BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS098H03

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622314.1|  PREDICTED: protein argonaute 4-like                238   2e-69   Nicotiana tomentosiformis
gb|ABC61505.1|  AGO4-2                                                  238   2e-69   Nicotiana benthamiana
ref|XP_006362741.1|  PREDICTED: protein argonaute 4-like                238   2e-69   Solanum tuberosum [potatoes]
ref|XP_009785001.1|  PREDICTED: protein argonaute 4-like                237   7e-69   Nicotiana sylvestris
ref|XP_006347268.1|  PREDICTED: protein argonaute 4-like isoform X1     234   7e-68   Solanum tuberosum [potatoes]
ref|NP_001289847.1|  uncharacterized protein LOC101246148               232   3e-67   Solanum lycopersicum
ref|NP_001266156.1|  uncharacterized protein LOC101256023               232   4e-67   Solanum lycopersicum
ref|XP_011080473.1|  PREDICTED: protein argonaute 4                     225   1e-64   Sesamum indicum [beniseed]
gb|AGS47791.1|  argonaute 4                                             223   5e-64   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009591976.1|  PREDICTED: protein argonaute 4                     221   2e-63   Nicotiana tomentosiformis
ref|XP_011090194.1|  PREDICTED: protein argonaute 4-like                221   3e-63   Sesamum indicum [beniseed]
gb|ABC61504.1|  AGO4-1                                                  219   1e-62   Nicotiana benthamiana
ref|XP_009773871.1|  PREDICTED: protein argonaute 4                     219   1e-62   Nicotiana sylvestris
gb|EYU46161.1|  hypothetical protein MIMGU_mgv1a000944mg                215   4e-61   Erythranthe guttata [common monkey flower]
ref|XP_004165479.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...    211   8e-60   
ref|XP_004149653.1|  PREDICTED: protein argonaute 4-like                211   9e-60   
ref|XP_008449865.1|  PREDICTED: protein argonaute 4                     211   1e-59   Cucumis melo [Oriental melon]
ref|XP_002527764.1|  eukaryotic translation initiation factor 2c,...    209   5e-59   Ricinus communis
ref|XP_002275928.1|  PREDICTED: protein argonaute 4                     207   2e-58   Vitis vinifera
gb|AGS47796.1|  argonaute 9                                             207   2e-58   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007016688.1|  Argonaute family protein isoform 1                 207   2e-58   
ref|XP_004241389.1|  PREDICTED: protein argonaute 4-like                206   6e-58   
ref|XP_010689361.1|  PREDICTED: protein argonaute 4                     206   9e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010093806.1|  hypothetical protein L484_022518                   193   1e-57   
ref|XP_006369389.1|  hypothetical protein POPTR_0001s22710g             205   1e-57   
ref|XP_006369390.1|  Argonaute 4 family protein                         205   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011006053.1|  PREDICTED: protein argonaute 4-like                203   5e-57   Populus euphratica
gb|KDP45657.1|  hypothetical protein JCGZ_17264                         203   5e-57   Jatropha curcas
emb|CDP09667.1|  unnamed protein product                                202   1e-56   Coffea canephora [robusta coffee]
gb|KCW87286.1|  hypothetical protein EUGRSUZ_B03780                     200   5e-56   Eucalyptus grandis [rose gum]
gb|KHG16394.1|  Protein argonaute 4 -like protein                       200   5e-56   Gossypium arboreum [tree cotton]
ref|XP_010045128.1|  PREDICTED: protein argonaute 4-like                200   6e-56   Eucalyptus grandis [rose gum]
ref|XP_010031652.1|  PREDICTED: protein argonaute 4-like                199   3e-55   Eucalyptus grandis [rose gum]
gb|KCW51008.1|  hypothetical protein EUGRSUZ_J00634                     198   5e-55   Eucalyptus grandis [rose gum]
gb|KJB26170.1|  hypothetical protein B456_004G228100                    198   5e-55   Gossypium raimondii
ref|XP_010653696.1|  PREDICTED: protein argonaute 4A-like               197   7e-55   Vitis vinifera
ref|XP_004491186.1|  PREDICTED: protein argonaute 4-like isoform X1     197   8e-55   Cicer arietinum [garbanzo]
ref|XP_007146204.1|  hypothetical protein PHAVU_006G021200g             196   4e-54   Phaseolus vulgaris [French bean]
gb|KHN37954.1|  Protein argonaute 4                                     195   8e-54   Glycine soja [wild soybean]
ref|XP_003555656.1|  PREDICTED: protein argonaute 4 isoform X1          194   8e-54   Glycine max [soybeans]
ref|XP_006605639.1|  PREDICTED: protein argonaute 4 isoform X2          194   1e-53   Glycine max [soybeans]
gb|ACZ04920.1|  argonaute 4-like protein                                194   1e-53   Pelargonium x hortorum [bedding geranium]
ref|XP_007207224.1|  hypothetical protein PRUPE_ppa000990mg             194   2e-53   Prunus persica
ref|XP_008231109.1|  PREDICTED: protein argonaute 4                     193   2e-53   Prunus mume [ume]
emb|CBI32885.3|  unnamed protein product                                192   4e-53   Vitis vinifera
ref|XP_006293644.1|  hypothetical protein CARUB_v10022599mg             192   5e-53   Capsella rubella
gb|KDO66364.1|  hypothetical protein CISIN_1g0024491mg                  191   5e-53   Citrus sinensis [apfelsine]
ref|XP_008363553.1|  PREDICTED: protein argonaute 4-like                192   5e-53   
ref|XP_009339636.1|  PREDICTED: protein argonaute 4-like                192   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_002323196.2|  hypothetical protein POPTR_0016s02480g             192   6e-53   Populus trichocarpa [western balsam poplar]
gb|KDO66363.1|  hypothetical protein CISIN_1g0024491mg                  191   6e-53   Citrus sinensis [apfelsine]
gb|KDO66362.1|  hypothetical protein CISIN_1g0024491mg                  191   7e-53   Citrus sinensis [apfelsine]
gb|KDO66360.1|  hypothetical protein CISIN_1g0024491mg                  191   9e-53   Citrus sinensis [apfelsine]
ref|XP_006470434.1|  PREDICTED: protein argonaute 4-like                191   1e-52   Citrus sinensis [apfelsine]
ref|XP_003617094.1|  Protein argonaute 4                                191   1e-52   
ref|XP_003617096.1|  Protein argonaute 4                                191   1e-52   
ref|XP_002308843.1|  hypothetical protein POPTR_0006s02680g             191   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006446389.1|  hypothetical protein CICLE_v10014186mg             191   2e-52   Citrus clementina [clementine]
ref|XP_003617095.1|  Protein argonaute 4                                191   2e-52   
gb|KHN38433.1|  Protein argonaute 4                                     190   2e-52   Glycine soja [wild soybean]
ref|XP_010521596.1|  PREDICTED: protein argonaute 4                     191   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_003519489.1|  PREDICTED: protein argonaute 4-like                190   4e-52   Glycine max [soybeans]
ref|XP_011041311.1|  PREDICTED: protein argonaute 4A-like               189   1e-51   Populus euphratica
ref|XP_002880875.1|  hypothetical protein ARALYDRAFT_481584             189   1e-51   
ref|XP_010520483.1|  PREDICTED: protein argonaute 4-like                189   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_003545462.1|  PREDICTED: protein argonaute 4-like                188   1e-51   Glycine max [soybeans]
gb|KEH35100.1|  eukaryotic translation initiation factor 2c, puta...    188   2e-51   Medicago truncatula
ref|NP_565633.1|  argonaute 4                                           188   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103572.1|  PREDICTED: protein argonaute 4-like                187   4e-51   Brassica rapa
ref|XP_010510823.1|  PREDICTED: protein argonaute 4                     187   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_011461779.1|  PREDICTED: protein argonaute 4-like                187   7e-51   Fragaria vesca subsp. vesca
emb|CDY56413.1|  BnaC04g54830D                                          186   9e-51   Brassica napus [oilseed rape]
ref|XP_006408675.1|  hypothetical protein EUTSA_v10001902mg             186   9e-51   Eutrema salsugineum [saltwater cress]
gb|KJB56072.1|  hypothetical protein B456_009G105600                    184   9e-51   Gossypium raimondii
ref|XP_011040669.1|  PREDICTED: protein argonaute 4A-like               186   1e-50   Populus euphratica
ref|XP_002527383.1|  eukaryotic translation initiation factor 2c,...    186   1e-50   Ricinus communis
gb|KJB56075.1|  hypothetical protein B456_009G105600                    184   2e-50   Gossypium raimondii
emb|CDY04475.1|  BnaA07g13010D                                          186   2e-50   
ref|XP_010417848.1|  PREDICTED: protein argonaute 4-like                185   2e-50   Camelina sativa [gold-of-pleasure]
gb|KJB56074.1|  hypothetical protein B456_009G105600                    184   3e-50   Gossypium raimondii
ref|XP_010473093.1|  PREDICTED: protein argonaute 4                     185   3e-50   Camelina sativa [gold-of-pleasure]
gb|KJB56071.1|  hypothetical protein B456_009G105600                    184   3e-50   Gossypium raimondii
gb|KJB56073.1|  hypothetical protein B456_009G105600                    184   3e-50   Gossypium raimondii
ref|XP_008385629.1|  PREDICTED: protein argonaute 4                     184   6e-50   
ref|XP_009345605.1|  PREDICTED: protein argonaute 4-like                184   7e-50   Pyrus x bretschneideri [bai li]
ref|XP_011091875.1|  PREDICTED: protein argonaute 4A-like               183   8e-50   Sesamum indicum [beniseed]
gb|KHG11406.1|  Protein argonaute 4 -like protein                       181   6e-49   Gossypium arboreum [tree cotton]
ref|XP_004501969.1|  PREDICTED: protein argonaute 4-like                181   6e-49   Cicer arietinum [garbanzo]
ref|NP_001266010.1|  uncharacterized protein LOC101248049               178   5e-48   Solanum lycopersicum
ref|XP_010323741.1|  PREDICTED: uncharacterized protein LOC101248...    178   6e-48   
ref|XP_006400685.1|  hypothetical protein EUTSA_v10012624mg             177   1e-47   Eutrema salsugineum [saltwater cress]
emb|CDY48192.1|  BnaA04g15560D                                          178   1e-47   Brassica napus [oilseed rape]
ref|XP_009140756.1|  PREDICTED: protein argonaute 4                     178   1e-47   Brassica rapa
ref|XP_006347690.1|  PREDICTED: protein argonaute 4-like                177   1e-47   Solanum tuberosum [potatoes]
ref|XP_010673246.1|  PREDICTED: protein argonaute 4-like                176   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007141565.1|  hypothetical protein PHAVU_008G206600g             176   5e-47   Phaseolus vulgaris [French bean]
ref|XP_007141564.1|  hypothetical protein PHAVU_008G206600g             176   6e-47   Phaseolus vulgaris [French bean]
gb|EYU42905.1|  hypothetical protein MIMGU_mgv1a001084mg                176   6e-47   Erythranthe guttata [common monkey flower]
ref|XP_009126507.1|  PREDICTED: protein argonaute 9-like                176   6e-47   Brassica rapa
emb|CDY09103.1|  BnaA02g05290D                                          175   8e-47   Brassica napus [oilseed rape]
emb|CDP19981.1|  unnamed protein product                                174   1e-46   Coffea canephora [robusta coffee]
ref|XP_009801790.1|  PREDICTED: protein argonaute 4A-like               174   2e-46   Nicotiana sylvestris
ref|XP_003592510.1|  Protein argonaute 4A                               173   4e-46   
gb|KEH26048.1|  eukaryotic translation initiation factor 2c, puta...    173   4e-46   Medicago truncatula
ref|XP_007141563.1|  hypothetical protein PHAVU_008G206500g             173   4e-46   Phaseolus vulgaris [French bean]
emb|CDX77061.1|  BnaC04g38560D                                          173   4e-46   
ref|XP_002310956.1|  hypothetical protein POPTR_0008s01100g             172   2e-45   
ref|XP_007220876.1|  hypothetical protein PRUPE_ppa017623mg             171   2e-45   Prunus persica
ref|XP_009120721.1|  PREDICTED: protein argonaute 9-like                171   2e-45   
ref|XP_011032992.1|  PREDICTED: protein argonaute 4A-like               171   4e-45   Populus euphratica
ref|XP_010493237.1|  PREDICTED: protein argonaute 9-like isoform X3     169   4e-45   
gb|AGS47795.1|  argonaute 8                                             170   5e-45   Salvia miltiorrhiza [Chinese salvia]
emb|CDX92405.1|  BnaA10g14440D                                          170   7e-45   
ref|XP_008231753.1|  PREDICTED: protein argonaute 4A-like               169   9e-45   Prunus mume [ume]
dbj|BAC42876.1|  putative zwille/pinhead                                162   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493236.1|  PREDICTED: protein argonaute 9-like isoform X2     169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010493235.1|  PREDICTED: protein argonaute 9-like isoform X1     169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008375403.1|  PREDICTED: protein argonaute 4A-like               168   2e-44   Malus domestica [apple tree]
ref|XP_008231754.1|  PREDICTED: protein argonaute 4A-like               167   6e-44   
ref|XP_009590319.1|  PREDICTED: protein argonaute 4A-like               167   7e-44   Nicotiana tomentosiformis
ref|XP_006471315.1|  PREDICTED: protein argonaute 4B-like               168   9e-44   
ref|XP_006432529.1|  hypothetical protein CICLE_v10003971mg             165   9e-44   
gb|KDO53795.1|  hypothetical protein CISIN_1g0026362mg                  164   2e-43   Citrus sinensis [apfelsine]
emb|CDY16595.1|  BnaC09g36780D                                          166   2e-43   Brassica napus [oilseed rape]
ref|XP_002871971.1|  PAZ domain-containing protein                      164   5e-43   
ref|XP_010420963.1|  PREDICTED: protein argonaute 9                     164   7e-43   Camelina sativa [gold-of-pleasure]
gb|AAO73892.1|  PAZ (Piwi Argonaut and Zwille) family                   163   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197613.2|  argonaute 9                                           163   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219668.1|  hypothetical protein PRUPE_ppa025242mg             163   2e-42   
emb|CAD66636.1|  ARGONAUTE9 protein                                     163   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287018.1|  hypothetical protein CARUB_v10000166mg             162   5e-42   
ref|XP_009416373.1|  PREDICTED: protein argonaute 4B-like               162   5e-42   
ref|XP_010251689.1|  PREDICTED: protein argonaute 4A                    161   8e-42   Nelumbo nucifera [Indian lotus]
gb|AET00057.2|  eukaryotic translation initiation factor 2c, puta...    160   1e-41   Medicago truncatula
gb|AIO05706.1|  putative argonaute 4                                    157   5e-41   Cocos nucifera
ref|XP_007016691.1|  Argonaute family protein isoform 4                 157   6e-41   
ref|XP_007016692.1|  Argonaute family protein isoform 5                 157   6e-41   
ref|XP_007016690.1|  Argonaute family protein isoform 3                 156   2e-40   
ref|XP_008805346.1|  PREDICTED: protein argonaute 4B-like isoform X2    153   4e-39   
emb|CDY59516.1|  BnaCnng35060D                                          153   5e-39   Brassica napus [oilseed rape]
ref|XP_008805343.1|  PREDICTED: protein argonaute 4B-like isoform X1    153   6e-39   Phoenix dactylifera
ref|XP_010943265.1|  PREDICTED: protein argonaute 4B-like               153   6e-39   Elaeis guineensis
gb|EAZ11412.1|  hypothetical protein OsJ_01273                          143   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308183.1|  PREDICTED: protein argonaute 4A-like               152   2e-38   Fragaria vesca subsp. vesca
ref|XP_002264978.1|  PREDICTED: protein argonaute 4A-like               151   2e-38   
sp|Q6YSJ5.2|AGO16_ORYSJ  RecName: Full=Protein argonaute 16; Shor...    151   3e-38   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC84805.1|  putative ARGONAUTE9 protein                            150   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008778689.1|  PREDICTED: protein argonaute 4B-like               150   5e-38   Phoenix dactylifera
ref|XP_009120723.1|  PREDICTED: protein argonaute 9-like                150   6e-38   Brassica rapa
emb|CDX92406.1|  BnaA10g14450D                                          150   6e-38   
ref|NP_001052115.1|  Os04g0151800                                       150   7e-38   
emb|CAH65970.1|  H0820C10.3                                             150   7e-38   Oryza sativa [red rice]
ref|XP_010943243.1|  PREDICTED: protein argonaute 16-like               148   3e-37   Elaeis guineensis
ref|XP_002874028.1|  PAZ domain-containing protein                      148   3e-37   
emb|CBI40895.3|  unnamed protein product                                148   3e-37   Vitis vinifera
ref|XP_008347021.1|  PREDICTED: protein argonaute 4B-like               142   4e-37   
ref|XP_010694897.1|  PREDICTED: protein argonaute 4A-like               148   4e-37   
ref|XP_010497367.1|  PREDICTED: protein argonaute 8-like                140   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008803511.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...    147   1e-36   
emb|CDY16587.1|  BnaC09g36860D                                          146   2e-36   Brassica napus [oilseed rape]
ref|XP_006652094.1|  PREDICTED: protein argonaute 4B-like               145   3e-36   Oryza brachyantha
emb|CAN61334.1|  hypothetical protein VITISV_044457                     145   4e-36   Vitis vinifera
ref|XP_003617098.1|  Protein argonaute 4A                               144   6e-36   
ref|NP_001169445.1|  argonaute104                                       142   6e-36   
gb|AFW79428.1|  argonaute104                                            142   1e-35   
gb|EEC70394.1|  hypothetical protein OsI_01365                          142   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_008375508.1|  PREDICTED: protein argonaute 4A-like               143   4e-35   
ref|XP_008648109.1|  PREDICTED: argonaute104 isoform X5                 142   4e-35   
ref|XP_008648106.1|  PREDICTED: argonaute104 isoform X2                 142   4e-35   Zea mays [maize]
ref|XP_008648107.1|  PREDICTED: argonaute104 isoform X3                 142   4e-35   
ref|XP_003598353.1|  Protein argonaute 4A                               142   4e-35   Medicago truncatula
ref|XP_008648104.1|  PREDICTED: argonaute104 isoform X1                 142   5e-35   
ref|XP_008648108.1|  PREDICTED: argonaute104 isoform X4                 142   5e-35   
ref|XP_010252577.1|  PREDICTED: protein argonaute 16 isoform X2         142   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010252575.1|  PREDICTED: protein argonaute 16 isoform X1         142   5e-35   Nelumbo nucifera [Indian lotus]
dbj|BAD81109.1|  zwille protein -like                                   142   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644052.1|  PREDICTED: protein argonaute 4A-like               142   6e-35   Oryza brachyantha
tpg|DAA54155.1|  TPA: hypothetical protein ZEAMMB73_367489              132   8e-35   
ref|XP_004298218.1|  PREDICTED: protein argonaute 4A-like               141   8e-35   Fragaria vesca subsp. vesca
sp|Q5NBN9.2|AGO15_ORYSJ  RecName: Full=Protein argonaute 15; Shor...    141   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960964.1|  PREDICTED: protein argonaute 4B-like isoform X2    141   1e-34   
ref|XP_004960963.1|  PREDICTED: protein argonaute 4B-like isoform X1    140   1e-34   Setaria italica
ref|NP_001042722.1|  Os01g0275600                                       140   2e-34   
ref|XP_003576965.2|  PREDICTED: protein argonaute 16                    140   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_010657243.1|  PREDICTED: protein argonaute 16                    139   4e-34   Vitis vinifera
ref|XP_006289242.1|  hypothetical protein CARUB_v10002706mg             139   5e-34   
ref|NP_001167850.1|  putative argonaute family protein                  138   9e-34   Zea mays [maize]
gb|EEE66926.1|  hypothetical protein OsJ_23783                          138   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81834.1|  hypothetical protein OsI_25587                          138   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_010230772.1|  PREDICTED: protein argonaute 4A                    138   1e-33   Brachypodium distachyon [annual false brome]
gb|AGB34311.1|  Argonaute                                               137   2e-33   Triticum aestivum [Canadian hard winter wheat]
gb|EMS68540.1|  Protein argonaute 4A                                    137   2e-33   Triticum urartu
ref|XP_004967701.1|  PREDICTED: protein argonaute 4A-like               137   2e-33   Setaria italica
gb|KDO59554.1|  hypothetical protein CISIN_1g002661mg                   137   2e-33   Citrus sinensis [apfelsine]
ref|XP_004956340.1|  PREDICTED: protein argonaute 16-like isoform X1    137   2e-33   Setaria italica
gb|AGO99010.1|  argonaute 4                                             137   3e-33   Triticum aestivum [Canadian hard winter wheat]
gb|KDO59555.1|  hypothetical protein CISIN_1g002661mg                   137   3e-33   Citrus sinensis [apfelsine]
ref|XP_004156089.1|  PREDICTED: protein argonaute 16-like               137   3e-33   
ref|XP_004140126.1|  PREDICTED: protein argonaute 16-like               137   4e-33   Cucumis sativus [cucumbers]
emb|CBI28870.3|  unnamed protein product                                136   4e-33   Vitis vinifera
ref|XP_008449486.1|  PREDICTED: protein argonaute 16                    136   5e-33   Cucumis melo [Oriental melon]
ref|NP_197602.2|  protein argonaute 8                                   136   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440386.1|  hypothetical protein SORBIDRAFT_09g030910          135   1e-32   Sorghum bicolor [broomcorn]
ref|XP_006447661.1|  hypothetical protein CICLE_v10014201mg             135   2e-32   
ref|XP_006447660.1|  hypothetical protein CICLE_v10014201mg             135   2e-32   
ref|XP_006447659.1|  hypothetical protein CICLE_v10014201mg             134   2e-32   
ref|XP_008379693.1|  PREDICTED: protein argonaute 16                    134   3e-32   
ref|XP_002320489.2|  PAZ domain-containing family protein               134   4e-32   
ref|XP_006661042.1|  PREDICTED: protein argonaute 16-like               133   5e-32   
gb|KDP30816.1|  hypothetical protein JCGZ_13759                         133   7e-32   Jatropha curcas
ref|XP_010035502.1|  PREDICTED: protein argonaute 16-like               132   1e-31   Eucalyptus grandis [rose gum]
ref|XP_009418523.1|  PREDICTED: protein argonaute 16-like               132   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009365125.1|  PREDICTED: protein argonaute 16 isoform X1         130   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_009365127.1|  PREDICTED: protein argonaute 16 isoform X2         130   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_008651670.1|  PREDICTED: uncharacterized protein LOC100382...    130   5e-31   Zea mays [maize]
ref|XP_008651669.1|  PREDICTED: uncharacterized protein LOC100382...    130   5e-31   Zea mays [maize]
ref|XP_009365128.1|  PREDICTED: protein argonaute 16 isoform X3         130   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_007049194.1|  Eukaryotic translation initiation factor 2c,...    130   5e-31   
ref|XP_007049195.1|  Eukaryotic translation initiation factor 2c,...    130   6e-31   
ref|XP_008651671.1|  PREDICTED: uncharacterized protein LOC100382...    130   6e-31   Zea mays [maize]
tpg|DAA60814.1|  TPA: putative argonaute family protein                 129   7e-31   
gb|EMS52455.1|  Protein argonaute 4B                                    129   1e-30   Triticum urartu
ref|XP_011007758.1|  PREDICTED: protein argonaute 16                    129   2e-30   Populus euphratica
ref|XP_011100483.1|  PREDICTED: protein argonaute 16 isoform X2         128   3e-30   
ref|XP_004304078.2|  PREDICTED: protein argonaute 16-like               128   3e-30   Fragaria vesca subsp. vesca
gb|AHC30882.1|  argonaute 6 protein                                     127   5e-30   Dimocarpus longan [longan]
gb|EYU42875.1|  hypothetical protein MIMGU_mgv1a001065mg                127   8e-30   Erythranthe guttata [common monkey flower]
gb|KJB10321.1|  hypothetical protein B456_001G195700                    125   2e-29   Gossypium raimondii
gb|KJB10319.1|  hypothetical protein B456_001G195700                    125   2e-29   Gossypium raimondii
ref|XP_003526363.1|  PREDICTED: protein argonaute 4B-like               125   2e-29   
