLFSFADKVDYVLMVVGGTAAVLHGAAVPVFFIYFSRLINDLGHSMGDPMKQTAEVSRYS  102

Query  535  LDFVYLSIVILFSSWTEVACWM  600
            ++F YL I  L ++W EV+CWM
Sbjct  103  MNFFYLGIHCLVTAWLEVSCWM  124



>ref|XP_001779184.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
 gb|EDQ56030.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
Length=1284

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL KLF FAD  DY+L+ +G VGA  HG ++PVFF+FFGK++D  G     P + +  V 
Sbjct  66   SLFKLFKFADSFDYLLISIGLVGAAAHGCALPVFFLFFGKLLDGFGANANNPVKMADIVG  125

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +YSL  +YL IV+ F+SW EVA WM 
Sbjct  126  QYSLYMLYLGIVVCFASWAEVAAWMQ  151



>ref|NP_174122.1| ABC transporter B family member 14 [Arabidopsis thaliana]
 sp|Q9C7F2.1|AB14B_ARATH RecName: Full=ABC transporter B family member 14; Short=ABC transporter 
ABCB.14; Short=AtABCB14; AltName: Full=Multidrug 
resistance protein 12; AltName: Full=P-glycoprotein 14 [Arabidopsis 
thaliana]
 gb|AAG51476.1|AC069471_7 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30902.1| ABC transporter B family member 14 [Arabidopsis thaliana]
Length=1247

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD VDY LMF+G +G C+HG ++P+FFVFFG ++D +G+    P   S +V+
Sbjct  32   SLMGLFSAADNVDYFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGKLSTDPNAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  VACWM 
Sbjct  92   QNALYLVYLGLVNLVSAWIGVACWMQ  117



>emb|CDP07374.1| unnamed protein product [Coffea canephora]
Length=1259

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S++ LF+ AD +DY+LMF G  GAC+HGA++P FFV FG++ID +G     P + +  V+
Sbjct  36   SVLGLFAAADKIDYILMFFGSAGACLHGAALPAFFVLFGRMIDSLGHLSSNPHQMASVVS  95

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            KY++  VYL +VIL S+W  VACW
Sbjct  96   KYAVYLVYLGLVILMSAWIGVACW  119



>ref|NP_174115.1| ABC transporter B family member 13 [Arabidopsis thaliana]
 sp|Q9C7F8.1|AB13B_ARATH RecName: Full=ABC transporter B family member 13; Short=ABC transporter 
ABCB.13; Short=AtABCB13; AltName: Full=P-glycoprotein 
13; AltName: Full=Putative multidrug resistance protein 
15 [Arabidopsis thaliana]
 gb|AAG51482.1|AC069471_13 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30893.1| ABC transporter B family member 13 [Arabidopsis thaliana]
Length=1245

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  31   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  90

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V   S+W  V+CWM 
Sbjct  91   QNALYLVYLGLVNFVSAWIGVSCWMQ  116



>ref|XP_002981381.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
 gb|EFJ17569.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
Length=1239

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+K+F+FADGVD   MF G +GA  HG ++P+F + FGK+++  G     P E   +V++
Sbjct  11   LLKIFAFADGVDCAFMFGGTIGAVAHGVALPIFLLLFGKLLNSFGSLASDPQEMYRQVSQ  70

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL I ILF+SW EVA WM 
Sbjct  71   YSLYFVYLGIAILFASWAEVALWMQ  95



>ref|XP_006368377.1| P-glycoprotein [Populus trichocarpa]
 gb|ERP64946.1| P-glycoprotein [Populus trichocarpa]
Length=1230

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 19/85 (22%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L+KLF+FAD  D+VLM +G +GAC+HGA+VPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGAAVPVFFIYFGKLINIIGLAYLFPQQTSHKVAK  94

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
                               VACWMH
Sbjct  95   -------------------VACWMH  100



>ref|XP_002973102.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ25476.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1214

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  379  VDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSI  558
            +D+ L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+L FVYL +
Sbjct  1    MDWGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYALYFVYLGL  60

Query  559  VILFSSWTEVACWMH  603
             IL ++W EVACW +
Sbjct  61   AILVAAWLEVACWTY  75



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+
Sbjct  26   QLFSFADKYDYLLMISGSIGAVIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  86   LYFVYLGLVVCLSSYAEIACWMY  108



>gb|KDP36900.1| hypothetical protein JCGZ_08191 [Jatropha curcas]
Length=1221

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF  AD +DY+LMFVG +G+C+HGA++PVFF+FFG++ID +G   L P + S K++
Sbjct  35   SFFGLFFAADKIDYLLMFVGSLGSCIHGAALPVFFIFFGRMIDSLGNLALDPHKMSSKIS  94

