BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS099B08

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 177   2e-47   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 176   3e-47   
gb|AAB17186.1|  plasma membrane H+-ATPase                               175   7e-47   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                175   7e-47   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   174   2e-46   Citrus sinensis [apfelsine]
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      173   4e-46   Solanum tuberosum [potatoes]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                172   8e-46   Sesamum indicum [beniseed]
ref|XP_010094202.1|  Plasma membrane ATPase 4                           171   2e-45   Morus notabilis
gb|KHG26452.1|  Plasma membrane ATPase 4                                169   2e-45   Gossypium arboreum [tree cotton]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                171   3e-45   Nicotiana sylvestris
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           171   3e-45   Sesamum indicum [beniseed]
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                170   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           170   5e-45   Cicer arietinum [garbanzo]
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                170   6e-45   Vitis vinifera
emb|CAN64375.1|  hypothetical protein VITISV_014422                     170   6e-45   Vitis vinifera
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         170   7e-45   Jatropha curcas
gb|KHN22686.1|  Plasma membrane ATPase 4                                169   8e-45   Glycine soja [wild soybean]
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             169   9e-45   Citrus clementina [clementine]
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             169   9e-45   Phaseolus vulgaris [French bean]
dbj|BAC77531.1|  plasma membrane H+-ATPase                              169   1e-44   Sesbania rostrata
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                169   1e-44   Nicotiana tomentosiformis
gb|KJB22048.1|  hypothetical protein B456_004G027300                    169   1e-44   Gossypium raimondii
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    169   1e-44   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAA37150.1|  p-type H+-ATPase                                       169   2e-44   Vicia faba [broad bean]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          169   2e-44   Medicago truncatula
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                169   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          169   2e-44   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           168   2e-44   
emb|CDP02997.1|  unnamed protein product                                168   2e-44   Coffea canephora [robusta coffee]
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                168   3e-44   
gb|KHN17608.1|  Plasma membrane ATPase 4                                168   4e-44   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    168   4e-44   Glycine max [soybeans]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                167   4e-44   Prunus mume [ume]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     167   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     167   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    167   5e-44   Ricinus communis
gb|KHG28536.1|  Plasma membrane ATPase 4                                165   5e-44   Gossypium arboreum [tree cotton]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             167   6e-44   Prunus persica
dbj|BAO45902.1|  plasma membrane H+-ATPase                              167   6e-44   Acacia mangium
gb|AAB84202.2|  plasma membrane proton ATPase                           167   7e-44   Kosteletzkya pentacarpos [seashore mallow]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                167   7e-44   Erythranthe guttata [common monkey flower]
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    166   1e-43   Prunus mume [ume]
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             166   1e-43   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                166   1e-43   Fragaria vesca subsp. vesca
emb|CAB69823.1|  plasma membrane H+ ATPase                              166   1e-43   Prunus persica
dbj|BAD16684.1|  plasma membrane H+-ATPase                              166   2e-43   Daucus carota [carrots]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    166   2e-43   Glycine max [soybeans]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             165   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111939.1|  Plasma membrane ATPase 4                           165   3e-43   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     165   4e-43   Populus euphratica
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             165   4e-43   Elaeis guineensis
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     164   5e-43   Populus euphratica
dbj|BAD16687.1|  plasma membrane H+-ATPase                              164   5e-43   Daucus carota [carrots]
ref|XP_003594954.1|  Plasma membrane ATPase                             164   6e-43   Medicago truncatula
dbj|BAD16685.1|  plasma membrane H+-ATPase                              164   6e-43   Daucus carota [carrots]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          164   6e-43   Amborella trichopoda
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                164   7e-43   Phoenix dactylifera
gb|KHN15309.1|  Plasma membrane ATPase 4                                164   7e-43   Glycine soja [wild soybean]
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           164   8e-43   Glycine max [soybeans]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           164   8e-43   Malus domestica [apple tree]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           164   9e-43   Phoenix dactylifera
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    164   9e-43   Fragaria vesca subsp. vesca
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    164   9e-43   Fragaria vesca subsp. vesca
ref|XP_002324397.1|  H+-ATPase family protein                           164   1e-42   
gb|AFM52333.1|  plasma membrane H+-ATPase                               164   1e-42   Malus baccata var. xiaojinensis
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  164   1e-42   Phoenix dactylifera
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                164   1e-42   Vitis vinifera
emb|CBI20766.3|  unnamed protein product                                163   1e-42   Vitis vinifera
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   161   1e-42   Citrus sinensis [apfelsine]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           163   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             163   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             163   2e-42   Phaseolus vulgaris [French bean]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     162   2e-42   Eucalyptus grandis [rose gum]
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   162   3e-42   Citrus sinensis [apfelsine]
dbj|BAD16688.1|  plasma membrane H+-ATPase                              162   4e-42   Daucus carota [carrots]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             162   4e-42   Citrus clementina [clementine]
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                162   4e-42   Eucalyptus grandis [rose gum]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             162   4e-42   Citrus sinensis [apfelsine]
gb|AAY42950.1|  plasma membrane H+ ATPase                               162   4e-42   Lupinus albus
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  162   4e-42   Elaeis guineensis
gb|KJB65971.1|  hypothetical protein B456_010G123000                    162   4e-42   Gossypium raimondii
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             162   5e-42   Elaeis guineensis
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             162   5e-42   Elaeis guineensis
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   161   6e-42   Citrus sinensis [apfelsine]
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 161   6e-42   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   161   7e-42   Citrus sinensis [apfelsine]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           161   8e-42   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    161   9e-42   Populus euphratica
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           161   9e-42   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                160   1e-41   Eucalyptus grandis [rose gum]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    160   1e-41   Gossypium raimondii
gb|KJB55189.1|  hypothetical protein B456_009G068100                    160   1e-41   Gossypium raimondii
gb|AAY42949.1|  plasma membrane H+ ATPase                               160   1e-41   Lupinus albus
gb|KJB66333.1|  hypothetical protein B456_010G136300                    160   1e-41   Gossypium raimondii
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    159   2e-41   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             160   3e-41   Capsella rubella
gb|EPS65442.1|  hypothetical protein M569_09334                         159   3e-41   Genlisea aurea
gb|AAY42948.1|  plasma membrane H+ ATPase                               159   3e-41   Lupinus albus
emb|CAA59799.1|  H(+)-transporting ATPase                               159   4e-41   Phaseolus vulgaris [French bean]
ref|NP_001190870.1|  H(+)-ATPase 2                                      159   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     159   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          159   4e-41   Camelina sativa [gold-of-pleasure]
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         159   4e-41   Jatropha curcas
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     159   4e-41   Eucalyptus grandis [rose gum]
ref|NP_194748.1|  H(+)-ATPase 2                                         159   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           159   4e-41   Cicer arietinum [garbanzo]
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          159   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             159   4e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     159   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                159   4e-41   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ34124.1|  unnamed protein product                                159   5e-41   Eutrema halophilum
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             159   5e-41   Phaseolus vulgaris [French bean]
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    159   5e-41   
gb|KHF98166.1|  Plasma membrane ATPase 4                                157   6e-41   Gossypium arboreum [tree cotton]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           159   6e-41   Sesamum indicum [beniseed]
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     159   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           159   7e-41   Populus euphratica
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                158   7e-41   Erythranthe guttata [common monkey flower]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          158   8e-41   Medicago truncatula
ref|XP_006382164.1|  H+-ATPase family protein                           158   8e-41   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     158   9e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           158   9e-41   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           158   9e-41   Cicer arietinum [garbanzo]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           158   1e-40   Elaeis guineensis
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             158   1e-40   Phoenix dactylifera
emb|CAC29436.1|  P-type H+-ATPase                                       158   1e-40   Vicia faba [broad bean]
emb|CBW30173.1|  Plasma membrane ATPase 4                               158   1e-40   Musa balbisiana [starchy banana]
emb|CBW30211.1|  Plasma membrane ATPase                                 158   1e-40   Musa balbisiana [starchy banana]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    158   1e-40   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             157   1e-40   Eutrema salsugineum [saltwater cress]
emb|CDY64741.1|  BnaCnng44750D                                          157   1e-40   Brassica napus [oilseed rape]
dbj|BAJ33915.1|  unnamed protein product                                157   1e-40   Eutrema halophilum
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          157   1e-40   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     157   1e-40   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             157   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH39758.1|  plasma membrane H+-ATPase                               157   1e-40   Medicago truncatula
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             157   1e-40   Capsella rubella
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    157   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          157   2e-40   Brassica rapa
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           157   2e-40   Cucumis melo [Oriental melon]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    157   2e-40   Phoenix dactylifera
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    157   2e-40   Phoenix dactylifera
gb|EPS73574.1|  hypothetical protein M569_01174                         156   2e-40   Genlisea aurea
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    155   2e-40   
gb|AFW04239.1|  plasma membrane H+-ATPase                               157   2e-40   Sesuvium portulacastrum [sea-purslane]
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    157   2e-40   Arabis alpina [alpine rockcress]
gb|KGN62872.1|  hypothetical protein Csa_2G378540                       154   2e-40   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   157   3e-40   Vicia faba [broad bean]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    157   3e-40   Gossypium raimondii
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    157   3e-40   Glycine max [soybeans]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    156   4e-40   Tarenaya hassleriana [spider flower]