gb|KJB10320.1|  hypothetical protein B456_001G195700                    125   3e-29   Gossypium raimondii
gb|AGO99012.1|  argonaute 4                                             125   3e-29   Triticum aestivum [Canadian hard winter wheat]
gb|KCW46921.1|  hypothetical protein EUGRSUZ_K00736                     125   4e-29   Eucalyptus grandis [rose gum]
ref|XP_010035500.1|  PREDICTED: protein argonaute 16-like               125   4e-29   
gb|EMT11809.1|  Protein argonaute 4B                                    125   4e-29   
gb|EMT20780.1|  Protein argonaute 4A                                    125   7e-29   
gb|EEC70395.1|  hypothetical protein OsI_01366                          124   8e-29   Oryza sativa Indica Group [Indian rice]
emb|CDP05690.1|  unnamed protein product                                124   1e-28   Coffea canephora [robusta coffee]
gb|EAZ11413.1|  hypothetical protein OsJ_01274                          124   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217062.1|  hypothetical protein PRUPE_ppa001137mg             124   1e-28   Prunus persica
ref|XP_008229810.1|  PREDICTED: protein argonaute 16                    124   1e-28   Prunus mume [ume]
ref|XP_011100478.1|  PREDICTED: protein argonaute 16 isoform X1         123   2e-28   Sesamum indicum [beniseed]
gb|KHG12030.1|  hypothetical protein F383_20383                         122   3e-28   Gossypium arboreum [tree cotton]
ref|XP_010110219.1|  Protein argonaute 16                               122   4e-28   Morus notabilis
gb|EMS52406.1|  Protein argonaute 4B                                    122   4e-28   Triticum urartu
ref|XP_002534129.1|  eukaryotic translation initiation factor 2c,...    122   4e-28   
ref|NP_001266273.1|  uncharacterized protein LOC101264839               122   5e-28   Solanum lycopersicum
ref|XP_004296439.1|  PREDICTED: protein argonaute 16-like isoform X2    122   5e-28   Fragaria vesca subsp. vesca
ref|XP_006594374.1|  PREDICTED: protein argonaute 16-like isoform X5    121   7e-28   Glycine max [soybeans]
ref|XP_006594371.1|  PREDICTED: protein argonaute 16-like isoform X2    121   7e-28   Glycine max [soybeans]
ref|XP_006400673.1|  hypothetical protein EUTSA_v10015501mg             121   7e-28   
gb|KHN37722.1|  Protein argonaute 16                                    121   8e-28   Glycine soja [wild soybean]
ref|XP_006594372.1|  PREDICTED: protein argonaute 16-like isoform X3    121   8e-28   Glycine max [soybeans]
ref|XP_006594373.1|  PREDICTED: protein argonaute 16-like isoform X4    121   8e-28   Glycine max [soybeans]
ref|XP_004968863.1|  PREDICTED: protein argonaute 16-like               121   1e-27   
ref|XP_004296440.2|  PREDICTED: protein argonaute 16-like               121   1e-27   Fragaria vesca subsp. vesca
ref|XP_006357979.1|  PREDICTED: protein argonaute 16-like               120   2e-27   Solanum tuberosum [potatoes]
gb|KHN26437.1|  Protein argonaute 4A                                    120   2e-27   Glycine soja [wild soybean]
ref|XP_009769203.1|  PREDICTED: protein argonaute 16                    120   2e-27   Nicotiana sylvestris
ref|XP_003541581.2|  PREDICTED: protein argonaute 16-like isoform X1    119   3e-27   Glycine max [soybeans]
ref|XP_011462334.1|  PREDICTED: protein argonaute 16-like isoform X1    119   4e-27   Fragaria vesca subsp. vesca
ref|XP_003567769.1|  PREDICTED: protein argonaute 4B-like               119   4e-27   Brachypodium distachyon [annual false brome]
ref|XP_007133316.1|  hypothetical protein PHAVU_011G169400g             117   1e-26   Phaseolus vulgaris [French bean]
ref|XP_009630855.1|  PREDICTED: protein argonaute 16                    115   8e-26   Nicotiana tomentosiformis
emb|CDP15091.1|  unnamed protein product                                112   1e-25   Coffea canephora [robusta coffee]
gb|EMT09812.1|  Protein argonaute 16                                    114   3e-25   
ref|XP_010556972.1|  PREDICTED: protein argonaute 6                     113   6e-25   Tarenaya hassleriana [spider flower]
gb|AGS47793.1|  argonaute 6                                             111   2e-24   Salvia miltiorrhiza [Chinese salvia]
emb|CDX79495.1|  BnaC03g18310D                                          111   2e-24   
emb|CDX84712.1|  BnaA03g15180D                                          110   4e-24   
ref|XP_009132895.1|  PREDICTED: protein argonaute 6                     110   4e-24   Brassica rapa
gb|AES71838.2|  eukaryotic translation initiation factor 2c, puta...    109   1e-23   Medicago truncatula
ref|XP_002881254.1|  PAZ domain-containing protein                      109   1e-23   Arabidopsis lyrata subsp. lyrata
gb|EYU22224.1|  hypothetical protein MIMGU_mgv1a001217mg                109   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_010509947.1|  PREDICTED: protein argonaute 6-like                109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006410431.1|  hypothetical protein EUTSA_v10016224mg             107   8e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010469531.1|  PREDICTED: protein argonaute 6-like                106   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010413926.1|  PREDICTED: protein argonaute 6                     105   2e-22   Camelina sativa [gold-of-pleasure]
gb|AAB91987.1|  Argonaute (AGO1)-like protein                           105   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180853.2|  argonaute 6                                           105   3e-22   
ref|XP_006293657.1|  hypothetical protein CARUB_v10022614mg             103   2e-21   
ref|XP_004956341.1|  PREDICTED: protein argonaute 16-like isoform X2    102   2e-21   
ref|XP_002457641.1|  hypothetical protein SORBIDRAFT_03g010990          100   2e-21   
ref|XP_009594593.1|  PREDICTED: protein argonaute 4B-like             99.4    3e-20   
ref|XP_009419463.1|  PREDICTED: protein argonaute 16-like             99.4    3e-20   
gb|KHM99307.1|  Protein argonaute 4                                   91.3    6e-20   
ref|XP_009763100.1|  PREDICTED: protein argonaute 4B-like isoform X2  98.2    9e-20   
ref|XP_009763095.1|  PREDICTED: protein argonaute 4B-like isoform X1  98.2    1e-19   
ref|XP_010688916.1|  PREDICTED: protein argonaute 16 isoform X1       95.9    5e-19   
gb|EPS71209.1|  hypothetical protein M569_03550                       92.8    1e-18   
ref|XP_010688917.1|  PREDICTED: protein argonaute 16 isoform X2       94.7    1e-18   
gb|AJA90771.1|  Argonaute 4                                           93.6    4e-18   
gb|EMT25923.1|  Protein argonaute 4B                                  93.2    4e-18   
ref|XP_003601587.1|  Protein argonaute                                90.1    5e-17   
emb|CDX78332.1|  BnaA03g02440D                                        87.0    3e-16   
ref|XP_006351552.1|  PREDICTED: protein argonaute 4B-like             85.9    1e-15   
ref|XP_004236549.1|  PREDICTED: protein argonaute 4A-like             85.5    1e-15   
gb|AJA90779.1|  Argonaute 4                                           80.5    7e-14   
gb|AJA90755.1|  Argonaute 4                                           76.3    2e-12   
gb|AJA90764.1|  Argonaute 4                                           75.5    3e-12   
gb|AAY67884.1|  argonaute/Zwille-like protein                         75.1    5e-12   
gb|KDO44722.1|  hypothetical protein CISIN_1g0356952mg                68.9    7e-11   
ref|XP_010435959.1|  PREDICTED: protein argonaute 5-like              71.2    8e-11   
gb|EEC76346.1|  hypothetical protein OsI_13926                        70.1    2e-10   
sp|Q851R2.1|MEL1_ORYSJ  RecName: Full=Protein argonaute MEL1; Alt...  70.1    2e-10   
gb|EAZ28935.1|  hypothetical protein OsJ_12979                        69.7    3e-10   
ref|XP_010417939.1|  PREDICTED: protein argonaute 5-like              69.3    3e-10   
ref|XP_006424394.1|  hypothetical protein CICLE_v10027760mg           68.9    4e-10   
dbj|BAK05938.1|  predicted protein                                    68.9    4e-10   
gb|KDP43930.1|  hypothetical protein JCGZ_05397                       68.6    5e-10   
ref|XP_002323195.1|  hypothetical protein POPTR_0016s02470g           63.5    5e-10   
ref|XP_010473185.1|  PREDICTED: protein argonaute 5-like              68.6    5e-10   
ref|XP_006424393.1|  hypothetical protein CICLE_v10027755mg           68.6    6e-10   
ref|XP_010510717.1|  PREDICTED: protein argonaute 5-like              68.6    6e-10   
ref|XP_002880962.1|  hypothetical protein ARALYDRAFT_481718           67.8    9e-10   
gb|AAD21514.1|  Argonaute (AGO1)-like protein                         67.8    1e-09   
ref|NP_850110.1|  argonaute 5                                         67.4    1e-09   
ref|XP_010521702.1|  PREDICTED: protein argonaute 5                   67.0    1e-09   
ref|XP_011010386.1|  PREDICTED: protein argonaute 5-like              66.6    2e-09   
ref|XP_004173728.1|  PREDICTED: protein argonaute 5-like              65.9    2e-09   
ref|XP_010490899.1|  PREDICTED: protein argonaute 5-like              66.2    3e-09   
ref|XP_006592296.1|  PREDICTED: protein argonaute 5-like              66.2    3e-09   
ref|XP_002314317.1|  argonaute family protein                         66.2    3e-09   
gb|EYU37000.1|  hypothetical protein MIMGU_mgv1a000822mg              66.2    3e-09   
ref|XP_006485142.1|  PREDICTED: protein argonaute 5-like              65.9    4e-09   
ref|XP_010689967.1|  PREDICTED: protein argonaute 5                   65.9    4e-09   
emb|CDY04517.1|  BnaA07g13430D                                        65.9    4e-09   
ref|XP_009103628.1|  PREDICTED: protein argonaute 5                   65.9    4e-09   
gb|KHN38687.1|  Protein argonaute 5                                   65.9    4e-09   
ref|XP_010100146.1|  Protein argonaute 5                              65.5    5e-09   
ref|XP_006409803.1|  hypothetical protein EUTSA_v10016181mg           65.5    6e-09   
gb|EYU42876.1|  hypothetical protein MIMGU_mgv1a001669mg              65.1    6e-09   
ref|XP_004167325.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...  65.1    6e-09   
ref|XP_010045278.1|  PREDICTED: protein argonaute 5-like              65.1    7e-09   
ref|XP_006296291.1|  hypothetical protein CARUB_v10025461mg           65.1    7e-09   
ref|XP_002298162.2|  argonaute family protein                         65.1    7e-09   
gb|EEC81647.1|  hypothetical protein OsI_25183                        65.1    8e-09   
ref|NP_001059079.1|  Os07g0188000                                     65.1    8e-09   
gb|EYU40234.1|  hypothetical protein MIMGU_mgv1a022215mg              64.7    8e-09   
ref|XP_008360082.1|  PREDICTED: protein argonaute 5-like              64.7    8e-09   
ref|XP_004139565.1|  PREDICTED: protein argonaute 5-like              64.7    8e-09   
ref|XP_001769106.1|  argonaute family member                          64.7    8e-09   
emb|CDX71410.1|  BnaC04g16450D                                        64.7    1e-08   
ref|XP_011037293.1|  PREDICTED: protein argonaute 5-like              64.7    1e-08   
ref|XP_008462248.1|  PREDICTED: protein argonaute 5                   64.3    1e-08   
ref|XP_006485143.1|  PREDICTED: protein argonaute 5-like              64.3    1e-08   
ref|XP_006485141.1|  PREDICTED: protein argonaute MEL1-like           63.9    1e-08   
dbj|BAO49750.1|  argonaute protein                                    63.9    2e-08   
gb|KDO37148.1|  hypothetical protein CISIN_1g026337mg                 62.0    2e-08   
ref|XP_010651834.1|  PREDICTED: protein argonaute 5                   63.5    2e-08   
gb|KFK44936.1|  hypothetical protein AALP_AA1G322100                  63.5    2e-08   
gb|AAF79718.1|AC020889_26  T1N15.2                                    63.5    2e-08   
gb|KJB35165.1|  hypothetical protein B456_006G103000                  63.2    2e-08   
gb|KJB35169.1|  hypothetical protein B456_006G103000                  63.2    3e-08   
gb|KJB35163.1|  hypothetical protein B456_006G103000                  63.2    3e-08   
ref|XP_008670390.1|  PREDICTED: protein argonaute 18-like isoform X2  63.2    3e-08   
gb|KJB35183.1|  hypothetical protein B456_006G103100                  63.2    3e-08   
gb|KJB35164.1|  hypothetical protein B456_006G103000                  63.2    3e-08   
ref|XP_010229446.1|  PREDICTED: protein argonaute MEL1-like           63.2    3e-08   
ref|XP_008670386.1|  PREDICTED: protein argonaute 18-like isoform X1  63.2    3e-08   
gb|KJB35161.1|  hypothetical protein B456_006G103000                  63.2    3e-08   
ref|XP_004957665.1|  PREDICTED: protein argonaute 18-like             62.8    3e-08   
ref|XP_001784983.1|  argonaute family member                          62.8    3e-08   
gb|KJB35162.1|  hypothetical protein B456_006G103000                  62.8    4e-08   
gb|KJB35168.1|  hypothetical protein B456_006G103000                  62.8    4e-08   
ref|XP_004294050.1|  PREDICTED: protein argonaute 5                   62.8    4e-08   
gb|KJB35167.1|  hypothetical protein B456_006G103000                  62.8    4e-08   
ref|XP_002461596.1|  hypothetical protein SORBIDRAFT_02g005150        62.8    4e-08   
ref|XP_008226878.1|  PREDICTED: protein argonaute 5                   62.4    5e-08   
tpg|DAA42502.1|  TPA: putative argonaute family protein               62.4    5e-08   
ref|XP_003561331.2|  PREDICTED: protein argonaute 14-like             62.4    5e-08   
ref|NP_175274.1|  protein argonaute 1                                 62.4    5e-08   
ref|NP_849784.1|  protein argonaute 1                                 62.4    5e-08   
ref|NP_001146206.1|  uncharacterized protein LOC100279776             62.4    5e-08   
dbj|BAE99844.1|  hypothetical protein                                 61.6    6e-08   
ref|XP_007206711.1|  hypothetical protein PRUPE_ppa024131mg           62.4    6e-08   
ref|XP_008385476.1|  PREDICTED: protein argonaute 5-like isoform X1   62.0    6e-08   
ref|XP_009608773.1|  PREDICTED: protein argonaute 5                   62.0    6e-08   
ref|XP_009356968.1|  PREDICTED: protein argonaute 5 isoform X3        62.0    7e-08   
ref|XP_006424392.1|  hypothetical protein CICLE_v10027752mg           61.6    9e-08   
ref|XP_001755804.1|  argonaute family member                          61.2    1e-07   
ref|XP_006424395.1|  hypothetical protein CICLE_v10027750mg           61.2    1e-07   
gb|AIN75619.1|  argonaute 5                                           61.2    1e-07   
ref|XP_009787109.1|  PREDICTED: protein argonaute 5                   61.2    1e-07   
ref|XP_009356967.1|  PREDICTED: protein argonaute 5 isoform X2        61.2    1e-07   
ref|XP_009356966.1|  PREDICTED: protein argonaute 5 isoform X1        61.2    1e-07   
ref|XP_002460677.1|  hypothetical protein SORBIDRAFT_02g032980        61.2    1e-07   
ref|XP_008377246.1|  PREDICTED: protein argonaute 5-like isoform X2   60.8    1e-07   
ref|XP_002972915.1|  hypothetical protein SELMODRAFT_98227            60.8    1e-07   
ref|XP_008377247.1|  PREDICTED: protein argonaute 5-like isoform X3   60.8    1e-07   
ref|XP_008377245.1|  PREDICTED: protein argonaute 5-like isoform X1   60.8    1e-07   
ref|XP_010494093.1|  PREDICTED: protein argonaute 6-like              56.6    1e-07   
ref|XP_007016005.1|  Argonaute protein group                          60.5    2e-07   
gb|AFW67327.1|  putative argonaute superfamily protein                60.5    2e-07   
ref|XP_010247717.1|  PREDICTED: protein argonaute 5-like isoform X2   60.1    3e-07   
ref|XP_008644431.1|  PREDICTED: protein argonaute MEL1-like           60.1    3e-07   
ref|XP_004506082.1|  PREDICTED: protein argonaute 5-like isoform X1   60.1    3e-07   
ref|XP_004506083.1|  PREDICTED: protein argonaute 5-like isoform X2   60.1    3e-07   
ref|XP_010247716.1|  PREDICTED: protein argonaute 1-like isoform X1   60.1    3e-07   
ref|XP_010247718.1|  PREDICTED: protein argonaute 5-like isoform X3   60.1    3e-07   
emb|CDX98740.1|  BnaA03g45250D                                        58.5    4e-07   
emb|CDX78331.1|  BnaA03g02430D                                        56.6    5e-07   
emb|CDP07006.1|  unnamed protein product                              59.3    6e-07   
ref|XP_001774237.1|  argonaute family member                          58.9    6e-07   
gb|KDO40404.1|  hypothetical protein CISIN_1g0053181mg                58.5    6e-07   
ref|XP_010045274.1|  PREDICTED: protein argonaute 5                   58.9    6e-07   
gb|KCW87437.1|  hypothetical protein EUGRSUZ_B03907                   58.9    6e-07   
ref|XP_002523757.1|  eukaryotic translation initiation factor 2c,...  58.9    7e-07   
gb|KEH29936.1|  eukaryotic translation initiation factor 2c           58.5    9e-07   
ref|XP_006347212.1|  PREDICTED: protein argonaute MEL1-like           58.2    1e-06   
ref|XP_010479262.1|  PREDICTED: protein argonaute 1 isoform X2        58.2    1e-06   
ref|XP_010069497.1|  PREDICTED: protein argonaute 1-like              58.2    1e-06   
ref|XP_010500364.1|  PREDICTED: protein argonaute 1-like isoform X2   58.2    1e-06   
ref|XP_010500363.1|  PREDICTED: protein argonaute 1-like isoform X1   57.8    1e-06   
ref|XP_010479261.1|  PREDICTED: protein argonaute 1 isoform X1        57.8    1e-06   
gb|KDO57345.1|  hypothetical protein CISIN_1g0361692mg                57.8    1e-06   
ref|XP_006484939.1|  PREDICTED: protein argonaute 5-like              57.8    2e-06   
ref|XP_004299479.1|  PREDICTED: protein argonaute 1-like              57.8    2e-06   
ref|XP_002988014.1|  hypothetical protein SELMODRAFT_235430           57.8    2e-06   
gb|KEH29935.1|  eukaryotic translation initiation factor 2c           57.8    2e-06   
ref|XP_006374268.1|  hypothetical protein POPTR_0015s05550g           57.4    2e-06   
emb|CDJ26672.1|  unnamed protein product                              57.4    2e-06   
gb|KHN23595.1|  Protein argonaute 1                                   57.4    2e-06   
ref|XP_010243012.1|  PREDICTED: protein argonaute MEL1-like           57.0    2e-06   
gb|EMS61534.1|  Protein argonaute 18                                  57.0    2e-06   
gb|KDO42526.1|  hypothetical protein CISIN_1g002204mg                 57.0    3e-06   
ref|XP_006424391.1|  hypothetical protein CICLE_v10027763mg           57.0    3e-06   
gb|KDP45800.1|  hypothetical protein JCGZ_17407                       57.0    3e-06   
ref|XP_003573171.1|  PREDICTED: protein argonaute 1C-like             57.0    3e-06   
ref|XP_003534084.1|  PREDICTED: protein argonaute 1                   56.6    4e-06   
ref|XP_004508549.1|  PREDICTED: protein argonaute PNH1-like isofo...  56.6    4e-06   
gb|AGS47788.1|  argonaute 1                                           56.2    5e-06   
ref|XP_007047833.1|  Argonaute protein group, putative                56.2    5e-06   
ref|XP_011072044.1|  PREDICTED: protein argonaute 1                   56.2    5e-06   
ref|XP_011047764.1|  PREDICTED: protein argonaute 1-like              56.2    5e-06   
ref|XP_008804398.1|  PREDICTED: protein argonaute 1B-like             56.2    5e-06   
ref|XP_010935362.1|  PREDICTED: protein argonaute 1B-like             56.2    5e-06   
gb|KHN24531.1|  Protein argonaute 1                                   56.2    5e-06   
ref|XP_010918322.1|  PREDICTED: protein argonaute 1A-like isoform X2  56.2    6e-06   
ref|XP_006306643.1|  hypothetical protein CARUB_v10008158mg           56.2    6e-06   
ref|XP_010914964.1|  PREDICTED: protein argonaute PNH1-like           56.2    6e-06   
ref|XP_010238589.1|  PREDICTED: protein argonaute 18-like             55.8    6e-06   
ref|NP_001265878.1|  uncharacterized protein LOC101244672             55.8    6e-06   
ref|XP_007047836.1|  Argonaute protein group, putative                55.8    6e-06   
gb|KEH26854.1|  argonaute protein 1A                                  55.8    6e-06   
gb|KEH26855.1|  argonaute protein 1A                                  55.8    6e-06   
gb|KJB37095.1|  hypothetical protein B456_006G189400                  55.8    6e-06   
ref|XP_009392848.1|  PREDICTED: protein argonaute 1B-like isoform X1  55.8    6e-06   
ref|XP_003595718.1|  Argonaute protein group                          55.5    7e-06   
ref|XP_009392849.1|  PREDICTED: protein argonaute 1B-like isoform X2  55.8    7e-06   
ref|XP_008792132.1|  PREDICTED: LOW QUALITY PROTEIN: protein argo...  55.8    7e-06   
ref|XP_009386428.1|  PREDICTED: protein argonaute 1B isoform X1       55.8    7e-06   
gb|EEE60897.1|  hypothetical protein OsJ_14581                        55.8    7e-06   
gb|AIO05704.1|  putative argonaute 1                                  55.8    7e-06   
ref|XP_010940264.1|  PREDICTED: protein argonaute 1A-like isoform X2  55.8    7e-06   
gb|ABF98226.1|  Argonaute-like protein At2g27880, putative, expre...  55.8    7e-06   
ref|XP_010229510.1|  PREDICTED: protein argonaute 12-like             55.8    7e-06   
ref|XP_010918321.1|  PREDICTED: protein argonaute 1A-like isoform X1  55.8    8e-06   
ref|NP_001050911.2|  Os03g0682600                                     55.5    8e-06   
gb|AFW67975.1|  putative argonaute superfamily protein                55.5    8e-06   
ref|XP_002440411.1|  hypothetical protein SORBIDRAFT_09g000530        55.5    9e-06   
ref|XP_002894111.1|  hypothetical protein ARALYDRAFT_473977           55.5    9e-06   
sp|Q10F39.2|AGO11_ORYSJ  RecName: Full=Protein argonaute 11; Shor...  55.5    9e-06   
gb|KEH38041.1|  eukaryotic translation initiation factor 2c           55.1    1e-05   
ref|XP_009409326.1|  PREDICTED: protein argonaute PNH1-like           55.5    1e-05   
gb|KHG08402.1|  Protein argonaute 1B                                  55.5    1e-05   
ref|XP_009355958.1|  PREDICTED: protein argonaute 1-like              55.5    1e-05   
ref|XP_003548311.1|  PREDICTED: protein argonaute 1-like              55.5    1e-05   
ref|XP_009386429.1|  PREDICTED: protein argonaute 1B isoform X2       55.5    1e-05   
ref|XP_008812792.1|  PREDICTED: protein argonaute 1B-like             55.5    1e-05   
ref|XP_008393490.1|  PREDICTED: protein argonaute 1                   55.5    1e-05   
ref|XP_010940261.1|  PREDICTED: protein argonaute 1B-like isoform X1  55.1    1e-05   
ref|XP_011465698.1|  PREDICTED: protein argonaute 1                   55.1    1e-05   
ref|XP_002454847.1|  hypothetical protein SORBIDRAFT_04g038420        55.1    1e-05   
ref|XP_008346888.1|  PREDICTED: protein argonaute 1-like              55.1    1e-05   
ref|XP_007132360.1|  hypothetical protein PHAVU_011G088200g           55.1    1e-05   
ref|XP_010270729.1|  PREDICTED: protein argonaute 1-like isoform X1   55.1    1e-05   
ref|XP_010270731.1|  PREDICTED: protein argonaute 1-like isoform X2   55.1    1e-05   
ref|XP_007210409.1|  hypothetical protein PRUPE_ppa000619mg           55.1    1e-05   
ref|XP_002318338.1|  hypothetical protein POPTR_0012s03410g           55.1    1e-05   
ref|XP_011003695.1|  PREDICTED: protein argonaute 1-like              55.1    1e-05   
gb|AES65969.2|  eukaryotic translation initiation factor 2c           54.7    1e-05   
ref|XP_004981405.1|  PREDICTED: protein argonaute MEL1-like           54.7    1e-05   
gb|KJB53119.1|  hypothetical protein B456_008G294100                  54.7    2e-05   
gb|KJB53121.1|  hypothetical protein B456_008G294100                  54.7    2e-05   
gb|KJB53116.1|  hypothetical protein B456_008G294100                  54.7    2e-05   
gb|KJB53120.1|  hypothetical protein B456_008G294100                  54.7    2e-05   
gb|KJB53118.1|  hypothetical protein B456_008G294100                  54.7    2e-05   
ref|XP_010925274.1|  PREDICTED: protein argonaute PNH1-like isofo...  54.7    2e-05   
ref|XP_008644147.1|  PREDICTED: uncharacterized protein LOC100384...  54.7    2e-05   
ref|XP_007210410.1|  hypothetical protein PRUPE_ppa000619mg           54.7    2e-05   
ref|XP_008644146.1|  PREDICTED: uncharacterized protein LOC100384...  54.7    2e-05   
ref|XP_008240369.1|  PREDICTED: protein argonaute 1-like              54.7    2e-05   
emb|CDO98607.1|  unnamed protein product                              54.7    2e-05   
ref|XP_003528280.1|  PREDICTED: protein argonaute PNH1-like isofo...  54.7    2e-05   
ref|XP_010461659.1|  PREDICTED: protein argonaute 1-like isoform X2   54.7    2e-05   
gb|KHN27615.1|  Protein argonaute PNH1                                54.7    2e-05   
ref|XP_010461658.1|  PREDICTED: protein argonaute 1-like isoform X1   54.7    2e-05   
ref|XP_010925275.1|  PREDICTED: protein argonaute PNH1-like isofo...  54.3    2e-05   
gb|AFW82929.1|  hypothetical protein ZEAMMB73_610629                  54.3    2e-05   