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL + +  S+W  VA WM 
Sbjct  95   QHALYLVYLGLAVFVSAWMGVAFWMQ  120



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+ LFS A+  DY LMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLIGLFSAANKFDYFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +  L S+W  VACWM 
Sbjct  92   QNALYLVYLGLANLVSAWIGVACWMQ  117



>ref|XP_002969904.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29028.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1239

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L K+F+FADGVD   MF G +GA  HG ++P+F + FGK+++  G     P E   +V+K
Sbjct  11   LHKIFAFADGVDCAFMFGGTIGAVAHGLALPIFLLLFGKLLNSFGSLASDPQEMYRQVSK  70

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            YSL FVYL I ILF+SW EVA WM 
Sbjct  71   YSLYFVYLGIAILFASWAEVALWMQ  95



>ref|XP_010460561.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1248

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GACVHGA++P+FFVFFGK++D +G         S  V+
Sbjct  34   SLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVS  93

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  VYL +V L S+W  VACWM 
Sbjct  94   KNALYLVYLGLVNLVSAWIGVACWMQ  119



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+      +  H+VAKY+
Sbjct  26   QLFSFADKYDWLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQTDLHKMIHEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L F+YL +++ FSS+ E+ACWMH
Sbjct  86   LYFIYLGLIVCFSSYAEIACWMH  108



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +++V+K
Sbjct  30   FFKLFSFADRYDYLLMITGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTNEVSK  89

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+ FSS+ E+ACWM+
Sbjct  90   YALYFVYLGLVVCFSSYAEIACWMY  114



>ref|XP_010527726.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Tarenaya hassleriana]
Length=1268

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL  LF  AD +DYVLMF G +GA +HGA++PVFF+ FG+++D +G  +  P   S +V+
Sbjct  38   SLFGLFGAADKLDYVLMFFGSLGAAIHGATLPVFFILFGRMLDALGTLYANPGSMSSRVS  97

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L+ VYL +  L SSW  VACWM 
Sbjct  98   QTALNAVYLGLANLVSSWVGVACWMQ  123



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D +LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+
Sbjct  25   QLFSFADKYDIILMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+ FSS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCFSSYAEIACWMY  107



>ref|XP_007225446.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
 gb|EMJ26645.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
Length=1244

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+ LF+ AD VD+VLM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V+
Sbjct  35   SLVGLFAAADKVDFVLMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVS  94

Query  526  KYSLDFVYLSIVILFSSWTEVACWM  600
            +++L  VYL +++  S+W  VA WM
Sbjct  95   QHALYLVYLGLILFASAWIGVAFWM  119



>ref|XP_010499285.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1245

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS +D +DY LM +G +GACVHGA++P+FFVFFGK++D +G         S  V+
Sbjct  31   SLMGLFSASDKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVS  90

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  VYL +V L S+W  V+CWM 
Sbjct  91   KNALYLVYLGLVNLVSAWIGVSCWMQ  116



>ref|XP_011459839.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like, partial [Fragaria vesca subsp. vesca]
Length=1390

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +DY+LM  G  G+C+HGA++PVFFV FG++ID +G   + P E S +++
Sbjct  917  SFLGLFAAADQMDYILMLFGSFGSCIHGAALPVFFVLFGRMIDSLGNMAMHPNEISSRIS  976

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            +Y+L  +YL IV+  S+W  VA W
Sbjct  977  EYALYVIYLGIVLFISAWIGVASW  1000


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +DY+LM  G  G+C+HGA+ PVFFV FG +ID +G   +   E S +++
Sbjct  37   SFLGLFAAADQMDYILMLFGSFGSCIHGAAFPVFFVLFGGMIDSLGHMAMRSNEMSSRIS  96

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            +Y+L  V L IV+  S+W  VA W
Sbjct  97   EYALYVVCLGIVLFISAWIGVASW  120



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+K
Sbjct  26   FFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+  SS+ E+ACWM+
Sbjct  86   YALYFVYLGLVVCVSSYAEIACWMY  110



>ref|XP_008221400.1| PREDICTED: ABC transporter B family member 13-like [Prunus mume]
Length=1205

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+ LF+ AD VD+VLM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V+
Sbjct  35   SLVGLFAAADKVDFVLMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVS  94

Query  526  KYSLDFVYLSIVILFSSWTEVACWM  600
            +++L  VYL +++  S+W  VA WM
Sbjct  95   QHALYLVYLGLILFASAWIGVAFWM  119



>ref|XP_006856780.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
 gb|ERN18247.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
Length=1265

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S  KL +FAD  D  LMF G +GACVHGA++PVFFV FG++ID +G       + + +V 
Sbjct  41   SFFKLLAFADTTDMFLMFFGTLGACVHGAALPVFFVIFGRLIDSLGCLSGDTNKLASEVG  100