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            154   4e-40   Gossypium arboreum [tree cotton]
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             156   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          156   5e-40   Brassica rapa
gb|KFK29576.1|  h(+)-atpase 2                                           156   5e-40   Arabis alpina [alpine rockcress]
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             156   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                155   6e-40   Cucumis melo [Oriental melon]
emb|CDX82608.1|  BnaC07g02580D                                          155   6e-40   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             155   7e-40   Phaseolus vulgaris [French bean]
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          155   7e-40   Brassica rapa
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    155   7e-40   Tarenaya hassleriana [spider flower]
gb|AAB41898.1|  H+-transporting ATPase                                  155   7e-40   Mesembryanthemum crystallinum
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     155   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     155   8e-40   Tarenaya hassleriana [spider flower]
dbj|BAF03589.1|  P-type H+-ATPase                                       155   8e-40   Zostera marina
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           155   9e-40   Elaeis guineensis
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             155   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    155   1e-39   Glycine max [soybeans]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     155   1e-39   Morus notabilis
dbj|BAC77530.1|  plasma membrane H+-ATPase                              155   1e-39   Sesbania rostrata
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          154   2e-39   Amborella trichopoda
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          154   2e-39   Brassica rapa
emb|CDY47940.1|  BnaA02g08160D                                          154   2e-39   Brassica napus [oilseed rape]
emb|CDY38294.1|  BnaA10g11420D                                          154   2e-39   Brassica napus [oilseed rape]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    154   3e-39   Populus euphratica
gb|KEH39753.1|  plasma membrane H+-ATPase                               154   3e-39   Medicago truncatula
gb|AHK23067.1|  plasma membrane ATPase 4                                154   3e-39   Fagopyrum tataricum [Kangra buckwheat]
ref|NP_200545.1|  H(+)-ATPase 3                                         154   3e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25913.1|  BnaC09g32850D                                          154   3e-39   Brassica napus [oilseed rape]
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             154   3e-39   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      154   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ27822.1|  PM H+-ATPase R                                          154   4e-39   Eichhornia crassipes
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           153   4e-39   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     153   4e-39   
gb|ACE77057.1|  plasma membrane proton pump                             153   4e-39   Cucumis sativus [cucumbers]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           153   4e-39   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          153   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007012006.1|  H(+)-ATPase 8                                      153   5e-39   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           153   5e-39   Cicer arietinum [garbanzo]
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          153   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     153   5e-39   Brassica rapa
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             153   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN16462.1|  Plasma membrane ATPase 4                                153   5e-39   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      153   5e-39   Glycine max [soybeans]
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           153   5e-39   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          153   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             152   7e-39   Capsella rubella
gb|KJB54894.1|  hypothetical protein B456_009G053500                    152   8e-39   Gossypium raimondii
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         152   9e-39   Jatropha curcas
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    152   9e-39   Glycine max [soybeans]
gb|AAK31799.2|  plasma membrane H+ ATPase                               152   1e-38   Lilium longiflorum [Easter lily]
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    152   1e-38   Arabis alpina [alpine rockcress]
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  152   1e-38   Nelumbo nucifera [Indian lotus]
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   152   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179486.1|  H(+)-ATPase 1                                         152   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                152   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    152   1e-38   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           152   1e-38   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    150   1e-38   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          152   1e-38   Fragaria vesca subsp. vesca
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             152   2e-38   Eutrema salsugineum [saltwater cress]
gb|KJB82762.1|  hypothetical protein B456_013G212200                    150   2e-38   Gossypium raimondii
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             152   2e-38   Oryza brachyantha
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    152   2e-38   
emb|CDY50939.1|  BnaC03g74390D                                          151   2e-38   Brassica napus [oilseed rape]
emb|CDX93092.1|  BnaA03g38140D                                          151   2e-38   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        151   2e-38   Lilium longiflorum [Easter lily]
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    151   2e-38   Arabis alpina [alpine rockcress]
ref|XP_007023381.1|  H(+)-ATPase 9                                      151   3e-38   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     151   3e-38   Cucumis melo [Oriental melon]
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          151   3e-38   Cucumis melo [Oriental melon]
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    151   3e-38   Brassica rapa
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    150   4e-38   Brassica rapa
emb|CDX72217.1|  BnaC07g42390D                                          150   4e-38   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     150   4e-38   Brassica rapa
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       150   4e-38   
emb|CDX72218.1|  BnaC07g42400D                                          150   4e-38   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     150   4e-38   
emb|CDY51650.1|  BnaAnng10900D                                          150   5e-38   Brassica napus [oilseed rape]
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    150   5e-38   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    150   5e-38   Eucalyptus grandis [rose gum]
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         150   6e-38   Jatropha curcas
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          150   6e-38   Brassica rapa
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           150   6e-38   Cucumis melo [Oriental melon]
emb|CDY67153.1|  BnaAnng23670D                                          150   6e-38   Brassica napus [oilseed rape]
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       149   6e-38   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          150   7e-38   Cucumis melo [Oriental melon]
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             150   8e-38   Cicer arietinum [garbanzo]
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    150   8e-38   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     150   8e-38   Cucumis sativus [cucumbers]
dbj|BAL41366.1|  plasma membrane H+-ATPase                              150   8e-38   Aeluropus littoralis
emb|CDP14278.1|  unnamed protein product                                150   9e-38   Coffea canephora [robusta coffee]
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEO22063.1|  plasma membrane H+-ATPase                               149   1e-37   Aeluropus littoralis
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                149   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                149   1e-37   Elaeis guineensis
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       148   1e-37   
ref|XP_002324564.1|  ATPase 6 family protein                            149   2e-37   Populus trichocarpa [western balsam poplar]
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          149   2e-37   Glycine soja [wild soybean]
gb|ABR18001.1|  unknown                                                 149   2e-37   Picea sitchensis
gb|ACL54575.1|  unknown                                                 149   2e-37   Zea mays [maize]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  149   2e-37   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     149   2e-37   Cucumis sativus [cucumbers]
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       149   2e-37   
dbj|BAD19091.1|  putative H+-exporting ATPase                           149   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     148   2e-37   Sesamum indicum [beniseed]
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    148   2e-37   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     148   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          148   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       148   3e-37   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          148   3e-37   Sesamum indicum [beniseed]
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    148   3e-37   Glycine max [soybeans]
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    148   3e-37   Glycine max [soybeans]
emb|CAD29312.1|  plasma membrane H+-ATPase                              148   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KEH19962.1|  plasma membrane H+-ATPase                               148   3e-37   Medicago truncatula
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     148   3e-37   Eucalyptus grandis [rose gum]
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     148   3e-37   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          148   3e-37   Glycine soja [wild soybean]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          148   4e-37   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          147   4e-37   Sorghum bicolor [broomcorn]
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     147   4e-37   Sesamum indicum [beniseed]
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          147   5e-37   Vitis vinifera
gb|KJB70727.1|  hypothetical protein B456_011G089100                    147   5e-37   Gossypium raimondii
ref|NP_178762.1|  H(+)-ATPase 6                                         147   5e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32174.1|  plasma membrane H+-ATPase                               147   6e-37   Medicago truncatula
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    147   7e-37   Glycine max [soybeans]
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     147   7e-37   Oryza brachyantha
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             147   7e-37   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             147   8e-37   
gb|KFK27283.1|  h(+)-atpase 3                                           147   9e-37   
gb|KJB56561.1|  hypothetical protein B456_009G125200                    147   1e-36   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          146   1e-36   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       146   1e-36   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     146   1e-36   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     146   1e-36   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          146   1e-36   
gb|ABW25091.1|  plasma membrane proton pump                             146   1e-36   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             146   2e-36   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             146   2e-36   
ref|NP_001054118.1|  Os04g0656100                                       145   2e-36   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          145   3e-36   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     145   3e-36   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          145   3e-36   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          145   4e-36   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           145   4e-36   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    145   4e-36   
ref|NP_001185450.1|  H(+)-ATPase 9                                      145   4e-36   
ref|NP_178181.1|  H(+)-ATPase 9                                         145   5e-36   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   145   5e-36   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             145   5e-36   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       143   5e-36   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       145   5e-36   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    144   5e-36   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             144   6e-36   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          144   6e-36   
ref|XP_002307856.1|  ATPase 6 family protein                            144   6e-36   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     144   6e-36   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                144   7e-36   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     144   7e-36   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     144   7e-36   