>ref|XP_009622314.1| PREDICTED: protein argonaute 4-like [Nicotiana tomentosiformis]
Length=905

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 144/164 (88%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeae-ptkkkapRLPMARRGFGSKGQKIPILTN  318
            MAEED NGAAE LPPPPPVP DFTP+K+E E   KK A RLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPAKSELEPVKKKAALRLPMARRGLGNKGQKIQILTN  60

Query  319  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
            HFKVNV+  DGHF+HYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFYHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SPNEGDK  621
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP    SPNE D+
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAAHESPNENDR  164



>gb|ABC61505.1| AGO4-2, partial [Nicotiana benthamiana]
Length=905

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 143/164 (87%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeae-ptkkkapRLPMARRGFGSKGQKIPILTN  318
            MAEED NGAAE LPPPPPVP DFTP+ +E E   KK A RLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPAISEPEPVKKKAALRLPMARRGLGNKGQKIQILTN  60

Query  319  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS---PNEGDK  621
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP +   PNE D+
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAADEGPNESDR  164



>ref|XP_006362741.1| PREDICTED: protein argonaute 4-like [Solanum tuberosum]
Length=909

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 145/164 (88%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  MAEEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTN  318
            MAEE+ NGAA E LPPPPPVP DFTP+K E EP KKK  R+PMARRG G+KGQKI ILTN
Sbjct  1    MAEEETNGAAAEGLPPPPPVPPDFTPAKTELEPVKKKILRVPMARRGVGNKGQKIQILTN  60

Query  319  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGKEFAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKEFAYDGEK  120

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            SLFT+GALPRNK+EFTVVL++VTSNRNNGN SP   GSPNE D+
Sbjct  121  SLFTIGALPRNKMEFTVVLDDVTSNRNNGNSSPGGHGSPNEADR  164



>ref|XP_009785001.1| PREDICTED: protein argonaute 4-like [Nicotiana sylvestris]
Length=906

 Score =   237 bits (604),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 140/165 (85%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTP-SkaeaeptkkkapRLPMARRGFGSKGQKIPILTN  318
            MAEED NGAAE LPPPPPVP DFTP         KK APRLPMARRG G+KGQKI ILTN
Sbjct  1    MAEEDKNGAAEGLPPPPPVPPDFTPVKSEPEPVKKKAAPRLPMARRGLGNKGQKIQILTN  60

Query  319  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRVH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVTNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVHETYDTELAGKDFAYDGEK  120

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----PNEGDK  621
            SLFT+GALPRNK+EFTVVLE+VTSNRNNGN SP +    PNE D+
Sbjct  121  SLFTIGALPRNKMEFTVVLEDVTSNRNNGNSSPAAADEGPNESDR  165



>ref|XP_006347268.1| PREDICTED: protein argonaute 4-like isoform X1 [Solanum tuberosum]
 ref|XP_006347269.1| PREDICTED: protein argonaute 4-like isoform X2 [Solanum tuberosum]
Length=913

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 7/167 (4%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAEE+N G+ EALPPPPPVP DF+P++AE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEENGGSTEALPPPPPVPLDFSPAQAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRN---NGNCSPG----SPNEGDK  621
            LFT+G+LPRNKLEFTVVL+++TSNRN   NGN SPG     PNE D+
Sbjct  121  LFTIGSLPRNKLEFTVVLDDITSNRNNGTNGNSSPGRHGSPPNETDR  167



>ref|NP_001289847.1| uncharacterized protein LOC101246148 [Solanum lycopersicum]
 gb|AFV15382.1| AGO4B [Solanum lycopersicum]
Length=913

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 7/167 (4%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAEE+N G+ EALPPPPPVP +F+P++AE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEENGGSTEALPPPPPVPLNFSPAQAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRN---NGNCSPG----SPNEGDK  621
            LFT+G+LPRNKLEFTVVL+++TSNRN   NGN SPG     PNE D+
Sbjct  121  LFTIGSLPRNKLEFTVVLDDITSNRNNGTNGNSSPGRHGSPPNETDR  167



>ref|NP_001266156.1| uncharacterized protein LOC101256023 [Solanum lycopersicum]
 gb|AFV15381.1| AGO4A [Solanum lycopersicum]
Length=909

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  MAEEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTN  318
            MAEE+ NGAA E LPPPPPVP DFTP+K E EP KKK  R+PMARRG G+KGQKI ILTN
Sbjct  1    MAEEETNGAAAEGLPPPPPVPPDFTPAKTEIEPVKKKILRVPMARRGVGNKGQKIQILTN  60

Query  319  HFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
            HFKVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLD VH+TYDTELAGK+FAYDGEK
Sbjct  61   HFKVNVNNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDTVHETYDTELAGKDFAYDGEK  120

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            SLFT+GALPRNK+EFTVVL++V SNRNNGN SP   GSPNE D+
Sbjct  121  SLFTIGALPRNKMEFTVVLDDVISNRNNGNSSPGGHGSPNEADR  164



>ref|XP_011080473.1| PREDICTED: protein argonaute 4 [Sesamum indicum]
 ref|XP_011080474.1| PREDICTED: protein argonaute 4 [Sesamum indicum]
Length=911

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = +1

Query  145  AEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  324
            +E+D NGA EALPPPPPVP + TP KA +EP  KK  R+PMARRG G++G K+PILTNHF
Sbjct  4    SEQDGNGAPEALPPPPPVPPNVTPIKAVSEPEAKKVLRVPMARRGLGTRGTKVPILTNHF  63

Query  325  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  504
            KVNVS  DGHFFHYSVAL YEDGRPVD KG+GRKVLDRVH+TYDTELAGKEFAYDGEKSL
Sbjct  64   KVNVSNVDGHFFHYSVALSYEDGRPVDGKGVGRKVLDRVHETYDTELAGKEFAYDGEKSL  123

Query  505  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            FTVG LPRNKLEFTVVLE+VTS+RNNGN SP   GSPNE D+
Sbjct  124  FTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGGHGSPNESDR  165



>gb|AGS47791.1| argonaute 4 [Salvia miltiorrhiza]
Length=870

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 3/162 (2%)
 Frame = +1

Query  145  AEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  324
            +E D NGA+EALPPPPPVP + TP K   EP  KK  R PMARRGFG++G K+PILTNHF
Sbjct  4    SEHDGNGASEALPPPPPVPPNVTPIKVVTEPEVKKVFRAPMARRGFGTRGNKVPILTNHF  63

Query  325  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  504
            KVNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRV DTYD+ELAGKEFAYDGEKSL
Sbjct  64   KVNVNNVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVRDTYDSELAGKEFAYDGEKSL  123

Query  505  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            FTVG+LPRNKLEFTVVLE+VTS+RNNGN SP   GSPNE DK
Sbjct  124  FTVGSLPRNKLEFTVVLEDVTSSRNNGNSSPGGKGSPNESDK  165



>ref|XP_009591976.1| PREDICTED: protein argonaute 4 [Nicotiana tomentosiformis]
Length=912

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 144/166 (87%), Gaps = 6/166 (4%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAEEDN+G  EALPPPPP+P DF+P+KAE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEDNSGVTEALPPPPPIPPDFSPAKAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDK  621
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGNSSPGRHGSPNENDR  166



>ref|XP_011090194.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090195.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090196.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090197.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090198.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090199.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090200.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
 ref|XP_011090201.1| PREDICTED: protein argonaute 4-like [Sesamum indicum]
Length=910

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG G++G K+PILTNHFKVNV+K DGHFFHYSVAL+YEDGRPVD KG+GRKVLD
Sbjct  40   RVPMARRGLGTRGNKVPILTNHFKVNVNKVDGHFFHYSVALFYEDGRPVDGKGVGRKVLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYDTELAGKEFAYDGEKSLFTVG LPRNKLEFTVVLE+VTS+RNNGN SP   GSP
Sbjct  100  RVHETYDTELAGKEFAYDGEKSLFTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGGHGSP  159

Query  607  NEGDK  621
            NE D+
Sbjct  160  NESDR  164



>gb|ABC61504.1| AGO4-1, partial [Nicotiana benthamiana]
Length=912

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 142/166 (86%), Gaps = 6/166 (4%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAEEDN G  EALPPPPP+P DF+P+ AE EP KKK  R+PM+RRG GSKGQKIPILTNH
Sbjct  1    MAEEDNGGVTEALPPPPPIPPDFSPAIAEPEPVKKKVLRVPMSRRGLGSKGQKIPILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDK  621
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGSSSPGKHGSPNENDR  166



>ref|XP_009773871.1| PREDICTED: protein argonaute 4 [Nicotiana sylvestris]
Length=912

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 142/166 (86%), Gaps = 6/166 (4%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAEEDN G  EALPPPPP+P DF P+KAE EP KKK  R+PMARRG GSKGQKIPILTNH
Sbjct  1    MAEEDNIGVTEALPPPPPIPPDFYPAKAEPEPVKKKVLRVPMARRGLGSKGQKIPILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            FKVNVS  DGHFFHYSVAL+YEDGRPV+ KGIGRKVLDRVH+TYDTELAGK+FAYDGEKS
Sbjct  61   FKVNVSNVDGHFFHYSVALFYEDGRPVEGKGIGRKVLDRVHETYDTELAGKDFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP------GSPNEGDK  621
            LFT+G+LPRNKLEFTVVLE+V SNRNNGN         GSPNE D+
Sbjct  121  LFTIGSLPRNKLEFTVVLEDVISNRNNGNNGNSSPGRHGSPNENDR  166



>gb|EYU46161.1| hypothetical protein MIMGU_mgv1a000944mg [Erythranthe guttata]
Length=936

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG G+KG K+PILTNHFKVNV+  DG+FFHYSVAL YEDGRPVD KGIGRKVLD
Sbjct  67   RVPMARRGLGTKGNKVPILTNHFKVNVNSVDGYFFHYSVALAYEDGRPVDGKGIGRKVLD  126

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS--PN  609
            RVH+TYD+ELAGKEFAYDGEKSLFTVG LPRNKLEFTVVLE+VTS+RNNGN SPGS  PN
Sbjct  127  RVHETYDSELAGKEFAYDGEKSLFTVGPLPRNKLEFTVVLEDVTSSRNNGNASPGSENPN  186