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  +YL +V++ SSW EVACWM 
Sbjct  101  KNALQLLYLGLVVMASSWIEVACWMQ  126



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY LM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+
Sbjct  25   QLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>gb|KJB33609.1| hypothetical protein B456_006G021600 [Gossypium raimondii]
Length=1249

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADKYDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>ref|XP_006415706.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
 gb|ESQ34059.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
Length=1242

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD VD +LMF+G +G+C+HG ++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFRAADKVDCLLMFLGSLGSCIHGGTLPLFFVFFGKLLDSLGSLSADPKAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  V CWM 
Sbjct  92   QNALYLVYLGLVNLVSAWMGVTCWMQ  117



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADKYDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>ref|XP_002890755.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67014.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
Length=1248

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  32   SLMGLFSAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNFSTDPNAISSRVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  VACWM 
Sbjct  92   QNALYLVYLGLVNLVSAWIGVACWMQ  117



>gb|KFK33112.1| hypothetical protein AALP_AA6G332600 [Arabis alpina]
Length=1240

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD  D  LMF+G +G C+HG ++P FFVFFGK++D +G   + P   S  V+
Sbjct  28   SLMILFSAADKFDCFLMFLGGLGTCIHGGTLPFFFVFFGKLLDSLGNLSMDPKATSSTVS  87

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  VACWM 
Sbjct  88   QNALYLVYLGLVNLVSAWIGVACWMQ  113



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++
Sbjct  26   FFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+  SS+ E+ACWM+
Sbjct  86   YALYFVYLGLVVCVSSYAEIACWMY  110



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++
Sbjct  26   FFKLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSR  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+  SS+ E+ACWM+
Sbjct  86   YALYFVYLGLVVCVSSYAEIACWMY  110



>ref|XP_007032498.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
 gb|EOY03424.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
Length=1216

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY LM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+
Sbjct  25   QLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>ref|XP_010478144.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Camelina 
sativa]
 ref|XP_010478146.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Camelina 
sativa]
Length=1246

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GACVHGA++P+FFV FGK++D +G         S  V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVLFGKMLDSLGNLSADSKAISSHVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  VYL +V L S+W  V+CWM 
Sbjct  92   KNALYLVYLGLVNLVSAWIGVSCWMQ  117



>gb|EPS72310.1| hypothetical protein M569_02448, partial [Genlisea aurea]
Length=152

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +1

Query  358  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  537
            LF FADG+DYVLM +G  GA VHGAS+P+F  FF  +I+  G     P + +H+V+KY+ 
Sbjct  19   LFRFADGIDYVLMGIGTAGAVVHGASLPLFLRFFADLINSFGSNENDPRKMTHEVSKYAF  78

Query  538  DFVYLSIVILFSSWTEVACWM  600
             F+ +   I  SSW E++CWM
Sbjct  79   YFLVVGAAIWLSSWAEISCWM  99



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  25   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCFSSYAEIACWMY  107



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  25   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCFSSYAEIACWMY  107



>ref|XP_008348224.1| PREDICTED: ABC transporter B family member 19-like [Malus domestica]
Length=162

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  GE  +   + + +VAKY+
Sbjct  26   QLFSFADKYDWLLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQMNLQKMTAEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  +S+ E+ACWM+
Sbjct  86   LYFVYLGLIVCVTSYAEIACWMY  108



>ref|XP_007017851.1| P-glycoprotein 13 [Theobroma cacao]
 gb|EOY15076.1| P-glycoprotein 13 [Theobroma cacao]
Length=1241

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +DY LMF G +GAC+HGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  28   SFLGLFAAADKLDYALMFSGSLGACIHGAALPVFFILFGRMIDSLGHLSSNPQKLSARVS  87

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL +V+  S+W  VA WM 
Sbjct  88   EHALYLVYLGLVVFASAWIGVAFWMQ  113



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADRYDYMLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>gb|KJB11390.1| hypothetical protein B456_001G256100 [Gossypium raimondii]
Length=1249

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADRYDYMLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMY  107



>ref|XP_006431131.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
 gb|ESR44371.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
Length=1252

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++ FSS+ E+ACWM+
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMY  110



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+
Sbjct  26   QLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  86   LYFVYLGVVVCISSYAEIACWMY  108



>ref|XP_006482578.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1252

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++ FSS+ E+ACWM+
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMY  110



>gb|KDO72551.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=1252

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++ FSS+ E+ACWM+
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMY  110



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+K
Sbjct  28   FFQLFSFADKYDHLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTSEVSK  87

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+ FSS+ E+ACWM+
Sbjct  88   YALYFVYLGLVVCFSSYAEIACWMY  112



>ref|XP_009113724.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Brassica 
rapa]
Length=1218

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            K +LD VYL +V   S+W  VACW
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACW  108