gb|EAZ06139.1|  hypothetical protein OsI_28373                          144   7e-36   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          144   8e-36   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       144   8e-36   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    144   8e-36   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           144   8e-36   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           144   8e-36   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             144   8e-36   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     144   9e-36   
dbj|BAD33363.1|  putative plasma membrane H+-ATPase                     144   9e-36   
emb|CAD29311.1|  plasma membrane H+-ATPase                              144   9e-36   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  144   1e-35   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    144   1e-35   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          144   1e-35   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    143   1e-35   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     143   1e-35   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           143   1e-35   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     143   1e-35   
gb|ABA18090.1|  putative plasma membrane ATPase                         143   2e-35   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     143   2e-35   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          143   2e-35   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          142   2e-35   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     142   3e-35   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          142   3e-35   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    142   3e-35   
gb|AAR32129.2|  proton P-ATPase                                         142   3e-35   
gb|AAV71150.1|  plasma membrane H+-ATPase                               142   3e-35   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             142   3e-35   
gb|EMT26270.1|  Plasma membrane ATPase                                  142   3e-35   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           142   3e-35   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     142   3e-35   
gb|EMS60594.1|  Plasma membrane ATPase                                  142   3e-35   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    142   3e-35   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     142   3e-35   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          142   3e-35   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          142   4e-35   
emb|CBI35956.3|  unnamed protein product                                142   4e-35   
gb|ABA18112.1|  putative plasma membrane ATPase                         142   4e-35   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             142   4e-35   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    142   4e-35   
gb|KJB19306.1|  hypothetical protein B456_003G094300                    142   5e-35   
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    142   5e-35   
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     137   5e-35   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     142   5e-35   
ref|XP_011468858.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    142   5e-35   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            140   5e-35   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     142   5e-35   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             142   5e-35   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    142   6e-35   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             141   6e-35   
gb|KJB19305.1|  hypothetical protein B456_003G094300                    141   6e-35   
gb|KJB19302.1|  hypothetical protein B456_003G094300                    141   6e-35   
gb|KEH37844.1|  plasma membrane H+-ATPase                               141   6e-35   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             141   7e-35   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          141   7e-35   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          141   7e-35   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           141   7e-35   
dbj|BAK05828.1|  predicted protein                                      141   7e-35   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                141   7e-35   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    141   7e-35   
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     137   8e-35   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          141   8e-35   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          141   8e-35   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          141   8e-35   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     141   9e-35   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    141   9e-35   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    141   9e-35   
gb|KJB19303.1|  hypothetical protein B456_003G094300                    141   9e-35   
ref|NP_001048395.2|  Os02g0797300                                       141   9e-35   
ref|XP_002309321.1|  ATPase 6 family protein                            141   1e-34   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             141   1e-34   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   1e-34   
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   139   1e-34   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    140   1e-34   
gb|KJB19307.1|  hypothetical protein B456_003G094300                    140   1e-34   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           140   1e-34   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              140   1e-34   
emb|CDO98206.1|  unnamed protein product                                140   1e-34   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     140   1e-34   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   1e-34   
emb|CDY67606.1|  BnaAnng24780D                                          137   2e-34   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610          140   2e-34   
ref|XP_002297804.2|  H+-ATPase family protein                           140   2e-34   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    140   2e-34   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   2e-34   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             140   2e-34   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    140   2e-34   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   139   2e-34   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             140   2e-34   
emb|CDY69631.1|  BnaCnng64550D                                          137   2e-34   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           140   2e-34   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    140   2e-34   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           140   2e-34   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    140   2e-34   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     140   3e-34   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     140   3e-34   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     140   3e-34   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    140   3e-34   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     139   3e-34   
ref|NP_201073.1|  H(+)-ATPase 11                                        139   3e-34   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     139   3e-34   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    139   3e-34   
ref|XP_002304716.2|  H+-ATPase family protein                           139   3e-34   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             139   3e-34   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    139   4e-34   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    139   4e-34   
gb|KEH35952.1|  plasma membrane H+-ATPase                               139   4e-34   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          139   4e-34   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    139   4e-34   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             139   4e-34   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             139   4e-34   
ref|NP_189850.1|  H(+)-ATPase 8                                         139   4e-34   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    139   5e-34   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    139   5e-34   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    139   5e-34   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             139   5e-34   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                          138   5e-34   
emb|CDY56511.1|  BnaCnng30540D                                          139   5e-34   
gb|KEH39623.1|  plasma membrane H+-ATPase                               139   6e-34   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             139   6e-34   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         139   6e-34   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     139   6e-34   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    138   7e-34   
emb|CDX67957.1|  BnaA07g19970D                                          138   7e-34   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    138   8e-34   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           138   8e-34   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     138   9e-34   
gb|AAV49159.1|  plasma membrane proton ATPase 5                         138   9e-34   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              137   1e-33   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     138   1e-33   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    138   1e-33   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    138   1e-33   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         138   1e-33   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              138   1e-33   
emb|CDX76809.1|  BnaC08g33950D                                          128   1e-33   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    138   1e-33   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    138   1e-33   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             138   1e-33   
gb|EPS57651.1|  hypothetical protein M569_17165                         138   1e-33   
emb|CDY34767.1|  BnaA09g41340D                                          138   1e-33   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          138   1e-33   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          138   1e-33   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    138   1e-33   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    138   1e-33   
ref|NP_001059093.1|  Os07g0191200                                       137   1e-33   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         137   1e-33   
gb|EEC81667.1|  hypothetical protein OsI_25220                          137   1e-33   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    137   2e-33   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         137   2e-33   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       137   2e-33   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    137   2e-33   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          137   2e-33   
gb|EEC69747.1|  hypothetical protein OsI_39279                          137   2e-33   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          137   2e-33   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    137   2e-33   
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           137   2e-33   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     137   2e-33   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    137   2e-33   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           137   2e-33   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    137   2e-33   
ref|XP_009386906.1|  PREDICTED: ATPase 3, plasma membrane-type-like     128   2e-33   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     137   2e-33   
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    137   3e-33   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    137   3e-33   
ref|NP_001067382.1|  Os12g0638700                                       137   3e-33   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           137   3e-33   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             137   3e-33   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    137   3e-33   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     137   3e-33   
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    137   3e-33   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           137   3e-33   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    137   3e-33   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    136   3e-33   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    137   3e-33   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             136   4e-33   
emb|CDY62140.1|  BnaCnng39300D                                          135   4e-33   
gb|EMS59303.1|  Plasma membrane ATPase                                  137   4e-33   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              136   4e-33   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             136   4e-33   
emb|CDY14186.1|  BnaA08g13170D                                          136   4e-33   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             136   4e-33   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               136   4e-33   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    136   5e-33   
gb|EPS63245.1|  hypothetical protein M569_11541                         136   5e-33   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              136   6e-33   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    136   6e-33   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                136   6e-33   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    135   6e-33   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           135   7e-33   