Query  610  EGDK  621
            + D+
Sbjct  187  DSDR  190



>ref|XP_004165479.1| PREDICTED: LOW QUALITY PROTEIN: protein argonaute 4-like [Cucumis 
sativus]
Length=915

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALAYEDGRPVDGKGVGRKVID  107

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  607  NEGDK  621
            N GD+
Sbjct  168  NNGDR  172



>ref|XP_004149653.1| PREDICTED: protein argonaute 4-like [Cucumis sativus]
 gb|KGN54041.1| hypothetical protein Csa_4G269720 [Cucumis sativus]
Length=915

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALAYEDGRPVDGKGVGRKVID  107

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  607  NEGDK  621
            N GD+
Sbjct  168  NNGDR  172



>ref|XP_008449865.1| PREDICTED: protein argonaute 4 [Cucumis melo]
 ref|XP_008449866.1| PREDICTED: protein argonaute 4 [Cucumis melo]
Length=915

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG  SKGQKI +LTNHFKVNV+  +GHFFHYSVAL YEDGRPVD KG+GRKV+D
Sbjct  48   RVPIARRGLASKGQKISLLTNHFKVNVTNIEGHFFHYSVALSYEDGRPVDGKGVGRKVID  107

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY++ELAGK+FAYDGEKSLFTVG LPRNKLEFTVVLE++TSNRNNGNCSP   GSP
Sbjct  108  KVHETYNSELAGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDITSNRNNGNCSPDGHGSP  167

Query  607  NEGDK  621
            N GD+
Sbjct  168  NNGDR  172



>ref|XP_002527764.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF34625.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=921

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQKI +LTNHFKVNV+K D +FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  54   RVPIARRGLGSKGQKISLLTNHFKVNVNKVDDYFFHYCVSLSYEDGRPVDGKGVGRKVID  113

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYD+E+ GK+FAYDGEKSLFTVGALPRNKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  114  RVHETYDSEMGGKKFAYDGEKSLFTVGALPRNKLEFTVVLEDVTSNRNNGNASPDGHGSP  173

Query  607  NEGDK  621
            NEGD+
Sbjct  174  NEGDR  178



>ref|XP_002275928.1| PREDICTED: protein argonaute 4 [Vitis vinifera]
 ref|XP_010651616.1| PREDICTED: protein argonaute 4 [Vitis vinifera]
 emb|CBI24382.3| unnamed protein product [Vitis vinifera]
Length=913

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRGF SKGQKI + TNHFKVNV+  DGHFFHYSV+L YEDGRPVD KGIGRKV+D
Sbjct  43   RVPIARRGFASKGQKIALTTNHFKVNVTGADGHFFHYSVSLSYEDGRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  609
            RVH+TYD+EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V+SNRNNGN SP  GSPN
Sbjct  103  RVHETYDSELGGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVSSNRNNGNGSPDRGSPN  162

Query  610  EGDK  621
            E D+
Sbjct  163  ESDR  166



>gb|AGS47796.1| argonaute 9 [Salvia miltiorrhiza]
Length=888

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +1

Query  148  EEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFK  327
            E   NGA EALP PPPVP + TP K + EP  KK  R+PMARRG G++G ++PILTNHFK
Sbjct  23   EHGGNGAPEALPAPPPVPPNVTPLKVQPEPESKKVVRVPMARRGPGTRGNRVPILTNHFK  82

Query  328  VNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLF  507
            VNV+  DGHFFHYSVAL+YEDGRPVD KG+GRKVLDRV  TY+TELAGKEFAYDGEKSLF
Sbjct  83   VNVASVDGHFFHYSVALFYEDGRPVDGKGVGRKVLDRVRATYETELAGKEFAYDGEKSLF  142

Query  508  TVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDK  621
            TVG+LPRNKLEFTVVLE+VTS+RNNGN SPG  NE D+
Sbjct  143  TVGSLPRNKLEFTVVLEDVTSSRNNGNSSPG--NESDR  178



>ref|XP_007016688.1| Argonaute family protein isoform 1 [Theobroma cacao]
 ref|XP_007016689.1| Argonaute family protein isoform 1 [Theobroma cacao]
 gb|EOY34307.1| Argonaute family protein isoform 1 [Theobroma cacao]
 gb|EOY34308.1| Argonaute family protein isoform 1 [Theobroma cacao]
Length=913

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG GSKGQKIPILTNHF+VNV   +GHFFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  42   RVPMARRGLGSKGQKIPILTNHFQVNVGNVNGHFFHYSVSLSYEDGRPVDGKGVGRKVID  101

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY +ELAGK+FAYDGEKSLFTVG LP NKLEFTVVLE+VTSNRNNGN SP    SP
Sbjct  102  RVHETYSSELAGKDFAYDGEKSLFTVGPLPSNKLEFTVVLEDVTSNRNNGNVSPDGHDSP  161

Query  607  NEGDK  621
            NE D+
Sbjct  162  NEHDR  166



>ref|XP_004241389.1| PREDICTED: protein argonaute 4-like [Solanum lycopersicum]
Length=904

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNH  321
            MAE++  G+ EALPPPPPVP DF+P KAE  P +KK  R+PMARRG G KG+ I ILTNH
Sbjct  1    MAEQEYGGSTEALPPPPPVPLDFSPEKAEPAPVEKKLLRVPMARRGLGKKGRNIQILTNH  60

Query  322  FKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKS  501
            F+VNVS  DGHFFHYSVAL+YEDG+PV+ KGIGRKVLDRVH+TY  ELAGK FAYDGEKS
Sbjct  61   FQVNVSNVDGHFFHYSVALFYEDGQPVEVKGIGRKVLDRVHETYHAELAGKGFAYDGEKS  120

Query  502  LFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDK  621
            LFT+G+LPR++ EFTVVL ++TSNRN G  SP  PNE D+
Sbjct  121  LFTIGSLPRSRFEFTVVLNDITSNRNVGTSSP--PNEADR  158



>ref|XP_010689361.1| PREDICTED: protein argonaute 4 [Beta vulgaris subsp. vulgaris]
Length=910

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 130/167 (78%), Gaps = 9/167 (5%)
 Frame = +1

Query  142  MAEEDNNGAAEALpppppvpS----DFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPI  309
            M   D NG+AEALPPPPP P+    D  P   + E    K  R+PMAR+G  ++GQKI +
Sbjct  1    MDSHDGNGSAEALPPPPPPPAEIPPDVVP--IKVESDPPKKKRVPMARKGLATRGQKIQL  58

Query  310  LTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYD  489
            L+NHFKVNVS  DGHFFHYSV L YEDGRPVD KG+GRKVLDRV +TYDTELAGK+FAYD
Sbjct  59   LSNHFKVNVSNVDGHFFHYSVNLMYEDGRPVDGKGVGRKVLDRVQETYDTELAGKDFAYD  118

Query  490  GEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            GEKSLFTVGALP NKLEFTVVLE+VTS RNNGN SP   GSPNE D+
Sbjct  119  GEKSLFTVGALPGNKLEFTVVLEDVTSARNNGNASPEGRGSPNETDR  165



>ref|XP_010093806.1| hypothetical protein L484_022518 [Morus notabilis]
 gb|EXB54657.1| hypothetical protein L484_022518 [Morus notabilis]
Length=226

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARR  G+KGQKIP+LTNHF+V VS  +GHFFHYSVAL YEDGR VD KGIGRKV+D
Sbjct  45   RVPMARRNLGTKGQKIPLLTNHFRVKVSNVEGHFFHYSVALSYEDGRAVDGKGIGRKVID  104

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++LA KEFAYDGEKSLFTVG LPRNKLEFTVVL++V++ R+NGN SP   GSP
Sbjct  105  KVHETYRSDLADKEFAYDGEKSLFTVGPLPRNKLEFTVVLDDVSAARSNGNRSPDGHGSP  164

Query  607  NEGDK  621
            +E D+
Sbjct  165  SENDR  169



>ref|XP_006369389.1| hypothetical protein POPTR_0001s22710g [Populus trichocarpa]
 gb|ERP65958.1| hypothetical protein POPTR_0001s22710g [Populus trichocarpa]
Length=883

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQK+P+LTNHFKVNV+  +G+FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLLTNHFKVNVTNTEGYFFHYCVSLAYEDGRPVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  607  NEGDK  621
            NEGD+
Sbjct  162  NEGDR  166



>ref|XP_006369390.1| Argonaute 4 family protein [Populus trichocarpa]
 gb|ERP65959.1| Argonaute 4 family protein [Populus trichocarpa]
Length=911

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQK+P+LTNHFKVNV+  +G+FFHY V+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLLTNHFKVNVTNTEGYFFHYCVSLAYEDGRPVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  607  NEGDK  621
            NEGD+
Sbjct  162  NEGDR  166



>ref|XP_011006053.1| PREDICTED: protein argonaute 4-like [Populus euphratica]
 ref|XP_011006054.1| PREDICTED: protein argonaute 4-like [Populus euphratica]
Length=911

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQK+P+ TNHFKVNV+  +G+FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  43   RVPIARRGLGSKGQKMPLSTNHFKVNVTNTEGYFFHYSVSLAYEDGRPVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYDTE  GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+V SNRNNGN SP   GSP
Sbjct  103  RVHETYDTEF-GKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDVVSNRNNGNASPDGHGSP  161

Query  607  NEGDK  621
            NEGD+
Sbjct  162  NEGDR  166



>gb|KDP45657.1| hypothetical protein JCGZ_17264 [Jatropha curcas]
Length=910

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM+RRG GSKG KIP+LTNHFKVNV+  DG+FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  45   RVPMSRRGLGSKGNKIPLLTNHFKVNVTNVDGYFFHYSVSLSYEDGRPVDGKGVGRKVID  104

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TYD+EL GK FAYDGEKSLFTVG+LPRNKLEFTVVLE+++SNR+NGN SP   GSP
Sbjct  105  RVQETYDSELGGKNFAYDGEKSLFTVGSLPRNKLEFTVVLEDISSNRSNGNASPDGHGSP  164

Query  607  NEGDK  621
            NE D+
Sbjct  165  NESDR  169



>emb|CDP09667.1| unnamed protein product [Coffea canephora]
Length=868

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 3/122 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            MARRG G+KGQKI +LTNHFKV V   DG FFHYSVAL+YEDGRPVD KGIGR+VLDRV 
Sbjct  1    MARRGLGTKGQKIQLLTNHFKVAVKNVDGQFFHYSVALFYEDGRPVDGKGIGRRVLDRVQ  60

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SPNEG  615
            +TYDTELAG+EFAYDGEKSLFTVG LPRNKL+FTVVLE+VTSNRN GN SPG   SPN+G
Sbjct  61   ETYDTELAGREFAYDGEKSLFTVGPLPRNKLQFTVVLEDVTSNRNTGNSSPGGHESPNDG  120

Query  616  DK  621
            D+
Sbjct  121  DR  122



>gb|KCW87286.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
Length=851

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQKIP+LTNHFKVNV+  DG FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  49   RVPIARRGPGSKGQKIPLLTNHFKVNVTNLDGQFFHYSVSLSYEDGRPVDGKGVGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  609
            +V  TY +ELAGK+FAYDGEKSLFTVG LP+NKLEFTVVLE+VTS+RNNGN SP  GSPN
Sbjct  109  KVQATYSSELAGKDFAYDGEKSLFTVGPLPQNKLEFTVVLEDVTSSRNNGNASPDGGSPN  168

Query  610  EGDK  621
            E D+
Sbjct  169  ESDR  172



>gb|KHG16394.1| Protein argonaute 4 -like protein [Gossypium arboreum]
Length=863

 Score =   200 bits (509),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  148  EEDNNGAA-EALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHF  324
            E+D NGAA ++LPPPPPVP D  P KAE EP KKK  R+PMARRG GSKGQKI +LTNHF
Sbjct  10   EQDGNGAAPDSLPPPPPVPPDVVPIKAEPEPAKKKVVRIPMARRGLGSKGQKITLLTNHF  69

Query  325  KVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSL  504
            KVNV  +DGHFFHY V+LYYEDGRPVD KG+GRKV++RV +TY  ELAGK+FAYDGEKSL
Sbjct  70   KVNVGSSDGHFFHYCVSLYYEDGRPVDGKGVGRKVIERVQETYGNELAGKDFAYDGEKSL  129

Query  505  FTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            FTVGALP NK EFTVVLE+VTSNRNNGN SP
Sbjct  130  FTVGALPNNKHEFTVVLEDVTSNRNNGNASP  160



>ref|XP_010045128.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010045129.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010045131.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 gb|KCW87284.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
 gb|KCW87285.1| hypothetical protein EUGRSUZ_B03780 [Eucalyptus grandis]
Length=918

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG GSKGQKIP+LTNHFKVNV+  DG FFHYSV+L YEDGRPVD KG+GRKV+D
Sbjct  49   RVPIARRGPGSKGQKIPLLTNHFKVNVTNLDGQFFHYSVSLSYEDGRPVDGKGVGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  609
            +V  TY +ELAGK+FAYDGEKSLFTVG LP+NKLEFTVVLE+VTS+RNNGN SP  GSPN
Sbjct  109  KVQATYSSELAGKDFAYDGEKSLFTVGPLPQNKLEFTVVLEDVTSSRNNGNASPDGGSPN  168

Query  610  EGDK  621
            E D+
Sbjct  169  ESDR  172



>ref|XP_010031652.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 ref|XP_010031653.1| PREDICTED: protein argonaute 4-like [Eucalyptus grandis]
 gb|KCW51009.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
 gb|KCW51010.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
Length=921

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG GSKGQKI +LTNHFKVNV+  DG FFHYSV++ YEDGRPVD+KG+GR+V+D
Sbjct  50   RVPMARRGLGSKGQKIALLTNHFKVNVTNVDGQFFHYSVSVSYEDGRPVDAKGVGRRVMD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY +EL+GK+FAYDGEKSLFT+G LPRNKLEFTVVLE+V+S+RNNGN SP   GSP
Sbjct  110  RVQETYSSELSGKDFAYDGEKSLFTIGPLPRNKLEFTVVLEDVSSSRNNGNASPDAHGSP  169

Query  607  NEGDK  621
            N  D+
Sbjct  170  NHTDR  174



>gb|KCW51008.1| hypothetical protein EUGRSUZ_J00634 [Eucalyptus grandis]
Length=949

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG GSKGQKI +LTNHFKVNV+  DG FFHYSV++ YEDGRPVD+KG+GR+V+D
Sbjct  50   RVPMARRGLGSKGQKIALLTNHFKVNVTNVDGQFFHYSVSVSYEDGRPVDAKGVGRRVMD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY +EL+GK+FAYDGEKSLFT+G LPRNKLEFTVVLE+V+S+RNNGN SP   GSP
Sbjct  110  RVQETYSSELSGKDFAYDGEKSLFTIGPLPRNKLEFTVVLEDVSSSRNNGNASPDAHGSP  169

Query  607  NEGDK  621
            N  D+
Sbjct  170  NHTDR  174



>gb|KJB26170.1| hypothetical protein B456_004G228100 [Gossypium raimondii]
Length=913

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG GSKGQKI +LTNHFKVNV  +DGHFFHY V+LYYEDGRPVD KG+GRKV++
Sbjct  42   RVPMARRGLGSKGQKITLLTNHFKVNVGSSDGHFFHYCVSLYYEDGRPVDGKGVGRKVIE  101

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            RV +TY  ELAGK+FAYDGEKSLFTVGALP NK EFTVVLE+VTSNRNNGN SP
Sbjct  102  RVQETYGNELAGKDFAYDGEKSLFTVGALPNNKHEFTVVLEDVTSNRNNGNASP  155



>ref|XP_010653696.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
 ref|XP_010653697.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
Length=918

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM+RRGFGSKGQKI +LTNHFKV ++   GHFFHYSVAL YEDGRPV+ KG+GRK++D
Sbjct  47   RVPMSRRGFGSKGQKISLLTNHFKVGITNASGHFFHYSVALTYEDGRPVEMKGVGRKIMD  106

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TYDTEL+GK+FAYDGEKSLFTVGALP NKLEFTVVL+ V+SNRN  N SP   GSP
Sbjct  107  KVHETYDTELSGKDFAYDGEKSLFTVGALPHNKLEFTVVLDSVSSNRNTRNGSPDVNGSP  166

Query  607  NEGDK  621
            N GD+
Sbjct  167  NGGDR  171



>ref|XP_004491186.1| PREDICTED: protein argonaute 4-like isoform X1 [Cicer arietinum]
 ref|XP_004491187.1| PREDICTED: protein argonaute 4-like isoform X2 [Cicer arietinum]
Length=906

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG GSKG K+P+LTNHFKVNV+ NDG+F+ YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  42   RVPMARRGLGSKGTKLPLLTNHFKVNVANNDGYFYQYSVALFYEDGRPVEGKGAGRKLLD  101

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TYD+EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  102  RVQETYDSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  161

Query  607  NEGDK  621
            N+ DK
Sbjct  162  NDADK  166



>ref|XP_007146204.1| hypothetical protein PHAVU_006G021200g [Phaseolus vulgaris]
 gb|ESW18198.1| hypothetical protein PHAVU_006G021200g [Phaseolus vulgaris]
Length=919

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARR  GS+G KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  47   RLPIARRDLGSRGMKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIMD  106

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP--GSPN  609
            RV +TY ++L GK+FAYDGEKSLFT+G+LPRNKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  107  RVQETYHSDLNGKDFAYDGEKSLFTIGSLPRNKLEFEVVLEDVTSNRNNGNCSPDGNGDN  166

Query  610  EGDK  621
            E D+
Sbjct  167  ESDR  170



>gb|KHN37954.1| Protein argonaute 4 [Glycine soja]
Length=947

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  79   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  138

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  609
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  139  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  198

Query  610  EGDK  621
            E D+
Sbjct  199  ESDR  202



>ref|XP_003555656.1| PREDICTED: protein argonaute 4 isoform X1 [Glycine max]
Length=915

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  47   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  106

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  609
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  107  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  166

Query  610  EGDK  621
            E D+
Sbjct  167  ESDR  170



>ref|XP_006605639.1| PREDICTED: protein argonaute 4 isoform X2 [Glycine max]
Length=947

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+AR G GSKG KI +LTNHFKVNV+KNDGHFFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  79   RLPIARSGLGSKGNKIQLLTNHFKVNVAKNDGHFFHYSVAFTYEDGRPVEGKGVGRKIID  138

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  609
            RV +TY ++L GK+FAYDGEKSLFTVG+LP+NKLEF VVLE+VTSNRNNGNCSP     N
Sbjct  139  RVQETYHSDLNGKDFAYDGEKSLFTVGSLPQNKLEFEVVLEDVTSNRNNGNCSPDGLGDN  198

Query  610  EGDK  621
            E D+
Sbjct  199  ESDR  202



>gb|ACZ04920.1| argonaute 4-like protein [Pelargonium x hortorum]
Length=933

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG  SKGQKIP+LTNHFKVNV+  +GHFFHYSVAL+YEDGRPVD KG+G KV+D
Sbjct  65   RVPIARRGLASKGQKIPLLTNHFKVNVTNVEGHFFHYSVALFYEDGRPVDGKGVGGKVID  124

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            RV +TYDTELAGK+FAYDGEKSLFTVG LPRNK EF VVLE+V+SNR NGN SP + +  
Sbjct  125  RVQETYDTELAGKDFAYDGEKSLFTVGPLPRNKHEFIVVLEDVSSNRVNGNASPDAGDGN  184

Query  616  DK  621
            D+
Sbjct  185  DR  186



>ref|XP_007207224.1| hypothetical protein PRUPE_ppa000990mg [Prunus persica]
 gb|EMJ08423.1| hypothetical protein PRUPE_ppa000990mg [Prunus persica]
Length=939

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG G+KG KIP++TNHFKVNV+  DG+FFHYSV++ YEDGRP+D KG GR+++D
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIDGYFFHYSVSVSYEDGRPLDGKGAGRRIID  129

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE++ SNRNNGN SP   GSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDMPSNRNNGNASPDGHGSP  189

Query  607  NEGDK  621
            NE D+
Sbjct  190  NESDR  194



>ref|XP_008231109.1| PREDICTED: protein argonaute 4 [Prunus mume]
 ref|XP_008231117.1| PREDICTED: protein argonaute 4 [Prunus mume]
Length=939