>ref|XP_011034997.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Populus euphratica]
Length=1246

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+  LFS AD  D+ LMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+
Sbjct  33   SIFGLFSAADKFDHFLMFLGLVGSCAHGAVYPMFFVLFGHLIDSLGHVGSDPHQMSSQVS  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLD VYL + +  + W  VA WM 
Sbjct  93   KYSLDLVYLGLGVFVAGWIGVASWMQ  118



>ref|XP_009113722.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Brassica 
rapa]
 ref|XP_009113723.1| PREDICTED: ABC transporter B family member 13 isoform X2 [Brassica 
rapa]
Length=1247

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            K +LD VYL +V   S+W  VACW
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACW  108



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  27   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYA  86

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL IV+  SS+ E+ACWM+
Sbjct  87   LYFVYLGIVVCLSSYAEIACWMY  109



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  27   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYA  86

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL IV+  SS+ E+ACWM+
Sbjct  87   LYFVYLGIVVCLSSYAEIACWMY  109



>emb|CBI22189.3| unnamed protein product [Vitis vinifera]
Length=1088

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+
Sbjct  26   QLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  86   LYFVYLGVVVCISSYAEIACWMY  108



>ref|XP_002301961.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEE81234.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1219

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S+  LFS AD  D+ LMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+
Sbjct  14   SIFGLFSAADKFDHFLMFLGLVGSCAHGAVFPLFFVLFGHLIDSLGHVRSDPHQMSSQVS  73

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KYSLD VYL + +  + W  VA WM 
Sbjct  74   KYSLDLVYLGLGVFVAGWIGVASWMQ  99



>emb|CDY27639.1| BnaA09g27680D [Brassica napus]
Length=1218

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKALSSRVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            K +LD VYL +V   S+W  VACW
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACW  108



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G  GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  35   QLFSFADNYDWLLMISGSTGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLTKMTHEVSKYA  94

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  95   LYFVYLGLVVCLSSYAEIACWMY  117



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  25   KLFSFADKCDWMLMISGSIGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCISSYAEIACWMY  107



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSF+D  D+ +M +G VGA VHG+S+PVFF+FFG +++  G+  +   + + +V+KY+
Sbjct  25   KLFSFSDSYDWFVMTIGTVGAVVHGSSMPVFFLFFGDLVNGFGKNQMDLRKMTEEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  85   LYFVYLGLIVCASSYAEIACWMY  107



>emb|CDX84896.1| BnaC05g21590D [Brassica napus]
Length=1051

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D IG     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSIGNLSTDPKALSSRVS  84

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            K +LD VYL +V   S+W  VACW
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACW  108



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  25   KLFSFADKCDWMLMISGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMY  107



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ CWM+
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMY  107



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ CWM+
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMY  107



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ CWM+
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMY  107



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   KLFSFADKCDWMLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMNLKKMTEEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  86   LYFVYLGLVVCISSYAEIACWMY  108



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  GE  +   + + +VAK
Sbjct  24   FFQLFSFADKYDWLLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQMNLQKMTAEVAK  83

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++  +S+ E+ACWM+
Sbjct  84   YALYFVYLGLIVCVTSYAEIACWMY  108



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G VGA +HG+S+P FF+ FG++++  G+  +   + + +V+KYS
Sbjct  25   QLFSFADKYDYLLMISGSVGAVIHGSSMPFFFLLFGQMVNGFGKNQMDLRKMTDEVSKYS  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCVSSYAEIACWMY  107



>gb|AAP72956.1| putative MDR-like P-glycoprotein [Lactuca sativa]
Length=1251

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY LM +G +GA +HG+S+P FF+ FG++I+  G+        +H+V+KY+
Sbjct  27   QLFSFADKFDYALMILGSIGAIIHGSSMPFFFLLFGQMINGFGKNQSDLNTMTHEVSKYA  86

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ CWM+
Sbjct  87   LYFVYLGLVVCISSYAEIGCWMY  109



>ref|XP_003544389.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF+ AD  D VLMF+G VG+CVHGA++PVFF+ FG++ID +G     P + S +++
Sbjct  30   SFFGLFAAADATDCVLMFLGSVGSCVHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRIS  89

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL  V+L S+W  VA WM 
Sbjct  90   EHALYLVYLGGVVLVSAWMGVAFWMQ  115



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+
Sbjct  25   QLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ CWM+
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMY  107



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+
Sbjct  25   QLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ CWM+
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMY  107



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D+VLM  G +GA VHG+++PVFF+ FG +++  G+      + + +VAKY+
Sbjct  25   QLFSFADKYDWVLMIAGSIGAVVHGSAMPVFFLLFGDMVNGFGKNQSDLKKMTEEVAKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMY  107



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+K
Sbjct  24   FFQLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSK  83