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   177 bits (448),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 101/109 (93%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  111



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   176 bits (447),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 101/109 (93%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  111



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   175 bits (444),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME AAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   KFLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  109



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   175 bits (444),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 102/107 (95%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME AAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   KFLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  109



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   174 bits (441),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 100/110 (91%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGDK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKES
Sbjct  1    MGDKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVIN  110



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   173 bits (439),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 102/107 (95%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVIN  109



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   172 bits (437),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 99/109 (91%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVCLLVIN  111



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   171 bits (434),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 99/108 (92%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGLTS+EGA+RLQIFGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVIN  111



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 100/106 (94%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLEKIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEKKESK+LK
Sbjct  3    AISLEEIKNETVDLEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKKESKILK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  108



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   171 bits (432),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 96/107 (90%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDF+GI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVIN  109



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   171 bits (432),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MG  +I+LEQIKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANR+QIFGPNKLEEKKES
Sbjct  1    MGGDAISLEQIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGIVCLLVIN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAALMAIVLANGSGQPPDWQDFVGIVCLLVIN  110



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   170 bits (431),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 99/109 (91%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVIN  111



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   170 bits (431),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 96/109 (88%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             +KSI+LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    ANKSISLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVIN  111



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   170 bits (431),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3    GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIVCLLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVIN  111



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   170 bits (431),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3    GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIVCLLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVIN  111



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   170 bits (430),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 99/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  3    KSITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIMCLLVIN  109



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   169 bits (429),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 97/106 (92%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  67   FLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFVGIVCLLVIN  112



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   169 bits (429),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 100/111 (90%), Positives = 109/111 (98%), Gaps = 1/111 (1%)
 Frame = +1

Query  274  MGDKS-ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  450
            MGDK+ I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKE
Sbjct  1    MGDKTAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKE  60

Query  451  skllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            SK+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVIN  111



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   169 bits (429),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 99/106 (93%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +ITL+QIKNETVDLE+IPIEEVF+QLKCSREGL+ DEGANRLQIFGPNKLEEKKESKLLK
Sbjct  7    AITLDQIKNETVDLERIPIEEVFQQLKCSREGLSGDEGANRLQIFGPNKLEEKKESKLLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVIN
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVIN  112



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 98/106 (92%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SITLE+IKNETVDLE+IP+EEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LK
Sbjct  6    SITLEEIKNETVDLERIPVEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILK  65

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLL+IN
Sbjct  66   FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLLIN  111



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 97/107 (91%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESKLL
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDF+GI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFIGIICLLVIN  109



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 99/105 (94%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSDEGVNRLQIFGPNKLEEKKESKILKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  108



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 95/107 (89%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGA+RLQIFGPNKLEEK ESK+L
Sbjct  3    KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDF+GI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVIN  109



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   169 bits (427),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 97/108 (90%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +KSITLE+IKNETVDLE IP+EEVFEQLKC++EGL+ +EGANRLQIFGPNKLEEKKESKL
Sbjct  4    NKSITLEEIKNETVDLEHIPVEEVFEQLKCTKEGLSLEEGANRLQIFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVIN  111



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   169 bits (427),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 94/107 (88%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5    KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGI+CLLVIN
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVIN  111



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   169 bits (427),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 98/109 (90%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL++DEG +RLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSADEGESRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  111



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   169 bits (427),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 94/107 (88%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5    KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGI+CLLVIN
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVIN  111



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 96/108 (89%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVIN  111



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 99/109 (91%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGIVCLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGQDPDWQDFVGIVCLLVIN  111



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   168 bits (426),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 96/108 (89%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4    DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVIN  111



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   168 bits (425),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 97/106 (92%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVIN  112



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   168 bits (425),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 97/106 (92%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7    AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  67   FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVIN  112



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL+ +EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  112



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVIN  111



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVIN  111



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   167 bits (424),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 96/107 (90%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            KSI+LE+IKNETVDLE+IPI+EVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+L
Sbjct  3    KSISLEEIKNETVDLERIPIDEVFEQLKCTREGLSSDEGTNRLQIFGPNKLEEKKESKIL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDF+GI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGEPPDWQDFIGIICLLVIN  109



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   165 bits (418),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 97/105 (92%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+SDEG NR+QIFGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSDEGVNRIQIFGPNKLEEKKESKILKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVIN  108



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   167 bits (423),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL  +EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  112



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   167 bits (423),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE VDLE+IP++EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNEAVDLERIPVDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDW+DFVGI+CLLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWEDFVGIICLLVIN  111



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   167 bits (422),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 97/107 (91%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+I+NETVDLEKIPIEEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  5    KGISLEEIRNETVDLEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVIN
Sbjct  65   KFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVIN  111



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   167 bits (422),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 97/108 (90%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+++LE IKNETVDLEK+PIEEVFEQLKC+REGL+SDEGANRL++FGPNKLEEKKESK+
Sbjct  2    DKALSLEGIKNETVDLEKVPIEEVFEQLKCNREGLSSDEGANRLELFGPNKLEEKKESKV  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  109



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   166 bits (421),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 97/109 (89%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVIN  111



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   166 bits (420),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 97/109 (89%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRPPDWQDFVGIVVLLVIN  111



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   166 bits (420),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 98/108 (91%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFAQLKCSREGLSSAEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  112



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   166 bits (420),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 97/109 (89%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRPPDWQDFVGIVVLLVIN  111



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   166 bits (419),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 97/105 (92%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESKLLKF
Sbjct  3    LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKLLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGI+CLLVIN
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIICLLVIN  107



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   166 bits (419),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+IN
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLIN  112



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   166 bits (419),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+I+LE+IKNE VDLE++PIEEVFEQLKC+REGLTS EGANRLQIFGPNKLEEKKESK
Sbjct  3    GNKAISLEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AA+MAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVIN  111



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   165 bits (418),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNETVDLE+IP++EVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AA+MAIALANG GKPPDWQDFVGIV LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVIN  111



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =   165 bits (417),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK ITLE+IKNE+VDLE+IP+EEVFEQLKC+R+GLTS+EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKGITLEEIKNESVDLERIPMEEVFEQLKCTRQGLTSEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+IN
Sbjct  63   FLKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIVLLLIN  111



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   165 bits (417),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL+IN
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLIN  111



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   165 bits (417),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGDK I+LE+IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKES
Sbjct  1    MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME AAIMAIALANG GKPPDW+DFVGIV LL IN
Sbjct  61   KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFIN  110



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   164 bits (414),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL+IN
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLIN  111



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   164 bits (416),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 96/103 (93%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVFEQLKC+REGL+ DEGANRLQIFGPNKLEEKKESKLLKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFEQLKCTREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAI LANGDGKPPDWQDFVGI+CLL+IN
Sbjct  64   FMWNPLSWVMEAAAIMAIVLANGDGKPPDWQDFVGIICLLLIN  106



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   164 bits (416),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK SI+L+QIKNETVDLE+IPIEEVFEQLKC+REGL+S EG NR+QIFGPNKLEEKKES
Sbjct  4    GDKGSISLDQIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRIQIFGPNKLEEKKES  63

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAA+MAIALANG+G+PPDWQDFVGI+CLLVIN
Sbjct  64   KFLKFLGFMWNPLSWVMEAAALMAIALANGEGQPPDWQDFVGIICLLVIN  113



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   164 bits (416),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 96/105 (91%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRL+IFGPNKLEEKKESK LKF
Sbjct  3    ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSTDEGANRLEIFGPNKLEEKKESKFLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVIN
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVIN  107



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   164 bits (416),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNE VDLE IPIEEVFEQLKCS+EGLTSDEGANRLQIFGPNKLEEKKESK+LKF
Sbjct  3    ISLEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LLVIN
Sbjct  63   LGFMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVIN  107



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   164 bits (415),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GGSTISLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME+AA+MAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVIN  111



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   164 bits (415),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+IN
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLIN  112



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   164 bits (415),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 98/110 (89%), Positives = 106/110 (96%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+IN
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLIN  112



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   164 bits (415),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S+EG  RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPIEEVFGQLKCSREGLSSEEGGQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGILCLLVIN  112



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   164 bits (415),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVF+QLKC+REGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    GGTAISLEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIV LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVIN  111



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   164 bits (415),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 93/109 (85%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4    GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDF+GI  LL++N
Sbjct  64   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVN  112



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   164 bits (414),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 93/109 (85%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4    GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDF+GI  LL++N
Sbjct  64   LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVN  112



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   164 bits (414),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVIN
Sbjct  67   LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVIN  111



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   164 bits (414),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVIN  111



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   164 bits (414),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+L++IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKPISLDEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVME AAIMAIALANGDG+PPDW+DFVGIV LL IN
Sbjct  63   LLKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWEDFVGIVALLFIN  111



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   164 bits (414),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 97/109 (89%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             DKSI LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLIN  111



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   163 bits (412),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 97/109 (89%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
             DKSI LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3    ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLIN  111



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   161 bits (408),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   163 bits (413),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 93/108 (86%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK+I+LE+IKNETVDLE+IP+EEVFEQLKCS+EGL+S+EGA RL+IFGPNKLEEKKESK 
Sbjct  5    DKAISLEEIKNETVDLERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKF  64

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANG+G+PPDWQDFVGI+CLLVIN
Sbjct  65   LKFLGFMWNPLSWVMEAAAVMAIALANGEGQPPDWQDFVGILCLLVIN  112



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   163 bits (412),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+L++IKNETVDLE+IPIEEVFEQLKC+REGL+  EGANRLQIFGPNKLEEKKESK
Sbjct  3    GDKAISLDEIKNETVDLERIPIEEVFEQLKCTREGLSLTEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGIV LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGSGKPPDWQDFVGIVVLLVIN  111



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   163 bits (412),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GDK +ITLE+I+NETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3    GDKGTITLEEIRNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+IN
Sbjct  63   KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLIN  112



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   162 bits (409),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4    NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLIN  111



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   162 bits (410),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   162 bits (410),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEG NRL+IFGPNKLEEKKESKLLKF
Sbjct  3    LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKF  62

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGI+CLLVIN
Sbjct  63   LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIMCLLVIN  107



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   162 bits (410),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK I+LEQIKNETVDLEKIPIEEVFEQLKC+  GLT+ EG +RLQIFGPNKLEEKKESK 
Sbjct  4    DKGISLEQIKNETVDLEKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGEGKPPDWQDFVGIVCLLVIN  111



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 90/107 (84%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+IKNETVDLE++PIEEVF+QLKC++EGL+S EGANRL+IFGPNKLEEKK+SK L
Sbjct  5    KGISLEEIKNETVDLERVPIEEVFQQLKCTKEGLSSGEGANRLEIFGPNKLEEKKDSKFL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME AAIMA+ALANG+GKPPDWQDFVGI+CLLVIN
Sbjct  65   KFLGFMWNPLSWVMELAAIMAVALANGEGKPPDWQDFVGIICLLVIN  111



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3    GGSAISLEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVIN  111



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   162 bits (409),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 93/109 (85%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+++EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GEKGISLEEIKNESVDLERIPIEEVFEQLKCTREGLSTEEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVIN  111



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   162 bits (409),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 93/109 (85%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G++ I+LE+IKNETVDLE+IP+EEVFEQLKC+REGL+++EGANRLQIFGPNKLEEKKESK
Sbjct  3    GEQGISLEEIKNETVDLERIPVEEVFEQLKCTREGLSAEEGANRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVIN  111



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   162 bits (409),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLE IPIEEVF+QLKC+REGLTSDEGA+RLQ+FGPNKLEEKKESK
Sbjct  3    GGTAISLEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVME+AAIMAIALANG GKPPDWQDFVGIV LLVIN
Sbjct  63   FLKFLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVIN  111



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   161 bits (407),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   161 bits (408),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 93/109 (85%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK I+L++IKNE+VDLE+IPIEEVFEQLKC+R GLT++EGANRLQ+FGPNKLEEKKESK
Sbjct  3    GDKGISLDEIKNESVDLERIPIEEVFEQLKCTRAGLTTEEGANRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LL IN
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLFIN  111



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   161 bits (407),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 95/109 (87%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVIN  111



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   161 bits (408),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK 
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKF  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVIN
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVIN  109



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   161 bits (407),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK+
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKI  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVIN
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVIN  109



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   161 bits (407),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIV LLVIN
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVIN  111



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4    NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLIN  111



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4    DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIALLLIN  111



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4    DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIALLLIN  111



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP++EVFEQLKCSREGLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLERIPVDEVFEQLKCSREGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVIN  108



>gb|KJB66333.1| hypothetical protein B456_010G136300 [Gossypium raimondii]
Length=949

 Score =   160 bits (406),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M DKSI+LE+IKNETVDLE+IP+EEVF+QLKC+R GLTS+EG  RLQIFGPNKLEEKKE+
Sbjct  1    MADKSISLEEIKNETVDLERIPVEEVFQQLKCTRNGLTSEEGQKRLQIFGPNKLEEKKEN  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDF+GIV LL IN
Sbjct  61   KLLKFLGFMWNPLSWVMEFAAIMAIALANGGGKPPDWQDFIGIVSLLFIN  110



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   159 bits (401),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 93/105 (89%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGL+S+EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCSREGLSSEEGTNRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIV LL+IN
Sbjct  67   LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVALLLIN  111



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGDDRLQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   159 bits (403),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 95/111 (86%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = +1

Query  274  MGDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  450
            M +K SI+LE+IKNETVDLEKIPIEEVFE L+C+REGL+S+EG  RLQIFGPNKLEEKKE
Sbjct  1    MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  451  skllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            SK+LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLL+IN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLLIN  111



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   159 bits (403),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I LE+IKNE VDLE+IP+EEVFEQLKC++EGL++ EGA+RL+IFGPNKLEEKKESK L
Sbjct  5    KGIPLEEIKNENVDLERIPVEEVFEQLKCTKEGLSTQEGASRLEIFGPNKLEEKKESKFL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  65   KFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIICLLVIN  111



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   159 bits (403),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVIN  108



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   159 bits (403),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+S+EGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPIEEVFEQLKCTREGLSSEEGANRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LL IN
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVALLFIN  111



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   159 bits (403),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3    GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVIN  111



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/105 (89%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPIEEVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNESVDLERIPIEEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVIN  108



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGL+S EG  RLQIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLSSREGEERLQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVIN  106



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   159 bits (402),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3    GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVIN  111



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTS EGA+RLQIFGPNKLEEK E+K L
Sbjct  3    KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSQEGADRLQIFGPNKLEEKTENKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVIN  109



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   159 bits (402),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   159 bits (402),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVIN  108



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   159 bits (401),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGL+++EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GEKGISLEEIKNESVDLERIPIEEVFEQLKCSREGLSTEEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVIN  111



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   159 bits (401),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            +K ITLE+IKNE VDLE+IP+EEVFEQLKC++EGLTS+EG NRL+IFGPNKLEEKKESK+
Sbjct  4    NKGITLEEIKNEAVDLERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVALLFIN  111



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   159 bits (401),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 95/104 (91%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLTS EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  106



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   159 bits (401),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LLVIN
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVIN  111



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   158 bits (400),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K +TLE+IKNE VDLE+IP+EEVFEQLKC+REGLTS+EG NRLQIFGPNKLEEKKESK+L
Sbjct  5    KGLTLEEIKNEAVDLERIPVEEVFEQLKCTREGLTSEEGQNRLQIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAI LANGD +PPDWQDFVGIV LL IN
Sbjct  65   KFLGFMWNPLSWVMEAAALMAIVLANGDNRPPDWQDFVGIVALLFIN  111



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   158 bits (400),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVIN  108



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   158 bits (400),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7    ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LLVIN
Sbjct  67   LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVIN  111



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   158 bits (399),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   158 bits (399),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            +G    +LE+IKNE VDLEKIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEK ES
Sbjct  2    VGGGPSSLEEIKNENVDLEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKSES  61

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAA+MAI LANGD +PPDWQDFVGI+ LLVIN
Sbjct  62   KFLKFLGFMWNPLSWVMEAAALMAIVLANGDHRPPDWQDFVGIMVLLVIN  111



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   158 bits (399),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSREGLTS+EG+NRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSREGLTSEEGSNRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAALMAIALANGSGRPPDWQDFVGIIALLVIN  108



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 94/105 (90%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKESKLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GD +I+L++IKNE VDLE+IP+EEVFEQLKC+REGL++ EG NRLQIFGPNKLEEKKESK
Sbjct  3    GDNAISLDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVIN  111



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCS+EGL+SDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSKEGLSSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVIN  108



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANGD K PDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVIN  111



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANGD K PDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVIN  111



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3    GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL IN
Sbjct  63   KLLKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFIN  112