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG G+KG KIP++TNHFKVNV+  DG+FFHYSV++ YEDGRP+D KG GR+++D
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIDGYFFHYSVSVSYEDGRPLDGKGAGRRIID  129

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE++ SNRNNGN SP   GSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDMPSNRNNGNASPDGHGSP  189

Query  607  NEGDK  621
            NE D+
Sbjct  190  NENDR  194



>emb|CBI32885.3| unnamed protein product [Vitis vinifera]
Length=879

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 3/122 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRGFGSKGQKI +LTNHFKV ++   GHFFHYSVAL YEDGRPV+ KG+GRK++D+VH
Sbjct  1    MSRRGFGSKGQKISLLTNHFKVGITNASGHFFHYSVALTYEDGRPVEMKGVGRKIMDKVH  60

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEG  615
            +TYDTEL+GK+FAYDGEKSLFTVGALP NKLEFTVVL+ V+SNRN  N SP   GSPN G
Sbjct  61   ETYDTELSGKDFAYDGEKSLFTVGALPHNKLEFTVVLDSVSSNRNTRNGSPDVNGSPNGG  120

Query  616  DK  621
            D+
Sbjct  121  DR  122



>ref|XP_006293644.1| hypothetical protein CARUB_v10022599mg [Capsella rubella]
 gb|EOA26542.1| hypothetical protein CARUB_v10022599mg [Capsella rubella]
Length=923

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F VVLEEV++ R NGN SP   GSP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPNNKMDFAVVLEEVSAARTNGNASPNGNGSP  172

Query  607  NEGDK  621
            ++GD+
Sbjct  173  SDGDR  177



>gb|KDO66364.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=676

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>ref|XP_008363553.1| PREDICTED: protein argonaute 4-like [Malus domestica]
 ref|XP_008363554.1| PREDICTED: protein argonaute 4-like [Malus domestica]
 ref|XP_008363555.1| PREDICTED: protein argonaute 4-like [Malus domestica]
Length=939

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNGNC    PGSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGNCEPDGPGSP  189

Query  607  NEGDK  621
            NE D+
Sbjct  190  NESDR  194



>ref|XP_009339636.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339637.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339638.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339640.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339641.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339642.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339643.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009339644.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
Length=939

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RVPIARRGLGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNGNC    PGSP
Sbjct  130  RVHETYHSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGNCEPDGPGSP  189

Query  607  NEGDK  621
            NE D+
Sbjct  190  NESDR  194



>ref|XP_002323196.2| hypothetical protein POPTR_0016s02480g [Populus trichocarpa]
 gb|EEF04957.2| hypothetical protein POPTR_0016s02480g [Populus trichocarpa]
Length=921

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ RRG GS+GQKI ++TNHFKV++S   GHFFHYSV+LYYEDGRPVD+KGIGR+++D
Sbjct  50   RSPITRRGVGSRGQKIQLVTNHFKVSISNTGGHFFHYSVSLYYEDGRPVDAKGIGRRLID  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  110  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  169

Query  607  NEGDK  621
            NE DK
Sbjct  170  NETDK  174



>gb|KDO66363.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=735

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>gb|KDO66362.1| hypothetical protein CISIN_1g0024491mg [Citrus sinensis]
Length=845

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>gb|KDO66360.1| hypothetical protein CISIN_1g0024491mg, partial [Citrus sinensis]
 gb|KDO66361.1| hypothetical protein CISIN_1g0024491mg, partial [Citrus sinensis]
Length=820

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>ref|XP_006470434.1| PREDICTED: protein argonaute 4-like [Citrus sinensis]
Length=920

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>ref|XP_003617094.1| Protein argonaute 4 [Medicago truncatula]
Length=908

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  38   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  97

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  98   RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  157

Query  607  NEGDK  621
            N+ D+
Sbjct  158  NDTDR  162



>ref|XP_003617096.1| Protein argonaute 4 [Medicago truncatula]
 gb|AET00055.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=926

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  78   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  137

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  138  RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  197

Query  607  NEGDK  621
            N+ D+
Sbjct  198  NDTDR  202



>ref|XP_002308843.1| hypothetical protein POPTR_0006s02680g [Populus trichocarpa]
 gb|EEE92366.1| hypothetical protein POPTR_0006s02680g [Populus trichocarpa]
Length=930

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ARRGFGS+GQKI +L+NHFKV++S   GHFFHY V+L YEDGRP+D+KGIGR+++D
Sbjct  59   RSPIARRGFGSRGQKIQLLSNHFKVSISNTGGHFFHYCVSLSYEDGRPIDAKGIGRRLID  118

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  119  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  178

Query  607  NEGDK  621
            NE DK
Sbjct  179  NETDK  183



>ref|XP_006446389.1| hypothetical protein CICLE_v10014186mg [Citrus clementina]
 gb|ESR59629.1| hypothetical protein CICLE_v10014186mg [Citrus clementina]
Length=920

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P++RRG GS+GQ+I +LTNHFKVNV+  +GHF+HYSV++ YEDGRPVD KG GRKV+D
Sbjct  49   RVPISRRGLGSRGQRISLLTNHFKVNVTNVEGHFYHYSVSVSYEDGRPVDGKGAGRKVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY+ EL GK+FAYDGEKSLFTVG LPRNKLEFTVVLE+++SNRNNGN SP   GSP
Sbjct  109  RVQETYNAELDGKDFAYDGEKSLFTVGPLPRNKLEFTVVLEDISSNRNNGNASPDAHGSP  168

Query  607  NEGDK  621
            N  D+
Sbjct  169  NGNDR  173



>ref|XP_003617095.1| Protein argonaute 4 [Medicago truncatula]
 gb|AET00054.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=948

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            ++PMARRG GSKG K+P+LTNHFKVNV+  DG+FF YSVAL+YEDGRPV+ KG GRK+LD
Sbjct  78   KVPMARRGLGSKGAKLPLLTNHFKVNVTNTDGYFFQYSVALFYEDGRPVEGKGAGRKILD  137

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RV +TY +EL GK+ AYDGEK+LFT+G+L +NKLEFTVVLE+VTSNRNNGN SP   GSP
Sbjct  138  RVQETYGSELNGKDLAYDGEKTLFTIGSLAQNKLEFTVVLEDVTSNRNNGNASPDGHGSP  197

Query  607  NEGDK  621
            N+ D+
Sbjct  198  NDTDR  202



>gb|KHN38433.1| Protein argonaute 4 [Glycine soja]
Length=878

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RLPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE++ ++RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDIIASRNNGNCSPDGNGEL  159

Query  607  NEGDK  621
            NE DK
Sbjct  160  NESDK  164



>ref|XP_010521596.1| PREDICTED: protein argonaute 4 [Tarenaya hassleriana]
Length=920

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG G+KGQKIP+LTNHFKVNV+  DG+F+HYSVAL+Y+DGRPV++KG+GRKVLD
Sbjct  51   RVPMARRGLGTKGQKIPLLTNHFKVNVTNLDGYFYHYSVALFYDDGRPVETKGVGRKVLD  110

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++H+TY ++LA K+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN +  SP++G
Sbjct  111  KLHETYRSDLADKDFAYDGEKTLFTFGALPTNKMDFSVVLEEVSSKRTNGNSNLDSPDDG  170

Query  616  DK  621
            DK
Sbjct  171  DK  172



>ref|XP_003519489.1| PREDICTED: protein argonaute 4-like [Glycine max]
Length=906

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RLPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE++ ++RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDIIASRNNGNCSPDGNGEL  159

Query  607  NEGDK  621
            NE DK
Sbjct  160  NESDK  164



>ref|XP_011041311.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011041312.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=921

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ RRG GS+GQKI ++TNHFKV++S   GHFFHYSV+LYYEDGRPVD+ GIGR+++D
Sbjct  50   RSPITRRGVGSRGQKIQLVTNHFKVSISNTGGHFFHYSVSLYYEDGRPVDATGIGRRLID  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++LAGK+FAYDGEKS+FT+GALPRNK+EFTV+L+  +SNRN+GN SP   GSP
Sbjct  110  KVHETYGSDLAGKDFAYDGEKSVFTIGALPRNKMEFTVLLDSFSSNRNSGNGSPVGNGSP  169

Query  607  NEGDK  621
            NE DK
Sbjct  170  NETDK  174



>ref|XP_002880875.1| hypothetical protein ARALYDRAFT_481584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57134.1| hypothetical protein ARALYDRAFT_481584 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  54   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  113

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  114  KVHETYHSDLDGKEFAYDGEKTLFTYGALPDNKMDFSVVLEEVSAARTNGNGSPNGNESP  173

Query  607  NEGDK  621
            ++GD+
Sbjct  174  SDGDR  178



>ref|XP_010520483.1| PREDICTED: protein argonaute 4-like [Tarenaya hassleriana]
Length=911

 Score =   189 bits (479),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMARRG G+KGQKI +LTNHFKVN + ++GHFFHYSVAL YEDG PV++KG+GRKVL+
Sbjct  41   RLPMARRGLGTKGQKISLLTNHFKVNYTNSNGHFFHYSVALMYEDGHPVEAKGVGRKVLE  100

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V +TY ++L  K+FAYDGEK+LFT+GALPRNKL+F+VVLE+++S+RN GN SP   N+ 
Sbjct  101  KVQETYQSDLGFKDFAYDGEKTLFTIGALPRNKLDFSVVLEDISSSRNTGNASPSDTNDA  160

Query  616  DK  621
            D+
Sbjct  161  DR  162



>ref|XP_003545462.1| PREDICTED: protein argonaute 4-like [Glycine max]
 gb|KHN26023.1| Protein argonaute 4 [Glycine soja]
Length=906

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ARRG  SKG K+ +LTNH++VNV+  DGHF+ YSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  40   RFPIARRGLASKGTKLQLLTNHYRVNVANTDGHFYQYSVALFYDDGRPVEGKGVGRKLLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TYD+EL GK+FAYDGEK+LFT+G+L RNKLEFTVVLE+V + RNNGNCSP   G  
Sbjct  100  RVHETYDSELNGKDFAYDGEKTLFTLGSLARNKLEFTVVLEDVIATRNNGNCSPEGNGEL  159

Query  607  NEGDK  621
            NE DK
Sbjct  160  NESDK  164



>gb|KEH35100.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=923

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMARRG GSKG KIPILTNHF VN+ KNDG+FF YSV+  YEDGRPV+ KG+GRK++D
Sbjct  58   RLPMARRGLGSKGMKIPILTNHFSVNIGKNDGYFFQYSVSFAYEDGRPVEGKGVGRKIMD  117

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS--PN  609
            RV +TY ++L GKEFAYDGEKSLFT+G+LP+NKLEF +VLE+V S+RNNGN SP +   N
Sbjct  118  RVQETYASDLNGKEFAYDGEKSLFTIGSLPQNKLEFEIVLEDVVSSRNNGNRSPDANGDN  177

Query  610  EGDK  621
            E DK
Sbjct  178  EADK  181



>ref|NP_565633.1| argonaute 4 [Arabidopsis thaliana]
 ref|NP_001189613.1| argonaute 4 [Arabidopsis thaliana]
 sp|Q9ZVD5.2|AGO4_ARATH RecName: Full=Protein argonaute 4; AltName: Full=Protein OVEREXPRESSOR 
OF CATIONIC PEROXIDASE 11 [Arabidopsis thaliana]
 gb|AAK59586.1| putative Argonaute (AGO1) protein [Arabidopsis thaliana]
 gb|AAK93710.1| putative argonaute AGO1 protein [Arabidopsis thaliana]
 gb|AAC77862.2| Argonaute (AGO1)-like protein [Arabidopsis thaliana]
 gb|AEC07928.1| argonaute 4 [Arabidopsis thaliana]
 gb|AEC07929.1| argonaute 4 [Arabidopsis thaliana]
Length=924

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+GFG++GQKIP+LTNHFKV+V+   GHFFHYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  54   RVPMARKGFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEQKGVGRKILD  113

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  114  KVHQTYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSATRANGNGSPNGNESP  173

Query  607  NEGDK  621
            ++GD+
Sbjct  174  SDGDR  178



>ref|XP_009103572.1| PREDICTED: protein argonaute 4-like [Brassica rapa]
Length=923

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 108/126 (86%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKILD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  603
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  604  PNEGDK  621
            P++GD+
Sbjct  170  PSDGDR  175



>ref|XP_010510823.1| PREDICTED: protein argonaute 4 [Camelina sativa]
Length=923

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+GFG++GQKIP+LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIPLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+  R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSVARTNGNGSPNGNESP  172

Query  607  NEGDK  621
            ++GD+
Sbjct  173  SDGDR  177



>ref|XP_011461779.1| PREDICTED: protein argonaute 4-like [Fragaria vesca subsp. vesca]
 ref|XP_011461780.1| PREDICTED: protein argonaute 4-like [Fragaria vesca subsp. vesca]
Length=944

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 5/127 (4%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNV--SKNDGHFFHYSVALYYEDGRPVDSKGIGRKV  429
            RLP+ARRG G+KGQKIP+LTNHFKVNV  S  + HFFHYSV + YEDGRP+D KG GR++
Sbjct  73   RLPIARRGLGTKGQKIPLLTNHFKVNVTNSNKEEHFFHYSVLVTYEDGRPLDGKGAGRRI  132

Query  430  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---G  600
            +DRVH+TY++EL GK+FAYDGEKSLFTVG+LPRNKLEF+VVLE+  SNRNNG+ +    G
Sbjct  133  IDRVHETYNSELGGKDFAYDGEKSLFTVGSLPRNKLEFSVVLEDTPSNRNNGSINADGEG  192

Query  601  SPNEGDK  621
            SPNE D+
Sbjct  193  SPNESDR  199



>emb|CDY56413.1| BnaC04g54830D [Brassica napus]
Length=923

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KGIGRK+LD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGIGRKILD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  603
            +VH TY ++L G+EFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHQTYHSDLDGQEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  604  PNEGDK  621
            P++GD+
Sbjct  170  PSDGDR  175



>ref|XP_006408675.1| hypothetical protein EUTSA_v10001902mg [Eutrema salsugineum]
 gb|ESQ50128.1| hypothetical protein EUTSA_v10001902mg [Eutrema salsugineum]
Length=922

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR GFGSKGQKIP+LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPIARAGFGSKGQKIPLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F VVLEEV+S R NGN SP
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFAVVLEEVSSARTNGNASP  163



>gb|KJB56072.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=688

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>ref|XP_011040669.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011040670.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=914

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ARRG GS+GQKI +L+NHF+V++S   GHFFHY V+L YEDGRP+D+KGIGR+++D
Sbjct  43   RSPIARRGVGSRGQKIQLLSNHFRVSISNTGGHFFHYCVSLSYEDGRPIDAKGIGRRLID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +VH+TY ++LAGK+FAYDGEKSLFT+GALPRNK+EFTV+L+  +SNRN GN SP   GSP
Sbjct  103  KVHETYGSDLAGKDFAYDGEKSLFTIGALPRNKMEFTVLLDSFSSNRNAGNGSPVGNGSP  162

Query  607  NEGDK  621
            NE D+
Sbjct  163  NETDR  167



>ref|XP_002527383.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF35008.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=917

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM+RRG GS+GQ+I +LTNHFKV V+ + GHF HYSVAL+YEDGRPVDSKGIGRKV+D
Sbjct  45   RVPMSRRGNGSRGQRIELLTNHFKVGVNCDGGHFSHYSVALFYEDGRPVDSKGIGRKVID  104

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TYD++LAGK+FAYDGEKSLFTVG+LPRNK+EFTV+L++V+SNR NG+ SP   GSP
Sbjct  105  KVRETYDSDLAGKDFAYDGEKSLFTVGSLPRNKMEFTVLLDDVSSNRINGSGSPVGNGSP  164

Query  607  NEGDK  621
            N  +K
Sbjct  165  NGSEK  169



>gb|KJB56075.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=822

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>emb|CDY04475.1| BnaA07g13010D [Brassica napus]
Length=923

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R GFGSKGQKI +LTNHFKVNV+   GHF+HYSVAL+Y+DGRPV+ KG+GRK+LD
Sbjct  50   RVPMVRPGFGSKGQKIQLLTNHFKVNVANLQGHFYHYSVALFYDDGRPVEQKGVGRKILD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS----  603
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP +    
Sbjct  110  KVHETYHSDLDGKEFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSTRTNGNASPNNGNEE  169

Query  604  PNEGDK  621
            P++GD+
Sbjct  170  PSDGDR  175



>ref|XP_010417848.1| PREDICTED: protein argonaute 4-like [Camelina sativa]
Length=920

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+G G++GQKIP+LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGIGTRGQKIPLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV+  R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSVARTNGNGSPNGNESP  172

Query  607  NEGDK  621
            ++GD+
Sbjct  173  SDGDR  177



>gb|KJB56074.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=844

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>ref|XP_010473093.1| PREDICTED: protein argonaute 4 [Camelina sativa]
Length=923

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR+GFG++GQKI +LTNHF+V+V+   GHFFHYSVAL+Y+DGRPV++KG+GRK+LD
Sbjct  53   RVPMARKGFGTRGQKIQLLTNHFRVDVANLQGHFFHYSVALFYDDGRPVEAKGVGRKILD  112

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GKEFAYDGEK+LFT GALP NK++F+VVLEEV++ R NGN SP    SP
Sbjct  113  KVHETYHSDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSAARTNGNRSPNGNESP  172

Query  607  NEGDK  621
            ++GD+
Sbjct  173  SDGDR  177



>gb|KJB56071.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
 gb|KJB56076.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
 gb|KJB56078.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=912

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>gb|KJB56073.1| hypothetical protein B456_009G105600 [Gossypium raimondii]
Length=863

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DGHF+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGHFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            RVH+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RVHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>ref|XP_008385629.1| PREDICTED: protein argonaute 4 [Malus domestica]
 ref|XP_008385630.1| PREDICTED: protein argonaute 4 [Malus domestica]
Length=939

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  70   RAPIARRGQGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  129

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNG      PGSP
Sbjct  130  RVHETYQSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGTSEPDGPGSP  189

Query  607  NEGDK  621
            NE D+
Sbjct  190  NESDR  194



>ref|XP_009345605.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
 ref|XP_009345606.1| PREDICTED: protein argonaute 4-like [Pyrus x bretschneideri]
Length=945

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R P+ARRG G+KG KIP++TNHFKVNV+  +G+FFHYSV++ YEDGRP+D KG GR++++
Sbjct  76   RAPIARRGQGTKGTKIPLVTNHFKVNVTNIEGYFFHYSVSVAYEDGRPLDGKGAGRRIIE  135

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS---PGSP  606
            RVH+TY +EL GK+FAYDGEKSLFTVG+LPRNKLEF VVLE+V S+RNNG      PGSP
Sbjct  136  RVHETYQSELGGKDFAYDGEKSLFTVGSLPRNKLEFAVVLEDVPSSRNNGTSEPDGPGSP  195

Query  607  NEGDK  621
            NE D+
Sbjct  196  NESDR  200



>ref|XP_011091875.1| PREDICTED: protein argonaute 4A-like [Sesamum indicum]
Length=909

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMA+RGF S+GQ I +LTNHFKV +S+ DGHF+HYSV++ YED  P D+KGIGRKVLD
Sbjct  40   RVPMAKRGFASRGQSISLLTNHFKVALSRTDGHFYHYSVSIKYEDDSPADAKGIGRKVLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR---NNGNCSPGSP  606
            +VHDTY +ELAGK FAYDGEKSLFTVG LP+NKLEFTVVLEE++SNR   +  + + GSP
Sbjct  100  KVHDTYASELAGKRFAYDGEKSLFTVGPLPQNKLEFTVVLEEISSNRKIWSGSHGADGSP  159

Query  607  NEGDK  621
            +E D+
Sbjct  160  DESDR  164



>gb|KHG11406.1| Protein argonaute 4 -like protein [Gossypium arboreum]
Length=880

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRG G+KGQK+ ILTNHFKV+V   DG F+HYSV+L YEDGRPVD KG+GRKV+D
Sbjct  40   RHPMARRGVGTKGQKVTILTNHFKVSVGSTDGQFYHYSVSLSYEDGRPVDGKGVGRKVID  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            R+H+TY  +L GK FAYDGEKSLFT+G LP NKLEFTVVLE+V   RNNGN SP    SP
Sbjct  100  RLHETYKNDLDGKNFAYDGEKSLFTIGPLPNNKLEFTVVLEDVAPTRNNGNASPDGQDSP  159