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +V+  SS+ E+ACWM+
Sbjct  84   YALYFVYLGLVVCISSYAEIACWMY  108



>ref|XP_010439790.1| PREDICTED: ABC transporter B family member 14-like isoform X1 
[Camelina sativa]
Length=1250

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +LM LF  AD VD  LMF+G +G C+HG ++P FFVFFG ++D +G  +  P   S  V+
Sbjct  35   TLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFVFFGGMLDSLGNLYKDPKAISSHVS  94

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +V L S+W  VACWM 
Sbjct  95   QNALYLVYLGLVNLVSAWIGVACWMQ  120



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  DY LM +G +GA +HG+S+PVFF+ FG++++  G+        +H+V+KY+
Sbjct  26   QLFSFADKYDYFLMSLGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQSDLQTMTHEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  86   LYFVYLGLIVCVSSYAEIACWMY  108



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   QLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  86   LYFVYLGLVVCISSYAEIACWMY  108



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  358  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  537
            LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L
Sbjct  36   LFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVSKYAL  95

Query  538  DFVYLSIVILFSSWTEVACWMH  603
             FVYL +V+  SS+ E+ACWM+
Sbjct  96   YFVYLGLVVCISSYAEIACWMY  117



>ref|XP_007160658.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
 gb|ESW32652.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
Length=1247

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF+ AD  D VLMF+G VG+C+HGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  26   SFFGLFATADSTDCVLMFLGSVGSCLHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRVS  85

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL  V+L S+W  VA WM 
Sbjct  86   EHALYLVYLGGVVLVSAWMGVAFWMQ  111



>ref|XP_003549468.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF+ AD  D VLMF+G  G+CVHGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  30   SFFGLFATADATDCVLMFLGCFGSCVHGAALPVFFILFGRMIDSLGHLSNDPHKLSSRVS  89

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL  V+L S+W  VA WM 
Sbjct  90   EHALYLVYLGGVVLVSAWMGVAFWMQ  115



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D++LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAK
Sbjct  24   FFQLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAK  83

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++  +S+ E+ACWM+
Sbjct  84   YALYFVYLGLIVCVTSYAEIACWMY  108



>dbj|BAD07905.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07705.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=653

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  352  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  531
            +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK 
Sbjct  38   LKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKM  97

Query  532  SL  537
             L
Sbjct  98   PL  99



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
              +LFSFAD  D++LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAK
Sbjct  24   FFQLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAK  83

Query  529  YSLDFVYLSIVILFSSWTEVACWMH  603
            Y+L FVYL +++  +S+ E+ACWM+
Sbjct  84   YALYFVYLGLIVCVTSYAEIACWMY  108



>ref|XP_010501626.1| PREDICTED: ABC transporter B family member 14-like [Camelina 
sativa]
Length=1233

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  13   SLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVS  72

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +  L S+W  VACWM 
Sbjct  73   QNALYLVYLGLFNLVSAWIGVACWMQ  98



>ref|XP_010480688.1| PREDICTED: ABC transporter B family member 14 [Camelina sativa]
Length=1247

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  33   SLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVS  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL +  L S+W  VACWM 
Sbjct  93   QNALYLVYLGLFNLVSAWIGVACWMQ  118



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            KLFSFAD  D + M  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   KLFSFADKYDCLFMITGSLGAIVHGSSMPVFFLIFGEMVNGFGKNQMDLHKLTDEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L F+YL +V+ FSS+ E+ACWM+
Sbjct  86   LYFIYLGLVVCFSSYAEIACWMY  108



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMY  108



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMY  108



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  25   QLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMY  107



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  25   QLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYA  84

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMY  107



>ref|XP_006306603.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
 gb|EOA39501.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
Length=1247

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL+ LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S  V+
Sbjct  32   SLLGLFGAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNLSTDPKAISSHVS  91

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  VYL  V L S+W  VACWM 
Sbjct  92   QNALYLVYLGFVNLVSAWIGVACWMQ  117



>gb|KDO84908.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1253

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  36   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  95

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL +V L S+W  VA WM 
Sbjct  96   EHALYLVYLGLVALVSAWIGVAFWMQ  121



>ref|XP_006435210.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
 gb|ESR48450.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
Length=1253

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  36   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  95

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL +V L S+W  VA WM 
Sbjct  96   EHALYLVYLGLVALVSAWIGVAFWMQ  121



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19 [Fragaria vesca 
subsp. vesca]
Length=1250

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D +LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  26   QLFSFADKYDCLLMVSGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTAEVAKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++  SS+ E+ACWM+
Sbjct  86   LYFVYLGLIVCVSSYAEIACWMY  108



>ref|XP_006473687.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Citrus sinensis]
Length=1260

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  43   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  102