>ref|XP_006409094.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
 gb|ESQ50547.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>emb|CDY64741.1| BnaCnng44750D [Brassica napus]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>dbj|BAJ33915.1| unnamed protein product [Thellungiella halophila]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010467735.1| PREDICTED: ATPase 1, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+ITLE IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GNKAITLEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AA+MAIALANGD K PDWQDFVGI+ LLVIN
Sbjct  63   ILKFLGFMWNPLSWVMEMAAVMAIALANGDNKDPDWQDFVGIIVLLVIN  111



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE+VDLE+IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNESVDLERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVIN  108



>ref|XP_010414912.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=980

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score =   157 bits (398),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_009112568.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
 emb|CDY30294.1| BnaA09g09830D [Brassica napus]
Length=949

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 93/110 (85%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = +1

Query  277  GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3    GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K+LKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL IN
Sbjct  63   KILKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFIN  112



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 93/105 (89%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 93/105 (89%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4    ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   156 bits (394),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 90/107 (84%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            +SI+LE+IKNETVDLEK+PIEEVFE+L+C+REGL+S+EG  RL IFGPNKLEEKKESK+L
Sbjct  5    ESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKESKIL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDF+GI+CLL+IN
Sbjct  65   KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFMGIICLLIIN  111



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   155 bits (393),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 92/110 (84%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  KS +LE+IKNETVDLE+IP+EEVF+QL C+REGL+SDEG  RLQIFGPNKLEEKKES
Sbjct  1    MAAKSFSLEEIKNETVDLERIPVEEVFQQLNCTREGLSSDEGQKRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGIV LL IN
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLFIN  110



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/107 (92%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTSDEGANRL +FGPNKLEEKKESK L
Sbjct  3    KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSDEGANRLNLFGPNKLEEKKESKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  109



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score =   157 bits (397),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 88/105 (84%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ ++IKNE VDLEKIP+EEVF+QLKCSREGL+S+EG NRLQIFGPNKLEEK+E+K+LKF
Sbjct  5    ISWDEIKNENVDLEKIPVEEVFQQLKCSREGLSSEEGRNRLQIFGPNKLEEKEENKILKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI+CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIIN  109



>gb|KGN62872.1| hypothetical protein Csa_2G378540 [Cucumis sativus]
Length=546

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESKLL
Sbjct  6    KAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLL  65

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL IN
Sbjct  66   KFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFIN  112



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   157 bits (396),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 92/106 (87%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LEQIKNE+VDLEKIPIEEVF QLKC+REGL+S EG +R+QIFGPNKLEEKKESK LK
Sbjct  3    AISLEQIKNESVDLEKIPIEEVFAQLKCTREGLSSTEGESRIQIFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIVCLLVIN
Sbjct  63   FLGFMWNPLSWVMEAAAVMAIALANGGGQPPDWQDFVGIVCLLVIN  108



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   157 bits (396),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVIN  111



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   157 bits (396),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVIN  108



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   156 bits (395),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4    SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEA AIMAIALANG G+PPDWQDF+GIVCLLVIN
Sbjct  64   GFMWNPLSWVMEAPAIMAIALANGGGRPPDWQDFLGIVCLLVIN  107



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            DK I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EG NRLQ+FGPNKLEEKKESK 
Sbjct  4    DKGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGTNRLQVFGPNKLEEKKESKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+IN
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIALLLIN  111



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   156 bits (394),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+ +LE++KNETVDLEKIPIEEVFEQLKC++EGLTS EGA+RLQIFGPNKLEEKKESK
Sbjct  3    GDKASSLEELKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVME AAIMAIALANG G+ PDWQDF+GI  LLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEMAAIMAIALANGGGRAPDWQDFLGIAILLVIN  111



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   156 bits (394),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE IKNETVDLEKIPIEEVF+QL C+REGLT+ EG  R+QIFGPNKLEEKKESK+LKF
Sbjct  1    MSLEDIKNETVDLEKIPIEEVFQQLNCTREGLTTQEGEERIQIFGPNKLEEKKESKILKF  60

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  61   LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  105



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   156 bits (394),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+ IFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIVIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   156 bits (394),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GD SI+LEQIKNE+VDLE+IP+EEVF QLKCSREGL+S EG  RLQIFGPNKLEEK ESK
Sbjct  6    GDGSISLEQIKNESVDLERIPVEEVFAQLKCSREGLSSPEGEQRLQIFGPNKLEEKTESK  65

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVME AAIMAIAL NG G+PPDWQDF+GIV LL+IN
Sbjct  66   FLKFLGFMWNPLSWVMEIAAIMAIALDNGGGEPPDWQDFIGIVVLLLIN  114



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGRGPDWQDFVGIVCLLVIN  111



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score =   155 bits (393),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   155 bits (393),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKVLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLIIN  108



>ref|XP_009102205.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
Length=949

 Score =   155 bits (393),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   155 bits (393),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4    SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANG G+PPDWQDF+GIVCLLVIN
Sbjct  64   GFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFLGIVCLLVIN  107



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   155 bits (393),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+ S++L++IK+E VDLEKIPIEEVF+ LKCSREGL+S EGANRLQIFGPNKLEEKK+SK
Sbjct  4    GNSSMSLQEIKDEKVDLEKIPIEEVFDSLKCSREGLSSAEGANRLQIFGPNKLEEKKDSK  63

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAA+MAI LANGD KPPDWQDFVGI+ LLVIN
Sbjct  64   FLKFLGFMWNPLSWVMEAAALMAIVLANGDHKPPDWQDFVGIIILLVIN  112



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   155 bits (393),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 93/104 (89%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK LKFL
Sbjct  3    SLEDIKNENVDLEKIPIEEVFQQLKCSREGLTTREGEDRLQIFGPNKLEEKKESKFLKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLVIN  106



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   155 bits (393),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE I+NETVDLEKIP+EEVF+QLKC++EGLT+ EG NRLQIFGPNKLEEKKESK LKFL
Sbjct  11   SLEDIRNETVDLEKIPVEEVFQQLKCTKEGLTTAEGENRLQIFGPNKLEEKKESKFLKFL  70

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGIVCLLVIN
Sbjct  71   GFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLVIN  114



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M +K I LE+IKNETVDLE+IP+EEVFEQLKCSREGL+ +EGA+RLQIFGPNKLEEKKES
Sbjct  1    MENKGINLEEIKNETVDLERIPVEEVFEQLKCSREGLSGEEGASRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+ LLVIN
Sbjct  61   KFLKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIIVLLVIN  110



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   155 bits (392),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE IP++EVFEQLKCSREGLTS +G  RLQIFGPNKLEEKKESKLLKF
Sbjct  4    ISLEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   155 bits (392),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+ +I+LEQIKNE VDLE+IP+EEVF QLKC+REGLT  EG  RLQIFGPNKLEEK+ESK
Sbjct  6    GNGTISLEQIKNEAVDLERIPVEEVFAQLKCTREGLTDAEGEQRLQIFGPNKLEEKQESK  65

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LLKFLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  66   LLKFLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  114



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   155 bits (392),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVIN  108



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   155 bits (391),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE +KNE VDLE+IPIEEVFEQLKC+REGLT DEG  RLQIFGPNKLEEKKESK LKF
Sbjct  4    ISLEDVKNENVDLERIPIEEVFEQLKCTREGLTKDEGEKRLQIFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   155 bits (391),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IP+EEVFEQLKCSR GL+SDEGA+RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLSSDEGASRLQVFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVIN  108



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   154 bits (390),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE+IKNE +DLE+IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+L
Sbjct  5    KAISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  65   KFLGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIIN  111



>ref|XP_009120261.1| PREDICTED: ATPase 3, plasma membrane-type [Brassica rapa]
Length=952

 Score =   154 bits (389),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVIN
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVIN  110



>emb|CDY47940.1| BnaA02g08160D [Brassica napus]
 emb|CDY42259.1| BnaC02g11560D [Brassica napus]
Length=951

 Score =   154 bits (389),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  6    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  65

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVIN
Sbjct  66   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVIN  109



>emb|CDY38294.1| BnaA10g11420D [Brassica napus]
Length=952

 Score =   154 bits (389),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVIN
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVIN  110



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K+I+LE I N+ +DLEKI +EEVFEQLKC++ GLTSDEGANRLQIFGPNK+EEKKESK L
Sbjct  3    KAISLEDITNKNIDLEKILVEEVFEQLKCTKXGLTSDEGANRLQIFGPNKVEEKKESKFL  62