Query  607  N  609
            N
Sbjct  160  N  160



>ref|XP_004501969.1| PREDICTED: protein argonaute 4-like [Cicer arietinum]
Length=918

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+AR G GSKG KIP+LTNHFKVNV+ NDG+FFHYSVA  YEDGRPV+ KG+GRK++D
Sbjct  51   RLPIARTGLGSKGMKIPLLTNHFKVNVNNNDGYFFHYSVAFTYEDGRPVEGKGVGRKIMD  110

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP----GS  603
            RV +TY ++L  K+FAYDGEKSLFT+G+LP+ KLEF +VLE+VTSNRNNG+ SP      
Sbjct  111  RVQETYHSDLNDKDFAYDGEKSLFTIGSLPQKKLEFEIVLEDVTSNRNNGSRSPDGNGNE  170

Query  604  PNEGDK  621
             NE DK
Sbjct  171  DNESDK  176



>ref|NP_001266010.1| uncharacterized protein LOC101248049 [Solanum lycopersicum]
 ref|XP_010323744.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323747.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323752.1| PREDICTED: uncharacterized protein LOC101248049 isoform X1 [Solanum 
lycopersicum]
 gb|AFV15383.1| AGO4D [Solanum lycopersicum]
Length=881

 Score =   178 bits (452),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR+G GSKGQKI +LTNHFKV ++  DGHFFHYSVA+ YEDG PV+ KG+GRK+LD
Sbjct  15   RHPMARQGTGSKGQKIRLLTNHFKVGMNNTDGHFFHYSVAINYEDGNPVEVKGVGRKILD  74

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NKLEF VVLE+V+S+R +     GSP++ 
Sbjct  75   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKLEFDVVLEDVSSSRTDRGSPDGSPSDV  134

Query  616  DK  621
            D+
Sbjct  135  DR  136



>ref|XP_010323741.1| PREDICTED: uncharacterized protein LOC101248049 isoform X2 [Solanum 
lycopersicum]
Length=901

 Score =   178 bits (452),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR+G GSKGQKI +LTNHFKV ++  DGHFFHYSVA+ YEDG PV+ KG+GRK+LD
Sbjct  35   RHPMARQGTGSKGQKIRLLTNHFKVGMNNTDGHFFHYSVAINYEDGNPVEVKGVGRKILD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NKLEF VVLE+V+S+R +     GSP++ 
Sbjct  95   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKLEFDVVLEDVSSSRTDRGSPDGSPSDV  154

Query  616  DK  621
            D+
Sbjct  155  DR  156



>ref|XP_006400685.1| hypothetical protein EUTSA_v10012624mg [Eutrema salsugineum]
 gb|ESQ42138.1| hypothetical protein EUTSA_v10012624mg [Eutrema salsugineum]
Length=903

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR G GSKGQKIP+LTNHF+VN +  +GHFFHYSVA+ YEDGRPV++KGIGR++LD
Sbjct  29   RPPMARPGNGSKGQKIPLLTNHFRVNFNNANGHFFHYSVAITYEDGRPVEAKGIGRRILD  88

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNE  612
            +V +TY T+L  K FAYDGEK+LFTVGALP NKL+F+VVLE+  S RNN GN SP   N+
Sbjct  89   KVQETYQTDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDTPSGRNNTGNASPNETND  148

Query  613  GDK  621
            GD+
Sbjct  149  GDR  151



>emb|CDY48192.1| BnaA04g15560D [Brassica napus]
Length=922

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTNGNASPNGNEEP  169

Query  607  NEGDK  621
            ++GD+
Sbjct  170  SDGDR  174



>ref|XP_009140756.1| PREDICTED: protein argonaute 4 [Brassica rapa]
 gb|AGA95981.1| argonaute 4 [Brassica rapa subsp. pekinensis]
Length=922

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMARPGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R NGN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTNGNASPNGNEEP  169

Query  607  NEGDK  621
            ++GD+
Sbjct  170  SDGDR  174



>ref|XP_006347690.1| PREDICTED: protein argonaute 4-like [Solanum tuberosum]
Length=881

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMAR+G GSKGQKI +LTNHFKV ++ +DGHFFHYSVA+ YEDG PV+ KGIGRK+LD
Sbjct  15   RLPMARQGTGSKGQKIRLLTNHFKVGMNNSDGHFFHYSVAINYEDGNPVEVKGIGRKILD  74

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +VH TY  ELAGK+FAYDGEKSLFT+GALP NK EF VVLE+V+S+R       GSP++ 
Sbjct  75   KVHQTYSMELAGKDFAYDGEKSLFTIGALPGNKFEFDVVLEDVSSSRTTRGSPGGSPSDV  134

Query  616  DK  621
            D+
Sbjct  135  DR  136



>ref|XP_010673246.1| PREDICTED: protein argonaute 4-like [Beta vulgaris subsp. vulgaris]
Length=884

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 82/127 (65%), Positives = 107/127 (84%), Gaps = 5/127 (4%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM+R G+G+KGQKI + TNHF V ++  D +FFHYSVALYYEDG+PV+ KGIGRKV+D
Sbjct  11   RVPMSRPGYGTKGQKIRLCTNHFNVKIANIDDYFFHYSVALYYEDGKPVEMKGIGRKVMD  70

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN--RNNGNCSP---G  600
            ++++TY +E+ GK+FAYDGEK+LFTVG+LPRNKLEFTVVL++V+S   RN+G  SP   G
Sbjct  71   KINETYRSEMGGKDFAYDGEKTLFTVGSLPRNKLEFTVVLDKVSSESCRNDGKSSPGGDG  130

Query  601  SPNEGDK  621
            SP+E DK
Sbjct  131  SPSENDK  137



>ref|XP_007141565.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
 gb|ESW13559.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
Length=904

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARRG  SKG K+ +LTNHF+VNV   DGHFF YSV+L YEDGRPV+ KG+GRKVLD
Sbjct  40   RLPIARRGLASKGTKLRLLTNHFRVNVGNTDGHFFQYSVSLSYEDGRPVEGKGVGRKVLD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTS-NRNNGNCSP---GS  603
            RV +TY++EL GK FAYDGEK+LFT+G+L RN+LEFTVVLE+V S +R+NGN SP   G 
Sbjct  100  RVQETYNSELNGKNFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSTSRSNGNVSPDGNGE  159

Query  604  PNEGDK  621
             +EGDK
Sbjct  160  LSEGDK  165



>ref|XP_007141564.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
 gb|ESW13558.1| hypothetical protein PHAVU_008G206600g [Phaseolus vulgaris]
Length=907

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARRG  SKG K+ +LTNHF+VNV   DGHFF YSV+L YEDGRPV+ KG+GRKVLD
Sbjct  43   RLPIARRGLASKGTKLRLLTNHFRVNVGNTDGHFFQYSVSLSYEDGRPVEGKGVGRKVLD  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTS-NRNNGNCSP---GS  603
            RV +TY++EL GK FAYDGEK+LFT+G+L RN+LEFTVVLE+V S +R+NGN SP   G 
Sbjct  103  RVQETYNSELNGKNFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSTSRSNGNVSPDGNGE  162

Query  604  PNEGDK  621
             +EGDK
Sbjct  163  LSEGDK  168



>gb|EYU42905.1| hypothetical protein MIMGU_mgv1a001084mg [Erythranthe guttata]
Length=893

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPM R GFGSKGQ IP+LTNHFKV VSK DGHF+HYSVA+ Y+D  PV++KG GRK+L+
Sbjct  24   RLPMVRSGFGSKGQPIPLLTNHFKVAVSKTDGHFYHYSVAIKYDDDTPVEAKGSGRKILE  83

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V+DTY  EL  K FAYDGEK+LFTVG LPRNK EFTV+LE+  SNR+ GN SPG+   G
Sbjct  84   KVYDTYAAELDRKRFAYDGEKTLFTVGPLPRNKFEFTVILEDGQSNRSAGNGSPGADESG  143

Query  616  DK  621
             K
Sbjct  144  PK  145



>ref|XP_009126507.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=906

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG GSKGQ+IP+LTNHFKVN +  +G FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  33   LPMARRGTGSKGQRIPLLTNHFKVNFNNANGQFFHYSVAITYEDGRPVEAKGIGRKILDK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V  TY T+L  K FAYDGEK+LFTVG LP NKL+F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQQTYKTDLGSKYFAYDGEKTLFTVGPLPSNKLDFSVVLEDAPSSRNNTGNGSPNESNDA  152

Query  616  DK  621
            D+
Sbjct  153  DR  154



>emb|CDY09103.1| BnaA02g05290D [Brassica napus]
Length=906

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG GSKGQ+IP+LTNHFKVN +   G FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  33   LPMARRGTGSKGQRIPLLTNHFKVNFNNASGQFFHYSVAITYEDGRPVEAKGIGRKILDK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V  TY T+L  K FAYDGEK+LFTVG LP NKL+F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQQTYKTDLGSKYFAYDGEKTLFTVGPLPSNKLDFSVVLEDAPSSRNNTGNGSPNESNDA  152

Query  616  DK  621
            D+
Sbjct  153  DR  154



>emb|CDP19981.1| unnamed protein product [Coffea canephora]
Length=866

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 103/122 (84%), Gaps = 3/122 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M R G  S+GQK+ +LTNHF V V++N+ +F+HYSV++ YEDG PVD+KG+GR++LD+VH
Sbjct  1    MNRLGLASRGQKLRLLTNHFNVKVARNEDYFYHYSVSISYEDGHPVDAKGVGRRILDKVH  60

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEG  615
            +TY +ELAGK+FAYDGEKSLFT+G+LPRNKLEFTVVL+E+ SNRN G+ SP    SPNE 
Sbjct  61   ETYASELAGKDFAYDGEKSLFTIGSLPRNKLEFTVVLDELASNRNVGSGSPEGNSSPNES  120

Query  616  DK  621
            DK
Sbjct  121  DK  122



>ref|XP_009801790.1| PREDICTED: protein argonaute 4A-like [Nicotiana sylvestris]
 ref|XP_009801791.1| PREDICTED: protein argonaute 4A-like [Nicotiana sylvestris]
Length=887

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR GFGSKGQKI +LTNHFKV ++ +DG+FFHYSVAL YEDG PV++KGIGRK+LD
Sbjct  15   RVPMARPGFGSKGQKIRLLTNHFKVGMTNSDGYFFHYSVALNYEDGNPVEAKGIGRKILD  74

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN---GNCSPGSP  606
            +V  TY  ELAGK+FAYDGEKSLFT+GALP NKLEFTVVLE+++S+  +   G    GSP
Sbjct  75   KVQQTYALELAGKDFAYDGEKSLFTIGALPHNKLEFTVVLEDLSSSSRSTTLGGSLEGSP  134

Query  607  NEGDK  621
             E DK
Sbjct  135  GEADK  139



>ref|XP_003592510.1| Protein argonaute 4A [Medicago truncatula]
Length=902

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            ++PMARRG G+ G K+ +LTNHFKVN +  DG FF Y+VA++YEDG PV++ G GRK+LD
Sbjct  37   KVPMARRGLGTTGNKLSLLTNHFKVNAANTDGFFFQYNVAIFYEDGCPVEASGAGRKILD  96

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            +V  TYD+EL GK+FAYDGEK+LFT+G+L +NKLEFTVVLE+VTS+RNNGNCSP
Sbjct  97   KVKKTYDSELRGKDFAYDGEKTLFTMGSLAQNKLEFTVVLEDVTSSRNNGNCSP  150



>gb|KEH26048.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=903

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            ++PMARRG G+ G K+ +LTNHFKVN +  DG FF Y+VA++YEDG PV++ G GRK+LD
Sbjct  37   KVPMARRGLGTTGNKLSLLTNHFKVNAANTDGFFFQYNVAIFYEDGCPVEASGAGRKILD  96

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            +V  TYD+EL GK+FAYDGEK+LFT+G+L +NKLEFTVVLE+VTS+RNNGNCSP
Sbjct  97   KVKKTYDSELRGKDFAYDGEKTLFTMGSLAQNKLEFTVVLEDVTSSRNNGNCSP  150



>ref|XP_007141563.1| hypothetical protein PHAVU_008G206500g [Phaseolus vulgaris]
 gb|ESW13557.1| hypothetical protein PHAVU_008G206500g [Phaseolus vulgaris]
Length=904

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLP+ARRG  SKG K+ +LTNHF+VN+   DGHFF YSV+L YEDGRPV+ KG+GRKVL+
Sbjct  40   RLPIARRGLASKGTKLRLLTNHFRVNIGNTDGHFFQYSVSLCYEDGRPVEGKGVGRKVLE  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN-RNNGNCSP  597
            R+ +TY++EL GK+FAYDGEK+LFT+G+L RN+LEFTVVLE+V SN RNNGN SP
Sbjct  100  RLQETYNSELNGKDFAYDGEKTLFTLGSLARNRLEFTVVLEDVVSNGRNNGNVSP  154



>emb|CDX77061.1| BnaC04g38560D [Brassica napus]
Length=922

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R GFGSKGQKI +LTNHF V V+   G F+HYSVAL+Y+DGRPV+ KG+GRKVLD
Sbjct  50   RVPMDRTGFGSKGQKIQLLTNHFGVKVANLQGFFYHYSVALFYDDGRPVEQKGVGRKVLD  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +VH+TY ++L GK+FAYDGEK+LFT GALP NK++F+VVLEEV+S R  GN SP     P
Sbjct  110  KVHETYHSDLDGKQFAYDGEKTLFTFGALPSNKMDFSVVLEEVSSARTTGNASPNGNEEP  169

Query  607  NEGDK  621
            ++GD+
Sbjct  170  SDGDR  174



>ref|XP_002310956.1| hypothetical protein POPTR_0008s01100g [Populus trichocarpa]
 gb|EEE88323.1| hypothetical protein POPTR_0008s01100g [Populus trichocarpa]
Length=923

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG+G+KGQ+I +LTNHFKV V K++ HF+ YSVAL+YEDG P D KGIGRKV+D
Sbjct  41   RVPMARRGYGAKGQRIQLLTNHFKVAVPKSNDHFYQYSVALFYEDGHPTDGKGIGRKVMD  100

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TYD+EL GK+ AYDGEK+LFT G+LP NKLEFTVVLE+V+  R   N S    GSP
Sbjct  101  KVQETYDSELEGKQLAYDGEKTLFTTGSLPHNKLEFTVVLEDVSLTRGGDNDSSRGNGSP  160

Query  607  NEGDK  621
            +E D+
Sbjct  161  SESDQ  165



>ref|XP_007220876.1| hypothetical protein PRUPE_ppa017623mg [Prunus persica]
 gb|EMJ22075.1| hypothetical protein PRUPE_ppa017623mg [Prunus persica]
Length=911

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+A+ YEDG PVD KGIGRKVLD
Sbjct  43   RVPMTRPGIGSKGQRIPLLTNHFKVAVNKSDGYFFHYSIAMLYEDGTPVDGKGIGRKVLD  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP-GSPNE  612
            +V +TY +EL  KEFAYDGEKSLFTVG LPRN+L+F VVL++++S R  G  SP GS N 
Sbjct  103  KVKETYGSELEHKEFAYDGEKSLFTVGPLPRNRLDFLVVLDDISSTRRTG--SPGGSSNP  160

Query  613  GD  618
            G+
Sbjct  161  GE  162



>ref|XP_009120721.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=911

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFHYSVA+ YEDGRPV++KGIGRK+L++
Sbjct  33   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHYSVAITYEDGRPVEAKGIGRKILEK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDGEK+LFTVGALP NKL+F+VVLE+ +S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDTSSSRNNTGNASPNESNDA  152

Query  616  DK  621
            D+
Sbjct  153  DR  154



>ref|XP_011032992.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
 ref|XP_011032994.1| PREDICTED: protein argonaute 4A-like [Populus euphratica]
Length=913

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMARRG+G+KGQ+I +LTNHFKV V K++ HF+ YSV L+YEDG P D KGIGRKV+D
Sbjct  41   RVPMARRGYGAKGQRIQLLTNHFKVAVPKSNDHFYQYSVGLFYEDGHPTDGKGIGRKVMD  100

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TYD+EL GK+ AYDGEK+LFT+G+LP NKLEFTVVLE+V+  R   N S    GSP
Sbjct  101  KVQETYDSELEGKQLAYDGEKTLFTIGSLPHNKLEFTVVLEDVSLTRGGDNDSSRGNGSP  160

Query  607  NEGD  618
            +E D
Sbjct  161  SESD  164



>ref|XP_010493237.1| PREDICTED: protein argonaute 9-like isoform X3 [Camelina sativa]
Length=723

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN  148



>gb|AGS47795.1| argonaute 8 [Salvia miltiorrhiza]
Length=890

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G  ++G+ I +L NHFKV V+  +G+FFHYSV++ YEDG PVD+KGIGR++LD
Sbjct  30   RIPMARPGVATRGRNISLLVNHFKVTVNNTEGYFFHYSVSIKYEDGSPVDAKGIGRRILD  89

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
            +VH+TY  EL GK+FAYDGEKSLFT+G LP NKLEFTV+L+E+ SNRN G+ SPG+
Sbjct  90   KVHETYAAELDGKKFAYDGEKSLFTIGPLPHNKLEFTVILDEIASNRNTGSGSPGA  145



>emb|CDX92405.1| BnaA10g14440D [Brassica napus]
Length=915

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFHYSVA+ YEDGRPV++KGIGRK+L++
Sbjct  35   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHYSVAITYEDGRPVEAKGIGRKILEK  94

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDGEK+LFTVGALP NKL+F++VLE+  S+RNN GN SP   N+ 
Sbjct  95   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKLDFSIVLEDTPSSRNNTGNASPNESNDA  154

Query  616  DK  621
            D+
Sbjct  155  DR  156



>ref|XP_008231753.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
Length=910

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 4/122 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+A+ YEDG PVD KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVAVNKSDGYFFHYSIAMLYEDGTPVDGKGIGRKVLD  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP-GSPNE  612
            +V +TY +EL  KEFAYDGEKSLFTVG LPRN+L+F VVL++++S R     SP GS N 
Sbjct  103  KVKETYGSELEHKEFAYDGEKSLFTVGPLPRNRLDFLVVLDDISSTRIG---SPGGSSNP  159

Query  613  GD  618
            G+
Sbjct  160  GE  161



>dbj|BAC42876.1| putative zwille/pinhead [Arabidopsis thaliana]
Length=304

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHA  144



>ref|XP_010493236.1| PREDICTED: protein argonaute 9-like isoform X2 [Camelina sativa]
Length=882

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN  148



>ref|XP_010493235.1| PREDICTED: protein argonaute 9-like isoform X1 [Camelina sativa]
Length=901

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD+
Sbjct  41   LPMARRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILDK  100

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
            V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN
Sbjct  101  VQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN  148



>ref|XP_008375403.1| PREDICTED: protein argonaute 4A-like [Malus domestica]
Length=911

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G G+KGQKIP+LTNHFKV V+K+D +FFHYS+A+ YEDG PVD KGIGRKV+D
Sbjct  43   RVPMARSGNGTKGQKIPLLTNHFKVAVNKSDEYFFHYSIAMSYEDGTPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG-----  600
            +V  TY  ELA KEFAYDGEKSLFTVG LP N+LEFTVVL++++S R     SPG     
Sbjct  103  KVKQTYAMELADKEFAYDGEKSLFTVGPLPHNRLEFTVVLDDISSTRRTA--SPGGGSNR  160

Query  601  SPNEGDK  621
            + +EGD+
Sbjct  161  ADSEGDR  167



>ref|XP_008231754.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
 ref|XP_008231755.1| PREDICTED: protein argonaute 4A-like [Prunus mume]
Length=902

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+DG+FFHYS+ + YEDG PV  KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVGVNKSDGYFFHYSIDMLYEDGTPVGEKGIGRKVLD  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V +TY +EL  KEFAYDGEKSLFTVG+LPRN+L+F +VL++++S R  G+   GS N  
Sbjct  103  KVKETYGSELGHKEFAYDGEKSLFTVGSLPRNRLDFVIVLDDISSIRRTGSAG-GSSNPT  161

Query  616  D  618
            D
Sbjct  162  D  162



>ref|XP_009590319.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590320.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590321.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590322.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590323.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
 ref|XP_009590324.1| PREDICTED: protein argonaute 4A-like [Nicotiana tomentosiformis]
Length=887