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL +V L S+W  VA WM 
Sbjct  103  EHALYLVYLGLVALVSAWIGVAFWMQ  128



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D +LM  G VGA VHG+++PVFF+ FG +++  G+        +H+V+KY+
Sbjct  29   ELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQHHLMVMTHEVSKYA  88

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  89   LYFVYLGLVVCLSSYAEIACWMY  111



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  137  QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  196

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  197  LYFVYLGLIVCFSSYAEIACWMY  219



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D +LM  G VGA VHG+++PVFF+ FG +++  G+     +  +H+V+KY+
Sbjct  30   ELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQTHLSVMTHEVSKYA  89

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ CWM+
Sbjct  90   LYFVYLGLVVCLSSYAEIGCWMY  112



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  40   ELFSFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDEVSKYS  99

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  100  LYFVYLGLVVCASSYLEIACWMY  122



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF+ AD +D   MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  123  SFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVS  182

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL + +L S+W  VA WM 
Sbjct  183  RHALYLVYLGLGVLASAWIGVAFWMQ  208



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  29   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTDEVSKYA  88

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ CWM+
Sbjct  89   LYFVYLGLVVCLSSYAEIGCWMY  111



>gb|KJB63497.1| hypothetical protein B456_010G002700 [Gossypium raimondii]
Length=1242

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S ++LFS AD +D  LM  G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  29   SFLRLFSAADKLDCALMVFGSLGACIHGAALPVFFVMFGRMIDSLGHLSSDPHKLSAQVS  88

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            ++++  VYL +V+  S+W  VA WM 
Sbjct  89   EHAIYLVYLGLVVFASAWIGVAFWMQ  114



>ref|XP_010439800.1| PREDICTED: ABC transporter B family member 14-like isoform X2 
[Camelina sativa]
Length=1249

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +LM LF  AD VD  LMF+G +G C+HG ++P FFVFFG ++D +G  +  P   S  V 
Sbjct  35   TLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFVFFGGMLDSLGNLYKDPKAISSHV-  93

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            K +L  VYL +V L S+W  VACWM 
Sbjct  94   KNALYLVYLGLVNLVSAWIGVACWMQ  119



>ref|XP_004173028.1| PREDICTED: ABC transporter B family member 19-like, partial [Cucumis 
sativus]
Length=848

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +++ FSS+ E+ACWM+
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMY  108



>ref|XP_002962569.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ36032.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1329

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            K+++FAD +DY+LM +G +GA VHG +VPV+F FFG+++D  GE +  P+  + +V+ YS
Sbjct  135  KMYAFADPLDYLLMAIGTLGAVVHGLAVPVYFYFFGRLVDAFGENYANPSSMASEVSTYS  194

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L  +YL++V+L ++W EV+CWMH
Sbjct  195  LYLLYLALVVLGAAWLEVSCWMH  217



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF+ AD +D   MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  33   SFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVS  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            +++L  VYL + +L S+W  VA WM 
Sbjct  93   RHALYLVYLGLGVLASAWIGVAFWMQ  118



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYS
Sbjct  29   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYS  88

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  89   LYFVYLGLVVCASSYLEIACWMY  111



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  +LF+FAD  D  LM  G VGA VHG+++PVFF+ FG +++  G+      + +++V+
Sbjct  24   AFYELFAFADRCDLALMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKMTNEVS  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KY+L FVYL +++  SS+ E+ACWM+
Sbjct  84   KYALYFVYLGLIVCLSSYAEIACWMY  109



>dbj|BAD12940.1| putative P-glycoprotein 1 [Oryza sativa Japonica Group]
Length=1344

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFADG+DYVLM +G +GA VHG S+PVF  FF  ++D  G     P      V KY+
Sbjct  97   QLFSFADGLDYVLMTLGTLGALVHGCSLPVFLRFFADLVDSFGSHAAHPDTMLRLVVKYA  156

Query  535  LDFVYLSIVILFSSWTEVACWM  600
              F+ +   I  SSW E++CWM
Sbjct  157  FYFLVVGAAIWASSWAEISCWM  178



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYS
Sbjct  33   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYS  92

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  93   LYFVYLGLVVCASSYLEIACWMY  115



>gb|EEE69159.1| hypothetical protein OsJ_28307 [Oryza sativa Japonica Group]
Length=1363

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFADG+DYVLM +G +GA VHG S+PVF  FF  ++D  G     P      V KY+
Sbjct  97   QLFSFADGLDYVLMTLGTLGALVHGCSLPVFLRFFADLVDSFGSHAAHPDTMLRLVVKYA  156

Query  535  LDFVYLSIVILFSSWTEVACWM  600
              F+ +   I  SSW E++CWM
Sbjct  157  FYFLVVGAAIWASSWAEISCWM  178



>gb|EEC84043.1| hypothetical protein OsI_30303 [Oryza sativa Indica Group]
Length=1366