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVMEAAAIMAIALANGD +PPDWQDFVGI+CLLVIN
Sbjct  63   KFLGFMWNPLSWVMEAAAIMAIALANGDRRPPDWQDFVGIICLLVIN  109



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI LEQ+KNE V+LE++PIEEVF+ LKCSR+GLTS+EGA+RLQ+FGPNKLEEK E+K LK
Sbjct  3    SINLEQMKNEDVNLERVPIEEVFDHLKCSRQGLTSEEGASRLQVFGPNKLEEKSENKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVIN
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIALLVIN  108



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  K + LE IKNE VDLE IPIEEVFEQLKCSREGL+++EG +RL IFGPNKLEEKKES
Sbjct  1    MAAKGLNLEDIKNEAVDLEHIPIEEVFEQLKCSREGLSAEEGDSRLAIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K+LKFLGFMWNPLSWVMEAAAIMAIALANGD KPPDWQDF+GI+CLLVIN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGDNKPPDWQDFLGIICLLVIN  110



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 94/103 (91%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>emb|CDY25913.1| BnaC09g32850D [Brassica napus]
Length=952

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7    SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVIN
Sbjct  67   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVIN  110



>ref|XP_002886251.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62510.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
Length=949

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+ LKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQSLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 94/103 (91%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   154 bits (388),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFL 
Sbjct  5    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLL  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LL+IN
Sbjct  65   FMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLIN  107



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   153 bits (387),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 87/109 (80%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K+I+LE+IKNE VDLE+IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3    GNKNISLEEIKNENVDLERIPVEEVFEQLKCTRQGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AA+MAI LANG G+PPD+QDFVGIV LL+IN
Sbjct  63   ILKFLGFMWNPLSWVMEIAALMAIGLANGGGEPPDYQDFVGIVVLLIIN  111



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   153 bits (387),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LENIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG  + PDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVIN  111



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4    DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAIALANG  + PDWQDFVGIVCLLVIN
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVIN  111



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 90/108 (83%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D   +LEQIKNETVDLE+IP+EEVFEQLKC+REGLT+ EG  RL+IFGPNKLEEKKE K 
Sbjct  4    DGDTSLEQIKNETVDLERIPVEEVFEQLKCTREGLTTAEGEKRLEIFGPNKLEEKKECKF  63

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVMEAAAIMAI LANG GKPPDWQDFVGIV LL IN
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIVALLFIN  111



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            S++L+ IKNETVDLE+IPI+EVFEQLKC+REGL++ EG NR+QIFGPNKLEEKKESK LK
Sbjct  8    SLSLDNIKNETVDLERIPIDEVFEQLKCTREGLSTAEGENRIQIFGPNKLEEKKESKFLK  67

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAA+MAIALANGD +PPDW+DFVGI+CLLVIN
Sbjct  68   FLGFMWNPLSWVMEAAAVMAIALANGDRQPPDWEDFVGIICLLVIN  113



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>ref|XP_009150710.1| PREDICTED: ATPase 1, plasma membrane-type-like [Brassica rapa]
Length=949

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNE VDLEKIPIEEVF+QLKC+ EGLT+ EG +R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4    LENIKNENVDLEKIPIEEVFQQLKCTSEGLTTQEGEDRIQLFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            GDK+ +LE ++NE VDLE+IPIEEVFEQL+C++EGLTS+EGANR+QIFG NKLEEKKESK
Sbjct  3    GDKASSLEDLRNEAVDLERIPIEEVFEQLQCTKEGLTSEEGANRIQIFGQNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDW+DFVGIV LLVIN
Sbjct  63   VLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVILLVIN  111



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFIN  108



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFIN  108



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   153 bits (387),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 86/110 (78%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            +G KS++LE IKNE+VDLEK+P+ EVFE LKC++EGLT++EG +RLQIFGPNKLEEK ES
Sbjct  8    VGTKSVSLEDIKNESVDLEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTES  67

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME AAIMAI LANG G+PPDWQDFVGIV LL+IN
Sbjct  68   KFLKFLGFMWNPLSWVMEIAAIMAIVLANGGGEPPDWQDFVGIVVLLIIN  117



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score =   153 bits (386),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIPIEEVF+QLKCSREGL+S+EG  RLQIFGPNKLEEK E+K LKF
Sbjct  5    ISWEEIKRENVDLEKIPIEEVFQQLKCSREGLSSEEGRKRLQIFGPNKLEEKTENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLIIN  109



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   152 bits (385),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I NE VDLEKIPIEEVF+QLKC+REGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5    LEDIVNENVDLEKIPIEEVFQQLKCTREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVIN
Sbjct  65   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVIN  107



>gb|KJB54894.1| hypothetical protein B456_009G053500 [Gossypium raimondii]
Length=952

 Score =   152 bits (385),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LEQIKNETVDLE+IP+EEVF+QLKC+REGLTS+EG  RLQIFGPNKLEEK+ESK LKF
Sbjct  7    ISLEQIKNETVDLERIPVEEVFQQLKCTREGLTSEEGEKRLQIFGPNKLEEKEESKFLKF  66

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANG GKPPDW DF+GIV LL IN
Sbjct  67   LGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWPDFIGIVSLLFIN  111



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   152 bits (385),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M  K+I+LE+IKNE VDLE+IP+EEVF+QL+C+REGL+S+EG  RLQIFGPNKLEEKKE+
Sbjct  1    MATKNISLEEIKNENVDLERIPVEEVFQQLQCTREGLSSEEGQKRLQIFGPNKLEEKKEN  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDF GIV LL+IN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFTGIVVLLIIN  110



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   152 bits (385),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLEKIP+EEVFE LKCS  GLTSDEGANRLQ+FGPNKLEEKKESKLLKF
Sbjct  4    ISLEEIKNENVDLEKIPVEEVFESLKCSTAGLTSDEGANRLQVFGPNKLEEKKESKLLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFIN  108



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE+IKNETVDLE+IP+EEVF QLKC++EGLT+ EG  RLQIFGPNKLEEKKESK LK
Sbjct  4    SISLEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLK  63

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGI+ LL+IN
Sbjct  64   FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIMVLLIIN  109



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIVIFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAI LANGD +PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAAIMAIVLANGDNRPPDWQDFVGIICLLVIN  106



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+KSI+LE+IKNE VDLE+IP++EVFEQLKC++EGLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3    GNKSISLEEIKNENVDLERIPVQEVFEQLKCTKEGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            +LKFLGFMWNPLSWVME AAIMAIALANG GKPPD+QDFVGIV LL IN
Sbjct  63   ILKFLGFMWNPLSWVMEIAAIMAIALANGGGKPPDYQDFVGIVVLLFIN  111



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAA+MAIALANGD +PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVIN  106



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAA+MAIALANGD +PPDWQDFVGI+CLLVIN
Sbjct  64   FMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVIN  106



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE I+NETVDLE IPIEEVF QLKCS+EGLTSDEGA RL+IFGPNKLEEKKESK LKFLG
Sbjct  5    LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVME+AAIMAI LANG GKPPDWQDFVGI+ LLVIN
Sbjct  65   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVIN  107



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   152 bits (383),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  5    LSLEEIKNETVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG GKPPDW+DFVGI+CLLVIN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVIN  109



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   152 bits (383),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNETVDLEKIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  5    LSLEEIKNETVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG GKPPDW+DFVGI+CLLVIN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVIN  109



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   150 bits (380),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNET+DLEKIPIEEVF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE K LKF
Sbjct  4    ISLEEIKNETIDLEKIPIEEVFQQLKCTKEGLTTAEGEKRLEIFGPNKLEEKKECKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME+AAIMAI LANG GKPPDWQDF+GI+ LL+IN
Sbjct  64   LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFLGIIVLLIIN  108



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   152 bits (383),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  283  KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  462
            K I+LE+IK E VDLE+IP++EVFEQL+C++EGL+SDEG  RLQ+FGPNKLEEKKE+K+L
Sbjct  5    KGISLEEIKKENVDLERIPVQEVFEQLQCTKEGLSSDEGQKRLQVFGPNKLEEKKENKVL  64

Query  463  kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KFLGFMWNPLSWVME AAIMAIALANG G+PPDWQDFVGI CLL+IN
Sbjct  65   KFLGFMWNPLSWVMEIAAIMAIALANGGGRPPDWQDFVGITCLLIIN  111