 Score =   167 bits (422),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G GSKGQKI +LTNHFKV ++ +DG+FFHYSVAL YEDG PV++KGIGRK+LD
Sbjct  15   RVPMARLGIGSKGQKIRLLTNHFKVGMTNSDGYFFHYSVALNYEDGNPVEAKGIGRKILD  74

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            +V  TY  ELAGK+FAYDGEKSLFT+GALP NKLEFTVVLE+++S+  +         SP
Sbjct  75   KVQQTYALELAGKDFAYDGEKSLFTIGALPHNKLEFTVVLEDLSSSSRSTTRGGSLERSP  134

Query  607  NEGDK  621
             E DK
Sbjct  135  GEADK  139



>ref|XP_006471315.1| PREDICTED: protein argonaute 4B-like [Citrus sinensis]
Length=1271

 Score =   168 bits (425),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  402  RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  461

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  462  KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  521

Query  607  NEGDK  621
            +EGD+
Sbjct  522  SEGDR  526



>ref|XP_006432529.1| hypothetical protein CICLE_v10003971mg, partial [Citrus clementina]
 gb|ESR45769.1| hypothetical protein CICLE_v10003971mg, partial [Citrus clementina]
Length=723

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  38   RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  97

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  98   KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  157

Query  607  NEGDK  621
            +EGD+
Sbjct  158  SEGDR  162



>gb|KDO53795.1| hypothetical protein CISIN_1g0026362mg, partial [Citrus sinensis]
Length=736

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 98/125 (78%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPMARR  G+KG  + +LTNHF+V + + +G+F HYSVAL+YEDG PVD KGIGRK+LD
Sbjct  38   RLPMARRNHGTKGTPMTLLTNHFEVRMRQTEGYFCHYSVALFYEDGHPVDGKGIGRKILD  97

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            +V +TY  EL GK FAYDGEKSLFT+G+  R KLEFT+V+E+++SNR   N SP   GSP
Sbjct  98   KVQETYSHELEGKHFAYDGEKSLFTLGSFQRKKLEFTIVVEDLSSNRTARNDSPGGDGSP  157

Query  607  NEGDK  621
             EGD+
Sbjct  158  GEGDR  162



>emb|CDY16595.1| BnaC09g36780D [Brassica napus]
Length=920

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG G+KG K  +LTNHF+VN + ++GHFFH SVA+ YEDGRPV++KGIGRK+L++
Sbjct  33   LPMARRGSGTKGVKTHLLTNHFRVNFNNSNGHFFHCSVAITYEDGRPVEAKGIGRKILEK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDGEK+LFTVGALP NK++F+VVLE+  S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGEKTLFTVGALPSNKMDFSVVLEDTPSSRNNTGNASPNESNDA  152

Query  616  DK  621
            D+
Sbjct  153  DR  154



>ref|XP_002871971.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48230.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 99/122 (81%), Gaps = 4/122 (3%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  41   LPMARPRGSGSKGQKIPLLTNHFGVKFNKASGYFFHYSVAISYEDGRPVEAKGIGRKILD  100

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE++ S+RNN        N+G
Sbjct  101  KVQETYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDIPSSRNNAG---NDTNDG  157

Query  616  DK  621
            D+
Sbjct  158  DR  159



>ref|XP_010420963.1| PREDICTED: protein argonaute 9 [Camelina sativa]
Length=902

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  41   LPMARPRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILD  100

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
            +V DTY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN
Sbjct  101  KVQDTYQSDLGSKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN  149



>gb|AAO73892.1| PAZ (Piwi Argonaut and Zwille) family [Arabidopsis thaliana]
Length=892

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHA  144



>ref|NP_197613.2| argonaute 9 [Arabidopsis thaliana]
 sp|Q84VQ0.2|AGO9_ARATH RecName: Full=Protein argonaute 9 [Arabidopsis thaliana]
 gb|AED92940.1| Argonaute family protein [Arabidopsis thaliana]
Length=896

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHA  144



>ref|XP_007219668.1| hypothetical protein PRUPE_ppa025242mg [Prunus persica]
 gb|EMJ20867.1| hypothetical protein PRUPE_ppa025242mg [Prunus persica]
Length=872

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G GSKGQ+IP+LTNHFKV V+K+ G+FFHYS+ + YEDG PV  KGIGRKVLD
Sbjct  43   RVPMARPGIGSKGQRIPLLTNHFKVGVNKSGGYFFHYSIDMLYEDGTPVGEKGIGRKVLD  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V +TY +EL  KEFAYDGEKSLFTVG+LPRN+L+F +VL+ ++S R  G+   GS N  
Sbjct  103  KVKETYGSELGHKEFAYDGEKSLFTVGSLPRNRLDFVIVLDGISSIRRTGSAG-GSSNPT  161

Query  616  D  618
            D
Sbjct  162  D  162



>emb|CAD66636.1| ARGONAUTE9 protein [Arabidopsis thaliana]
Length=896

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG GSKGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  35   LPMARPRGSGSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLEE+ S+RN+ 
Sbjct  95   KVQETYQSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHA  144



>ref|XP_006287018.1| hypothetical protein CARUB_v10000166mg [Capsella rubella]
 gb|EOA19916.1| hypothetical protein CARUB_v10000166mg [Capsella rubella]
Length=922

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +1

Query  259  LPMAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMAR RG G+KGQKIP+LTNHF V  +K  G+FFHYSVA+ YEDGRPV++KGIGRK+LD
Sbjct  61   LPMARPRGSGTKGQKIPLLTNHFGVKFNKPTGYFFHYSVAISYEDGRPVEAKGIGRKILD  120

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
            +V +TY ++L  K FAYDGEK+LFTVGALP NKL+F+VVLE+V S+RNN
Sbjct  121  KVQETYRSDLGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEDVPSSRNN  169



>ref|XP_009416373.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416374.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416375.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416376.1| PREDICTED: protein argonaute 4B-like [Musa acuminata subsp. malaccensis]
Length=915

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G G KGQ +P+LTNHFKV+V   D +F+HYSV L YED RPVD KGIGR+V+D
Sbjct  44   RVPMPRPGLGKKGQVVPLLTNHFKVSVRNVDDYFYHYSVLLKYEDDRPVDGKGIGRRVID  103

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSP  606
            ++H TYD +L  K+FAYDGEKSLFT+GALP  K EFTVVLE+V+S R  GN SP    SP
Sbjct  104  KLHQTYDVDLGNKDFAYDGEKSLFTLGALPHVKNEFTVVLEDVSSARTTGNRSPHGNDSP  163

Query  607  NEGD  618
             E D
Sbjct  164  GESD  167



>ref|XP_010251689.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
 ref|XP_010251690.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
 ref|XP_010251691.1| PREDICTED: protein argonaute 4A [Nelumbo nucifera]
Length=921

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G G KG+ I +L+NHF+VNV      FFHYSV++ YEDGRP + KGIGR+V+D
Sbjct  48   RVPMARPGMGRKGKPIQLLSNHFRVNVVNVTSIFFHYSVSICYEDGRPAEGKGIGRRVMD  107

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
            +VH+TYDTEL GK+ AYDGEKSLFTVG LPRNKLEFTVVLE+++SNR
Sbjct  108  KVHETYDTELEGKDLAYDGEKSLFTVGPLPRNKLEFTVVLEDLSSNR  154



>gb|AET00057.2| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=892

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            + PMARRG G+KG K+P+LTNHF+VNV+  +  FF YSVAL+YEDGRPV+ KG GRK++D
Sbjct  38   KAPMARRGLGTKGAKLPLLTNHFEVNVANTNRVFFQYSVALFYEDGRPVEGKGAGRKIID  97

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP  597
            +V +TYD+EL GK+ AYDGE +LFT+G+L + KLEF VV+E+V SNRNN N SP
Sbjct  98   KVQETYDSELNGKDLAYDGE-TLFTIGSLAQKKLEFIVVVEDVASNRNNANTSP  150



>gb|AIO05706.1| putative argonaute 4, partial [Cocos nucifera]
Length=714

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR G   +GQ I +LTNHFKV V   D  F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPITLLTNHFKVAVRNVDDCFYHYSVSLKYEDNRPVDGKGIGRRVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE++ S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMASGRTAGNGSPGGHDSP  168

Query  607  NEGDK  621
            +E D+
Sbjct  169  SESDR  173



>ref|XP_007016691.1| Argonaute family protein isoform 4, partial [Theobroma cacao]
 gb|EOY34310.1| Argonaute family protein isoform 4, partial [Theobroma cacao]
Length=667

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 3/95 (3%)
 Frame = +1

Query  346  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  525
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  526  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDR  95



>ref|XP_007016692.1| Argonaute family protein isoform 5, partial [Theobroma cacao]
 gb|EOY34311.1| Argonaute family protein isoform 5, partial [Theobroma cacao]
Length=675

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 3/95 (3%)
 Frame = +1

Query  346  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  525
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  526  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDR  95



>ref|XP_007016690.1| Argonaute family protein isoform 3, partial [Theobroma cacao]
 gb|EOY34309.1| Argonaute family protein isoform 3, partial [Theobroma cacao]
Length=773

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 3/95 (3%)
 Frame = +1

Query  346  DGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  525
            +GHFFHYSV+L YEDGRPVD KG+GRKV+DRVH+TY +ELAGK+FAYDGEKSLFTVG LP
Sbjct  1    NGHFFHYSVSLSYEDGRPVDGKGVGRKVIDRVHETYSSELAGKDFAYDGEKSLFTVGPLP  60

Query  526  RNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
             NKLEFTVVLE+VTSNRNNGN SP    SPNE D+
Sbjct  61   SNKLEFTVVLEDVTSNRNNGNVSPDGHDSPNEHDR  95



>ref|XP_008805346.1| PREDICTED: protein argonaute 4B-like isoform X2 [Phoenix dactylifera]
Length=852

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR G   +GQ I +LTNHF+V V   D +F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPINLLTNHFRVAVRNVDDYFYHYSVSLKYEDDRPVDGKGIGRRVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE+++S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMSSGR-TGNGSPGGHDSP  167

Query  607  NEGDK  621
            +E D+
Sbjct  168  SESDR  172



>emb|CDY59516.1| BnaCnng35060D [Brassica napus]
Length=906

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+ YSV + YEDG P+++KG+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYRYSVTITYEDGSPMEAKGVFRKILEK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDG+K+LFT+G LP NK++F VVLE   S+RNN GN SP   N+ 
Sbjct  93   VQETYRTDLGSKYFAYDGQKNLFTIGVLPSNKMDFLVVLENTPSSRNNTGNASPNETNDA  152

Query  616  DK  621
            D+
Sbjct  153  DR  154



>ref|XP_008805343.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805344.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805345.1| PREDICTED: protein argonaute 4B-like isoform X1 [Phoenix dactylifera]
Length=919

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR G   +GQ I +LTNHF+V V   D +F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVARPGLARRGQPINLLTNHFRVAVRNVDDYFYHYSVSLKYEDDRPVDGKGIGRRVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE+++S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMSSGR-TGNGSPGGHDSP  167

Query  607  NEGDK  621
            +E D+
Sbjct  168  SESDR  172



>ref|XP_010943265.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943266.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943267.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
 ref|XP_010943268.1| PREDICTED: protein argonaute 4B-like [Elaeis guineensis]
Length=920

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+ R G   +GQ I +LTNHF+V V   D  F+HYSV+L YED RPVD KGIGR+V+D
Sbjct  49   RVPVTRPGLAKRGQPITLLTNHFRVAVRNVDDCFYHYSVSLKYEDNRPVDGKGIGRRVID  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TYDTEL  K+FAYDGEKSLFT+GALP+   EFTVVLE++ S R  GN SPG   SP
Sbjct  109  KLQQTYDTELGNKDFAYDGEKSLFTIGALPQVNNEFTVVLEDMGSGRTAGNGSPGGNDSP  168

Query  607  NEGDK  621
             E D+
Sbjct  169  GESDR  173



>gb|EAZ11412.1| hypothetical protein OsJ_01273 [Oryza sativa Japonica Group]
Length=190

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            +LPM+R+GFG+KGQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTKGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN  573
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+ +S+
Sbjct  67   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSS  112



>ref|XP_004308183.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
 ref|XP_011468750.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
Length=915

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G GS+GQKI ++TNHFKV ++K++  F+HYS+A+ Y+DG  VD KGIGRKVLD
Sbjct  42   RVPMKRPGIGSQGQKISLVTNHFKVGLNKSNTEFYHYSIAMQYDDGTEVDGKGIGRKVLD  101

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
            +V +TY  EL  KEFAYDGEKSLFTVG LPR +LEFTVVL +++S+R+  N
Sbjct  102  KVKETYILELENKEFAYDGEKSLFTVGQLPRKQLEFTVVLNDISSSRSGTN  152



>ref|XP_002264978.1| PREDICTED: protein argonaute 4A-like [Vitis vinifera]
Length=889

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  426
            RLPMARRG G  G+ I ++TNHFKV++  N     HF+ Y+V+L +EDG P D+K IGRK
Sbjct  21   RLPMARRGLGRTGETIQLVTNHFKVSMHSNANTGAHFYQYNVSLAHEDGHPADAKDIGRK  80

Query  427  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSP  606
            V+D+VH+TY TE+AG  FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR +   +  SP
Sbjct  81   VMDKVHETYHTEMAGMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNRISTTRNIDSP  140

Query  607  NEG  615
            ++G
Sbjct  141  DDG  143



>sp|Q6YSJ5.2|AGO16_ORYSJ RecName: Full=Protein argonaute 16; Short=OsAGO16; AltName: Full=OsAGO6; 
AltName: Full=Protein ZWILLE/PINHEAD-like 1 [Oryza 
sativa Japonica Group]
Length=883

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ YSV++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGIDAVFYQYSVSIKSEDDKVIDGKGIGRKVMD  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  79   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  138

Query  616  DK  621
            DK
Sbjct  139  DK  140



>dbj|BAC84805.1| putative ARGONAUTE9 protein [Oryza sativa Japonica Group]
 dbj|BAD32046.1| putative ARGONAUTE9 protein [Oryza sativa Japonica Group]
Length=889

 Score =   150 bits (380),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ YSV++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGIDAVFYQYSVSIKSEDDKVIDGKGIGRKVMD  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  79   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  138

Query  616  DK  621
            DK
Sbjct  139  DK  140



>ref|XP_008778689.1| PREDICTED: protein argonaute 4B-like [Phoenix dactylifera]
Length=920

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PMAR G  S+GQ I +LTNHF+V+V   DG+F+HYSV+L YED  PVD  G+GR+V+D
Sbjct  49   RVPMARPGLASRGQPITLLTNHFRVSVQNLDGYFYHYSVSLKYEDNHPVDGNGVGRRVMD  108

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            ++  TYDTEL  K+FAYDGEK+LFT+GALP+   EFTVVLE+++S+R  G+ S G
Sbjct  109  KLQQTYDTELGNKDFAYDGEKNLFTMGALPQVNNEFTVVLEDISSSRTAGDGSLG  163



>ref|XP_009120723.1| PREDICTED: protein argonaute 9-like [Brassica rapa]
Length=903

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+HYSV + YEDG P+++ G+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYHYSVTITYEDGSPMEAIGVFRKILEK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDG K+LFT+GALP NK++F VVLE   S+RNN GN    SPN+ 
Sbjct  93   VQETYRTDLGSKYFAYDGHKNLFTIGALPSNKMDFLVVLENTPSSRNNTGN---ASPNDA  149

Query  616  DK  621
            D+
Sbjct  150  DR  151



>emb|CDX92406.1| BnaA10g14450D [Brassica napus]
Length=904

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LPMARRG GS+G + P+LTNHF+VN +  +GHF+HYSV + YEDG P+++ G+ RK+L++
Sbjct  33   LPMARRGIGSEGVRTPLLTNHFRVNFNNANGHFYHYSVTITYEDGSPMEAIGVFRKILEK  92

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN-GNCSPGSPNEG  615
            V +TY T+L  K FAYDG K+LFT+GALP NK++F VVLE   S+RNN GN    SPN+ 
Sbjct  93   VQETYRTDLGSKYFAYDGHKNLFTIGALPSNKMDFLVVLENTPSSRNNTGN---ASPNDA  149

Query  616  DK  621
            D+
Sbjct  150  DR  151



>ref|NP_001052115.1| Os04g0151800 [Oryza sativa Japonica Group]
 sp|Q0JF58.1|AGO4B_ORYSJ RecName: Full=Protein argonaute 4B; Short=OsAGO4b [Oryza sativa 
Japonica Group]
 dbj|BAF14029.1| Os04g0151800 [Oryza sativa Japonica Group]
 gb|EEE60454.1| hypothetical protein OsJ_13701 [Oryza sativa Japonica Group]
Length=911

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR G G KGQ I +L NH+KV+V  ++ +FFHY+V L YED RPVD KG+GRKV+D
Sbjct  43   RFPMARPGLGRKGQPIQLLANHYKVSVKSSEEYFFHYNVILKYEDDRPVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY +EL+ K+FAYDGEKSLFT+GALP+   EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRSELSSKDFAYDGEKSLFTIGALPQVTNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
               D+
Sbjct  163  GGSDR  167



>emb|CAH65970.1| H0820C10.3 [Oryza sativa Indica Group]
 gb|EEC76718.1| hypothetical protein OsI_14737 [Oryza sativa Indica Group]
Length=911

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR G G KGQ I +L NH+KV+V  ++ +FFHY+V L YED RPVD KG+GRKV+D
Sbjct  43   RFPMARPGLGRKGQPIQLLANHYKVSVKSSEEYFFHYNVILKYEDDRPVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY +EL+ K+FAYDGEKSLFT+GALP+   EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRSELSSKDFAYDGEKSLFTIGALPQVTNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
               D+
Sbjct  163  GGSDR  167



>ref|XP_010943243.1| PREDICTED: protein argonaute 16-like [Elaeis guineensis]
Length=906

 Score =   148 bits (374),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PM R GFGS G+ I +L+NHF V  +  D  F+HY+V +  ED   V++KG+GRK++D
Sbjct  40   RSPMVRCGFGSGGRHIQLLSNHFSVRFTAQDAAFYHYTVTIKSEDKHAVEAKGMGRKIMD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  609
            +++ TY +ELAGKEFAYDGEKSLFTVG LP+N  EFTVVLEE +S R  G  SPG  SP+
Sbjct  100  KLYQTYSSELAGKEFAYDGEKSLFTVGPLPQNNFEFTVVLEE-SSLRRVGGLSPGNASPS  158

Query  610  EGDK  621
            EGD+
Sbjct  159  EGDR  162



>ref|XP_002874028.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50287.1| PAZ domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=848

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGH-FFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMARRG GSKG+KI +LTNHF+VN S+ + H FFHYSVA+ YEDG PV++KGIGRK+L+
Sbjct  13   LPMARRGNGSKGKKIHLLTNHFRVNFSQPNNHDFFHYSVAITYEDGSPVEAKGIGRKILE  72

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            +V  TY T+L  K FAYDG+K+LFT G LP + LEF+VVLE+++S RN G
Sbjct  73   KVQQTYQTDLGFKHFAYDGDKNLFTAGPLPGSNLEFSVVLEDMSSRRNAG  122



>emb|CBI40895.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   148 bits (373),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 68/110 (62%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  426
            RLPMARRG G  G+ I ++TNHFKV++  N     HF+ Y+V+L +EDG P D+K IGRK
Sbjct  21   RLPMARRGLGRTGETIQLVTNHFKVSMHSNANTGAHFYQYNVSLAHEDGHPADAKDIGRK  80

Query  427  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
            V+D+VH+TY TE+AG  FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR
Sbjct  81   VMDKVHETYHTEMAGMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNR  130



>ref|XP_008347021.1| PREDICTED: protein argonaute 4B-like [Malus domestica]
Length=330

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            +PM+R GFGS+G+ I + TNHFKV V  +DG+FFHYS+ ++YEDG PV +  IGRKV+++
Sbjct  44   VPMSRPGFGSRGKSIQLTTNHFKVGVKISDGYFFHYSIDMFYEDGTPVTANAIGRKVVEK  103

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
            V +TYD +L  KEFAYDG+K+LFTVG+LP  +L+F VVL+ ++S+R  GN
Sbjct  104  VKETYDRDLGRKEFAYDGQKNLFTVGSLPHKRLDFVVVLDNISSSRRIGN  153



>ref|XP_010694897.1| PREDICTED: protein argonaute 4A-like [Beta vulgaris subsp. vulgaris]
Length=930