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFADG+DYVLM +G +GA VHG S+PVF  FF  ++D  G     P      V KY+
Sbjct  97   QLFSFADGLDYVLMTLGTLGALVHGCSLPVFLRFFADLVDSFGSHAAHPDTMLRLVVKYA  156

Query  535  LDFVYLSIVILFSSWTEVACWM  600
              F+ +   I  SSW E++CWM
Sbjct  157  FYFLVVGAAIWASSWAEISCWM  178



>ref|XP_008788471.1| PREDICTED: ABC transporter B family member 13-like [Phoenix dactylifera]
Length=1276

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  358  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  537
            LFSFAD  D +LM  G +GACVHGA++P+FF+ FG++ID +G     P   + +V+K++L
Sbjct  55   LFSFADRFDCLLMIFGGIGACVHGAALPIFFLLFGRLIDSLGSLSADPQRLASEVSKHAL  114

Query  538  DFVYLSIVILFSSWTEVACW  597
              VY+ ++++ S+W  VA W
Sbjct  115  QLVYVGLLVMASAWIGVAFW  134



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  38   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYS  97

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  98   LYFVYLGLVVCASSYLEIACWMY  120



>ref|XP_006306598.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
 gb|EOA39496.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
Length=1277

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 63/117 (54%), Gaps = 31/117 (26%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKTISSRVS  91

Query  526  KYSL-------------DF------------------VYLSIVILFSSWTEVACWMH  603
            + SL             DF                  VYL +V L S+W  V+CWM 
Sbjct  92   QVSLKPAINGNILFLSIDFVVITFHGVLSFFKNALYLVYLGLVNLVSAWIGVSCWMQ  148



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  40   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYS  99

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  100  LYFVYLGLVVCASSYLEIACWMY  122



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  34   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYS  93

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  94   LYFVYLGLVVCASSYLEIACWMY  116



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  37   ELFIFADPLDWLLMAAGTAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDEVSKYS  96

Query  535  LDFVYLSIVILFSSWTEVACWMH  603
            L FVYL +V+  SS+ E+ACWM+
Sbjct  97   LYFVYLGLVVCASSYLEIACWMY  119



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +  +LF+FAD  D  LM  G +GA VHG+++PVFF+ FG +++  G+      + +++V+
Sbjct  24   AFYELFTFADRYDLALMAAGSLGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKMTNEVS  83

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            KY+L FVYL +V+  SS+ E+ACWM+
Sbjct  84   KYALYFVYLGLVVCLSSYAEIACWMY  109



>ref|XP_004304461.2| PREDICTED: ABC transporter B family member 1 [Fragaria vesca 
subsp. vesca]
Length=1354

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            ++F FADG+DYVLM +G VGA VHG S+P+F  FF  +++  G     P +   +V KY+
Sbjct  94   QVFRFADGLDYVLMGIGSVGAIVHGCSLPIFLRFFADLVNSFGANADHPDKMMQEVLKYA  153

Query  535  LDFVYLSIVILFSSWTEVACWM  600
            L F+ +   I  SSW E++CWM
Sbjct  154  LYFLVVGAAIWASSWAEISCWM  175



>ref|XP_010069803.1| PREDICTED: ABC transporter B family member 13-like [Eucalyptus 
grandis]
 gb|KCW58265.1| hypothetical protein EUGRSUZ_H00958 [Eucalyptus grandis]
Length=1253

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF  AD +D VLMF G  GAC+HGA++PVFFV FG++ID +G+    P   S +V+
Sbjct  40   SFFGLFVAADKIDCVLMFFGSAGACIHGAALPVFFVLFGRMIDSLGKLSSDPHGLSSRVS  99

Query  526  KYSLDFVYLSIVILFSSWTEVACW  597
            + +L  VYL +++  S+W  VA W
Sbjct  100  EDALYLVYLGVIVFASAWIGVALW  123



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SL  LF+FAD  DY LMF+  +G+ +HGA++P+FFVFFG++I+ +      P   + +++
Sbjct  33   SLFGLFAFADTFDYFLMFLATIGSIIHGAALPLFFVFFGRLINSLDSIAKDPHRLTSEIS  92

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L FVYL +++  S+W  +A WM 
Sbjct  93   QEALHFVYLGVLVFASAWMGIAFWMQ  118



>ref|XP_010460562.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Camelina sativa]
Length=1240

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            SLM LFS AD +DY LM +G +GACVHGA++P+FFVFFGK++D +G         S  V+
Sbjct  34   SLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVS  93

Query  526  KYSLDFVYLSIVILFSSW  579
            K +L  VYL +V L S+W
Sbjct  94   KNALYLVYLGLVNLVSAW  111



>ref|XP_010234205.1| PREDICTED: ABC transporter B family member 1 [Brachypodium distachyon]
Length=1376