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score =   152 bits (383),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEKKE+K+LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKKENKVLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIIN  109



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  456
            G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3    GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  457  llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
             LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  63   FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVIN  111



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   152 bits (383),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IPIEEVFEQLKC+REGLTSDEGA R+++FGPNKLEEKKESK+LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLTSDEGARRIEVFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVIN
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVIN  106



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score =   152 bits (383),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI+CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIIN  109



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI+CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIIN  109



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI+CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIIN  109



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LE+IKNETVDLE+IP++EVF QLKC++EGLT+ EG  RLQIFGPNKLEEK ESK LK
Sbjct  7    SISLEEIKNETVDLERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLK  66

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVME AAIMAI +ANG GKPPDWQDFVGI+ LLVIN
Sbjct  67   FLGFMWNPLSWVMEIAAIMAIVMANGGGKPPDWQDFVGIMVLLVIN  112



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+ E+IK E VDLEKIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKF
Sbjct  5    ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANGDG+PPDWQDFVGI CLL+IN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIIN  109



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M DK  +L++IK+E VDLE+IPIEEVFEQLKC++EGLTS+EG  RLQIFGPNKLEEKKES
Sbjct  1    MVDKENSLQEIKSENVDLERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME AAIMAI LANG GKPPDWQDF+GIV LL+IN
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAICLANGGGKPPDWQDFLGIVVLLLIN  110



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE ++NE VDLE+IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LK
Sbjct  3    NISLEDVRNENVDLERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  63   FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  I+LE +KNE +DLE+IPIEEVFEQLKC++EGLT+ EG  RLQIFGPNKLEEKKES
Sbjct  1    MGD--ISLEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKES  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVME+AAIMAI LANG GKPPDWQDFVGI+ LL+IN
Sbjct  59   KLLKFLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIIN  108



>ref|XP_009137896.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X1 [Brassica 
rapa]
Length=976

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3    SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_009137897.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X2 [Brassica 
rapa]
Length=948

 Score =   150 bits (380),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3    SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>emb|CDX72217.1| BnaC07g42390D [Brassica napus]
Length=910

 Score =   150 bits (380),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3    LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  105



>ref|XP_009137895.1| PREDICTED: ATPase 2, plasma membrane-type-like [Brassica rapa]
Length=947

 Score =   150 bits (380),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3    LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  105



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   150 bits (379),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIIN  108



>emb|CDX72218.1| BnaC07g42400D [Brassica napus]
Length=911

 Score =   150 bits (380),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3    SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =   150 bits (379),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE ++NE +DLE+IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LK
Sbjct  3    NISLEDVRNENIDLERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  63   FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>emb|CDY51650.1| BnaAnng10900D [Brassica napus]
Length=910

 Score =   150 bits (379),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 90/103 (87%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3    LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  105



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   150 bits (379),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M    I+LEQIKNE++DLE+IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKES
Sbjct  1    MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIV LL+IN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIIN  110



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   150 bits (379),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            M    I+LEQIKNE++DLE+IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKES
Sbjct  1    MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIV LL+IN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIIN  110



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   150 bits (379),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 86/110 (78%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  I++EQIKNE VDLE+IP+E+VF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE+
Sbjct  1    MGD--ISMEQIKNENVDLERIPVEQVFQQLKCTKEGLTTAEGEKRLKIFGPNKLEEKKEN  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVME+AAIMAI LANG GKPPDWQDF+GIV LL+IN
Sbjct  59   KFLKFLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIVALLLIN  108



>ref|XP_009128001.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
 emb|CDY28167.1| BnaA01g06820D [Brassica napus]
Length=948

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   150 bits (379),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNE VDLEKIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  5    LSLEEIKNEAVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAIALANG GKPPDW+DFVGI+CLLVIN
Sbjct  65   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVIN  109



>emb|CDY67153.1| BnaAnng23670D [Brassica napus]
Length=918

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  471
            +LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFL
Sbjct  3    SLEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFL  62

Query  472  GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVIN
Sbjct  63   GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVIN  106



>gb|KGN60742.1| hypothetical protein Csa_2G009310 [Cucumis sativus]
Length=814

 Score =   149 bits (377),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            +I+LE ++NE +DLE+IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LK
Sbjct  3    NISLEDVRNENIDLERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+IN
Sbjct  63   FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIIN  108



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   150 bits (378),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIIN  108



>ref|XP_004498580.1| PREDICTED: plasma membrane ATPase-like [Cicer arietinum]
Length=952

 Score =   150 bits (378),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  286  SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  465
            SI+LEQ+KNE ++L++IP+EEVFEQLKCSR+GLTS+EG+ RLQ FGPNKLEEKKESK LK
Sbjct  3    SISLEQLKNENINLDQIPLEEVFEQLKCSRQGLTSEEGSKRLQSFGPNKLEEKKESKFLK  62

Query  466  FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVIN
Sbjct  63   FLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVIN  108



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   150 bits (378),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIIN  108



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   150 bits (378),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4    ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+IN
Sbjct  64   LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIIN  108



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   150 bits (378),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE+VDLE IP+EEVFEQLKC+REGL+S+EG  RLQ+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEEIKNESVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVIN  106



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   150 bits (379),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            ++LE+IKNE VDLE IPIEEVF+QLKCSREGL+ +EGA RLQIFGPNKLEEKKESKLLKF
Sbjct  5    LSLEEIKNEHVDLENIPIEEVFKQLKCSREGLSEEEGAKRLQIFGPNKLEEKKESKLLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGI  LL+IN
Sbjct  65   LGFMWNPLSWVMECAAVMAIVLANGGGKPPDWQDFVGIAVLLIIN  109



>ref|XP_009398632.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=952

 Score =   149 bits (377),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  459
            D +I+LE IKNETVDLE++PIEEVFEQLKC+++GLT+ EG  RLQIFGPNKLEEKKESK+
Sbjct  2    DGNISLEAIKNETVDLERVPIEEVFEQLKCTKDGLTTGEGDKRLQIFGPNKLEEKKESKV  61

Query  460  lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LKFLGFMWNPLSWVME AAIMAIALANG G+PPDWQDFVGI+ LL+IN
Sbjct  62   LKFLGFMWNPLSWVMEMAAIMAIALANGGGQPPDWQDFVGIIVLLLIN  109



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   149 bits (377),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  295  LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  474
            LE+IKNE VDLE IP+EEVFEQLKC+REGL+S+EG  RLQ+FGPNKLEEKKESK+LKFLG
Sbjct  4    LEEIKNEAVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  475  FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVIN
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVIN  106



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   149 bits (376),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE IKNET+DLE +PIEEVF +LKC+REGLTS+EGA RL IFGPNKLEEK+ESK LKF
Sbjct  5    ISLEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKF  64

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME+AAIMAI LANG GKPPDWQDFVGI+ LL+IN
Sbjct  65   LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIIN  109



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   149 bits (376),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  289  ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  468
            I+LE+IKNE VDLE+IPI+EVFEQLKCSREGL++ EG  RL+IFGPNKLEEKKESK+LKF
Sbjct  4    ISLEEIKNENVDLERIPIDEVFEQLKCSREGLSTAEGEQRLKIFGPNKLEEKKESKVLKF  63

Query  469  LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            LGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGIV LL+IN
Sbjct  64   LGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLIIN  108



>gb|KGN65225.1| hypothetical protein Csa_1G267210 [Cucumis sativus]
Length=778

 Score =   148 bits (374),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 2/110 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  I+LE +KNE +DLE+IP+EEVFEQLKC++EGL++ EG  RLQIFGPNKLEEKKES
Sbjct  1    MGD--ISLEDVKNENIDLERIPVEEVFEQLKCTKEGLSTAEGEKRLQIFGPNKLEEKKES  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            KLLKFLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGI+ LL+IN
Sbjct  59   KLLKFLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIIVLLIIN  108



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   149 bits (375),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = +1

Query  274  MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  453
            MGD  ++LEQIKNE +DLE+IP+EEVF+QL+C+REGLTS +G  RL+IFGPNKLEEKKE 
Sbjct  1    MGD--VSLEQIKNENIDLERIPVEEVFDQLRCTREGLTSAQGEERLKIFGPNKLEEKKEC  58

Query  454  kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVIN  603
            K LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIV LL+IN
Sbjct  59   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIIN  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370