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            +L  LF FADG+D VLM VG +GA VHG S+PVF  FF  ++D  G     P      V+
Sbjct  112  ALRDLFRFADGLDRVLMAVGTLGALVHGCSLPVFLRFFADLVDSFGSHAGDPDTMVRLVS  171

Query  526  KYSLDFVYLSIVILFSSWTEVACWM  600
            KY+L F+ +   I  SSW E+ACWM
Sbjct  172  KYALYFLVVGAAIWASSWAEIACWM  196



>ref|XP_011094609.1| PREDICTED: ABC transporter B family member 1-like [Sesamum indicum]
Length=1378

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L +LF FADG+DYVLM +G VGA VHG+S+P+F  FF  +++  G       + + +V K
Sbjct  115  LSELFRFADGLDYVLMAIGSVGAIVHGSSLPLFLRFFADLVNSFGSNANDVDKMTQEVLK  174

Query  529  YSLDFVYLSIVILFSSWTEVACWM  600
            Y+L F+ +   I  SSW E++CWM
Sbjct  175  YALYFLVVGAAIWASSWAEISCWM  198



>ref|XP_004494063.1| PREDICTED: ABC transporter B family member 1-like, partial [Cicer 
arietinum]
Length=1283

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FADG+DY+LM +G VGA VHG S+P+F  FF  +++  G       + +H+V KY+
Sbjct  98   ELFRFADGLDYILMTIGTVGAIVHGCSLPIFLRFFADLVNSFGSNANNLDKMTHEVVKYA  157

Query  535  LDFVYLSIVILFSSWTEVACWM  600
              F+ +   I  SSW E++CWM
Sbjct  158  FYFLVVGAAIWASSWAEISCWM  179



>gb|AFP44695.1| hypothetical protein [Eragrostis tef]
Length=1354

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +1

Query  349  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  528
            L  LF FADG+D VLM VG +GA VHG S+PVF  FF  ++D  G     P      VAK
Sbjct  104  LGSLFRFADGLDCVLMSVGTLGALVHGCSLPVFLRFFADLVDSFGSHADDPDTMVRLVAK  163

Query  529  YSLDFVYLSIVILFSSWTEVACWM  600
            Y+L F+ +   I  SSW E++CWM
Sbjct  164  YALYFLVVGAAIWASSWAEISCWM  187



>gb|KEH42187.1| ABC transporter B family protein [Medicago truncatula]
Length=1321

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LF FADG+DYVLM +G +GA VHG S+P+F  FF  +++  G       + + +VAKY+
Sbjct  62   ELFRFADGLDYVLMIIGSLGAVVHGCSLPLFLRFFADLVNSFGSNANNLDKMTQEVAKYA  121

Query  535  LDFVYLSIVILFSSWTEVACWM  600
            L F+ +   I  SSW E++CWM
Sbjct  122  LYFLIVGAAIWASSWAEISCWM  143



>ref|XP_006660395.1| PREDICTED: ABC transporter B family member 1-like [Oryza brachyantha]
Length=1332

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +1

Query  355  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  534
            +LFSFADG+DY+LM  G +GA VHG S+PVF  FF  ++D  G     P      V KY+
Sbjct  89   QLFSFADGLDYLLMAFGTLGALVHGCSLPVFLRFFADLVDSFGSHAAHPDTMLRLVVKYA  148

Query  535  LDFVYLSIVILFSSWTEVACWM  600
              F+ +   I  SSW E++CWM
Sbjct  149  FYFLVVGAAIWASSWAEISCWM  170



>ref|XP_004136487.1| PREDICTED: ABC transporter B family member 13-like [Cucumis sativus]
Length=1281

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF  ADG+D +LM  G +GA VHGAS+PVFFV FG++ID +G     P   S ++ 
Sbjct  61   SFFGLFGAADGIDCLLMVFGSLGAFVHGASLPVFFVLFGRMIDSLGHLSKHPHRLSSRIV  120

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  +YL +++L S+W  VA WM 
Sbjct  121  ENALYLIYLGLIVLASAWIGVAFWMQ  146



>gb|KGN60047.1| hypothetical protein Csa_3G873270 [Cucumis sativus]
Length=1248

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  346  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  525
            S   LF  ADG+D +LM  G +GA VHGAS+PVFFV FG++ID +G     P   S ++ 
Sbjct  28   SFFGLFGAADGIDCLLMVFGSLGAFVHGASLPVFFVLFGRMIDSLGHLSKHPHRLSSRIV  87

Query  526  KYSLDFVYLSIVILFSSWTEVACWMH  603
            + +L  +YL +++L S+W  VA WM 
Sbjct  88   ENALYLIYLGLIVLASAWIGVAFWMQ  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230