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RLPM R G GSKGQKI ++TNHF+V +  +DGHF+ YSV + YEDG  V++KGIGR+VLD
Sbjct  53   RLPMVRCGLGSKGQKIQLITNHFQVKMPNSDGHFYQYSVKMSYEDGTAVEAKGIGRRVLD  112

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN  573
            ++H+TY++EL GK FAYDG+K+LFT+GALP  K++F V+LE+  SN
Sbjct  113  KLHETYESELGGKHFAYDGDKTLFTLGALPCTKVDFDVILEDQQSN  158



>ref|XP_010497367.1| PREDICTED: protein argonaute 8-like, partial [Camelina sativa]
Length=235

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSK-NDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPMARRG GSKG KI +LTNHF+VN S     HFFHYSVA+ YEDG PV +K IGRK+L+
Sbjct  25   LPMARRGNGSKGDKIHLLTNHFRVNFSNPTCQHFFHYSVAITYEDGSPVIAKSIGRKILE  84

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRN  579
            +V  TY T+L  K F YDG+++L+TVG LPR+KL+F+VVLE+  S RN
Sbjct  85   KVQQTYQTDLDFKHFVYDGDQNLYTVGPLPRSKLDFSVVLEDAPSRRN  132



>ref|XP_008803511.1| PREDICTED: LOW QUALITY PROTEIN: protein argonaute 16-like [Phoenix 
dactylifera]
Length=906

 Score =   147 bits (370),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMARRGFGS G+ I +L+NHF V  +  D  F+HYS  +  ED   V +KG+GRK++D
Sbjct  40   RSPMARRGFGSDGRHIQLLSNHFSVRFTAQDAVFYHYSATIKSEDKHAVVAKGMGRKIMD  99

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS-PGSPNE  612
            +++ TY +ELAGKEFAYDGEKSLFT+G LP+N  EFTVVLEE + +R  G  S   SP+E
Sbjct  100  KLYQTYSSELAGKEFAYDGEKSLFTIGPLPQNNFEFTVVLEESSVSRVAGVSSGNASPSE  159

Query  613  GDK  621
            GD+
Sbjct  160  GDR  162



>emb|CDY16587.1| BnaC09g36860D [Brassica napus]
Length=882

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            L MAR G GS+GQKI +LTNHF VN +    HFF YSVA+ YEDG PV++KGIGRK+L +
Sbjct  9    LQMARSGNGSRGQKIDLLTNHFGVNFTSKSQHFFQYSVAITYEDGNPVEAKGIGRKILAK  68

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS  594
            V +TY T+L  K FAYDG+K+LFTVG LP NKL+F+VVLE+++  R+N + S
Sbjct  69   VQETYQTDLGSKHFAYDGDKTLFTVGPLPNNKLDFSVVLEDMSCTRSNTSTS  120



>ref|XP_006652094.1| PREDICTED: protein argonaute 4B-like [Oryza brachyantha]
Length=911

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR G G KGQ I +  NH+KV+V   +  FFHY+V L YED R VD KG+GRKV+D
Sbjct  43   RFPMARPGLGKKGQPIQLYANHYKVSVKSTEEFFFHYNVILKYEDDRLVDGKGVGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY +EL+ KEFAYDGEKSLFT+GALP+   EFTVVLE+VT+ +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKEFAYDGEKSLFTIGALPQVNNEFTVVLEDVTTGKTAANGSPGGSDSP  162

Query  607  NEGDK  621
               D+
Sbjct  163  GGSDR  167



>emb|CAN61334.1| hypothetical protein VITISV_044457 [Vitis vinifera]
Length=855

 Score =   145 bits (365),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKN---DGHFFHYSVALYYEDGRPVDSKGIGRK  426
            RLPMARRG G  G+ I ++ NHFKV++  N     HF+ Y+V+L  EDG P D+K IGRK
Sbjct  137  RLPMARRGLGRTGETIQLVXNHFKVSMHSNANTGAHFYQYNVSLAXEDGHPADAKDIGRK  196

Query  427  VLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSP  606
            V+D+VH+TY TE+A   FAYDGEKSLFT+G+LP  KL FTVVLE+ +SNR +   +   P
Sbjct  197  VMDKVHETYHTEMAXMSFAYDGEKSLFTIGSLPSKKLRFTVVLEDASSNRISTXRNIDXP  256

Query  607  NEG  615
            ++G
Sbjct  257  DDG  259



>ref|XP_003617098.1| Protein argonaute 4A [Medicago truncatula]
Length=929

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 94/144 (65%), Gaps = 31/144 (22%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSV---------------------  372
            + PMARRG G+KG K+P+LTNHF+VNV+  +  FF YSV                     
Sbjct  38   KAPMARRGLGTKGAKLPLLTNHFEVNVANTNRVFFQYSVCFVFYDSVVFLRTFVLIFLFV  97

Query  373  ---------ALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALP  525
                     AL+YEDGRPV+ KG GRK++D+V +TYD+EL GK+ AYDGE +LFT+G+L 
Sbjct  98   GSYYVFVQVALFYEDGRPVEGKGAGRKIIDKVQETYDSELNGKDLAYDGE-TLFTIGSLA  156

Query  526  RNKLEFTVVLEEVTSNRNNGNCSP  597
            + KLEF VV+E+V SNRNN N SP
Sbjct  157  QKKLEFIVVVEDVASNRNNANTSP  180



>ref|NP_001169445.1| argonaute104 [Zea mays]
 gb|ACN33790.1| unknown [Zea mays]
 gb|AFW79427.1| argonaute104 [Zea mays]
Length=560

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>gb|AFW79428.1| argonaute104 [Zea mays]
Length=633

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>gb|EEC70394.1| hypothetical protein OsI_01365 [Oryza sativa Indica Group]
Length=706

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 96/127 (76%), Gaps = 5/127 (4%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            +LPM+R+GFG++GQ I +LTN+F+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTRGQSIQLLTNYFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN-RNNGNCSP----G  600
            ++ +TY +ELAG+EFAYDGEK LFT GAL + K +F VV+E+ +S+ R     SP    G
Sbjct  67   KLQETYASELAGREFAYDGEKGLFTAGALLQTKHQFVVVMEDASSSGRTTTRRSPGGDDG  126

Query  601  SPNEGDK  621
            SP   D+
Sbjct  127  SPRGSDR  133



>ref|XP_008375508.1| PREDICTED: protein argonaute 4A-like [Malus domestica]
Length=1226

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            +PM+R GFGS+G+ I + TNHFKV V  +DG+FFHYS+ ++YEDG PV +  IGRKV+++
Sbjct  357  VPMSRPGFGSRGKNIQLTTNHFKVGVKISDGYFFHYSIDMFYEDGTPVTANAIGRKVVEK  416

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
            V +TYD +L  KEFAYDG+K+LFTVG+LP  +L+F VVL+ ++S+R  GN
Sbjct  417  VKETYDRDLGRKEFAYDGQKNLFTVGSLPHKRLDFVVVLDNISSSRRIGN  466



>ref|XP_008648109.1| PREDICTED: argonaute104 isoform X5 [Zea mays]
Length=890

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_008648106.1| PREDICTED: argonaute104 isoform X2 [Zea mays]
Length=917

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_008648107.1| PREDICTED: argonaute104 isoform X3 [Zea mays]
 gb|AFW79429.1| argonaute104 [Zea mays]
Length=910

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_003598353.1| Protein argonaute 4A [Medicago truncatula]
 gb|AES68604.1| eukaryotic translation initiation factor 2c, putative [Medicago 
truncatula]
Length=876

 Score =   142 bits (358),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            +PMARRG GSKG KI +L NHF+V +SKNDG+F+HY+VAL Y+DG  V+ KG+GRKV+D+
Sbjct  19   VPMARRGLGSKGAKIQLLANHFRVGLSKNDGYFYHYNVALCYQDGHAVEVKGVGRKVIDK  78

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  618
            + +TYD  L  K FAYDGEKSLFT+ +L   K EF VVLEEV+S R   N     P+E  
Sbjct  79   LCETYDV-LRNKNFAYDGEKSLFTLRSLHHKKQEFIVVLEEVSSTRVGSN-----PSEAT  132

Query  619  K  621
            K
Sbjct  133  K  133



>ref|XP_008648104.1| PREDICTED: argonaute104 isoform X1 [Zea mays]
 ref|XP_008648105.1| PREDICTED: argonaute104 isoform X1 [Zea mays]
Length=940

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_008648108.1| PREDICTED: argonaute104 isoform X4 [Zea mays]
Length=901

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED RPVD KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQPTQLYSNHFKVAVKSTEDVFFHYYVNLKYEDDRPVDGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+ K EFTVVLE+V++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKKNEFTVVLEDVSTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_010252577.1| PREDICTED: protein argonaute 16 isoform X2 [Nelumbo nucifera]
Length=857

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LP+ R GFG +G++I +LTNHFKV     DG FF YSV++  +D R V+ KGIGRKV+D+
Sbjct  32   LPIRRSGFGKEGRRISLLTNHFKVTFGAMDGIFFQYSVSIISDDKRAVEGKGIGRKVIDK  91

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  618
            ++ TY +E  GK FAYDGEKSL+TVG+LP+N  EFTVVLEE +  RN      GSP EGD
Sbjct  92   LYQTYASEFEGKTFAYDGEKSLYTVGSLPQNNFEFTVVLEESSFKRN------GSPTEGD  145

Query  619  K  621
            +
Sbjct  146  R  146



>ref|XP_010252575.1| PREDICTED: protein argonaute 16 isoform X1 [Nelumbo nucifera]
 ref|XP_010252576.1| PREDICTED: protein argonaute 16 isoform X1 [Nelumbo nucifera]
Length=893

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            LP+ R GFG +G++I +LTNHFKV     DG FF YSV++  +D R V+ KGIGRKV+D+
Sbjct  32   LPIRRSGFGKEGRRISLLTNHFKVTFGAMDGIFFQYSVSIISDDKRAVEGKGIGRKVIDK  91

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGD  618
            ++ TY +E  GK FAYDGEKSL+TVG+LP+N  EFTVVLEE +  RN      GSP EGD
Sbjct  92   LYQTYASEFEGKTFAYDGEKSLYTVGSLPQNNFEFTVVLEESSFKRN------GSPTEGD  145

Query  619  K  621
            +
Sbjct  146  R  146



>dbj|BAD81109.1| zwille protein -like [Oryza sativa Japonica Group]
Length=879

 Score =   142 bits (357),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/106 (57%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            +LPM+R+GFG++GQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  7    KLPMSRKGFGTRGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  66

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN  573
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+ +S+
Sbjct  67   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSS  112



>ref|XP_006644052.1| PREDICTED: protein argonaute 4A-like [Oryza brachyantha]
Length=905

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  M R G+G KGQ I +LTNHFKV++   D  F+HY V L YED RPVD KG+GRKV+D
Sbjct  37   RALMPRAGYGKKGQPIQLLTNHFKVSLKTTDEFFYHYYVNLKYEDDRPVDGKGVGRKVID  96

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNE  612
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EFTVVLE+V + ++  N  SPG+ + 
Sbjct  97   KLQQTYASELANKDFAYDGEKSLFTIGALPQVNNEFTVVLEDVNTGKSAANGGSPGNESP  156

Query  613  GD  618
            G+
Sbjct  157  GN  158



>tpg|DAA54155.1| TPA: hypothetical protein ZEAMMB73_367489, partial [Zea mays]
Length=161

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            + R GFG KGQ I ++TNHFKV++   +  F+HY V L YED  PVD KG GRKV++++ 
Sbjct  39   VQRNGFGRKGQPIKLITNHFKVSLVNAEEFFYHYYVNLKYEDDTPVDRKGSGRKVIEKLQ  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
             TY  ELA K+FAYDGEKSLFT+GALP+ K EFTVV+E+ ++ +   N SPG+
Sbjct  99   QTYAAELANKDFAYDGEKSLFTIGALPQVKNEFTVVVEDFSTGKTPANGSPGN  151



>ref|XP_004298218.1| PREDICTED: protein argonaute 4A-like [Fragaria vesca subsp. vesca]
Length=888

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G GS+GQ+IP+LTNHF+V ++K+   F+HYS+A+ Y+DG PVD K +GRKVLD
Sbjct  25   RVPMRRPGLGSRGQRIPLLTNHFQVGMNKSKDDFYHYSIAMQYDDGTPVDGKCVGRKVLD  84

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
            +V + Y  ELA KEFAYDGEK+LFT G LP  +LEF +VL++++++ + G+
Sbjct  85   KVKEVYGKELAYKEFAYDGEKTLFTGGQLPHKRLEFMIVLDDISASTSGGS  135



>sp|Q5NBN9.2|AGO15_ORYSJ RecName: Full=Protein argonaute 15; Short=OsAGO15 [Oryza sativa 
Japonica Group]
Length=889

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            +LPM+R+GFG++GQ I +LTNHF+V+V + DGHF+HY V + YEDG PV++KG+ R+V+D
Sbjct  19   KLPMSRKGFGTRGQSIQLLTNHFRVSVRRMDGHFYHYHVEVKYEDGGPVEAKGVCRRVVD  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSN  573
            ++ +TY +ELAG+EFAY+GEK LFT GAL + K +F VV+E+ +S+
Sbjct  79   KLQETYASELAGREFAYNGEKGLFTAGALLQTKHQFVVVMEDASSS  124



>ref|XP_004960964.1| PREDICTED: protein argonaute 4B-like isoform X2 [Setaria italica]
Length=872

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G G KGQ I + +NHFKV+V   +  F HY V L YED RPV+ KGIGRKV+D
Sbjct  43   RVPMVRPGIGRKGQSIQLYSNHFKVSVKSTEDFFVHYHVNLKYEDDRPVEGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY +EL+ K+FAYDGEKSLFTVG LP    EFTVVLE+  + +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKDFAYDGEKSLFTVGELPHKNNEFTVVLEDAATGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_004960963.1| PREDICTED: protein argonaute 4B-like isoform X1 [Setaria italica]
Length=910

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+PM R G G KGQ I + +NHFKV+V   +  F HY V L YED RPV+ KGIGRKV+D
Sbjct  43   RVPMVRPGIGRKGQSIQLYSNHFKVSVKSTEDFFVHYHVNLKYEDDRPVEGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY +EL+ K+FAYDGEKSLFTVG LP    EFTVVLE+  + +   N SPG   SP
Sbjct  103  KLQQTYHSELSNKDFAYDGEKSLFTVGELPHKNNEFTVVLEDAATGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|NP_001042722.1| Os01g0275600 [Oryza sativa Japonica Group]
 sp|Q9SDG8.1|AGO4A_ORYSJ RecName: Full=Protein argonaute 4A; Short=OsAGO4a [Oryza sativa 
Japonica Group]
 dbj|BAA88176.1| putative zwille protein [Oryza sativa Japonica Group]
 dbj|BAF04636.1| Os01g0275600 [Oryza sativa Japonica Group]
Length=904

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  330
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  2    ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  61

Query  331  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  510
            ++   D  F HY V L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  62   SLKAADEFFHHYYVNLKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  121

Query  511  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEGD  618
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G+
Sbjct  122  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGN  158



>ref|XP_003576965.2| PREDICTED: protein argonaute 16 [Brachypodium distachyon]
Length=888

 Score =   140 bits (352),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  MAR GFG +G+ I +++NHF V +S+ D  F+ YSV++  +D + VD KGIGRKV+D
Sbjct  25   RTAMARPGFGREGKPIRLMSNHFAVKLSRTDAVFYQYSVSIKSDDDKVVDGKGIGRKVID  84

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S     +   GSP  G
Sbjct  85   KMLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAVGRSPEHGSPGLG  144

Query  616  DK  621
            DK
Sbjct  145  DK  146



>ref|XP_010657243.1| PREDICTED: protein argonaute 16 [Vitis vinifera]
Length=904

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RRG G+ G++I +LTNHFKV+++ +D  F+ YSV++  ED R VD KGIGRKV+DR++
Sbjct  38   ISRRGVGTAGRRISLLTNHFKVSMNISDAMFYQYSVSITSEDKRVVDGKGIGRKVIDRLY  97

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
             TY +ELAGK+FAYDGEKSL+TVG LP+N  EFTVV+EE+ +   NG  SPG+
Sbjct  98   LTYSSELAGKKFAYDGEKSLYTVGPLPQNNFEFTVVVEELLARSANG--SPGA  148



>ref|XP_006289242.1| hypothetical protein CARUB_v10002706mg [Capsella rubella]
 gb|EOA22140.1| hypothetical protein CARUB_v10002706mg [Capsella rubella]
Length=861

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVS---KNDGHFFHYSVALYYEDGRPVDSKGIGRKV  429
            LP++RRG GS G+KI +LTNHF V+ S    N  +FFHYSVA+ YE+G PV +KG+GR++
Sbjct  23   LPLSRRGHGSNGRKINLLTNHFSVDFSIRELNSQYFFHYSVAITYENGSPVMTKGVGRRI  82

Query  430  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRN  579
            L++V  TY T+L  K FAYDG+KSLFTVG LPR+KL+F+VVLE+V S RN
Sbjct  83   LEKVQQTYQTDLDFKHFAYDGDKSLFTVGPLPRSKLDFSVVLEDVPSRRN  132



>ref|NP_001167850.1| putative argonaute family protein [Zea mays]
 ref|XP_008655164.1| PREDICTED: putative argonaute family protein isoform X1 [Zea 
mays]
 ref|XP_008655165.1| PREDICTED: putative argonaute family protein isoform X1 [Zea 
mays]
 gb|ACN26293.1| unknown [Zea mays]
 gb|AFW79548.1| putative argonaute family protein [Zea mays]
Length=898

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            + R GFG KGQ+I ++TNHFKV++ K +  F+HY V L YED  PVD KG GRKV++++ 
Sbjct  39   VQRNGFGRKGQQIKLITNHFKVSLMKAEDFFYHYYVNLKYEDDTPVDRKGSGRKVIEKLQ  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPNEGD  618
             TY  ELA K+FAYDGEKSLFT+GALP+ K+EFTVV E+V++ +   N SPG  SP   D
Sbjct  99   QTYAAELANKDFAYDGEKSLFTIGALPQVKMEFTVVDEDVSTGKTPANGSPGNDSPPGSD  158

Query  619  K  621
            +
Sbjct  159  R  159



>gb|EEE66926.1| hypothetical protein OsJ_23783 [Oryza sativa Japonica Group]
Length=863

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 6/122 (5%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR  FG +G++I +L+NHF V +S  D      +V++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGID------AVSIKSEDDKVIDGKGIGRKVMD  72

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  73   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  132

Query  616  DK  621
            DK
Sbjct  133  DK  134



>gb|EEC81834.1| hypothetical protein OsI_25587 [Oryza sativa Indica Group]
Length=863

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 6/122 (5%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR  FG +G++I +L+NHF V +S  D      +V++  ED + +D KGIGRKV+D
Sbjct  19   RVPIARPSFGREGKQIKLLSNHFTVKLSGID------AVSIKSEDDKVIDGKGIGRKVMD  72

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            +V  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSPN+G
Sbjct  73   KVLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSLGHGSPNQG  132

Query  616  DK  621
            DK
Sbjct  133  DK  134



>ref|XP_010230772.1| PREDICTED: protein argonaute 4A [Brachypodium distachyon]
Length=924

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  ++R GFG  G+ I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  55   RTLISRPGFGKNGKPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  114

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN  609
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG+ N
Sbjct  115  KLQQTYASELAHKDFAYDGEKSLFTIGALPQVNNEFVVVLEDVSSGKTAANGSPGNDN  172



>gb|AGB34311.1| Argonaute [Triticum aestivum]
Length=916

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  110

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG
Sbjct  111  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPG  165



>gb|EMS68540.1| Protein argonaute 4A [Triticum urartu]
Length=916

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  110

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG
Sbjct  111  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPG  165



>ref|XP_004967701.1| PREDICTED: protein argonaute 4A-like [Setaria italica]
Length=902

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+ + R+GFG KGQ I ++TNHFKV++   +  FFHY V L YED  PVD KG GR V++
Sbjct  37   RVLVPRKGFGKKGQPIRLVTNHFKVSLKNTEEFFFHYYVNLKYEDDTPVDRKGAGRSVIE  96

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG--SPN  609
            ++  TY TELA K+FAYDGEKSLFT+GALP+   EFTVV+E+V++ +   N SPG  SP 
Sbjct  97   KLQQTYATELANKDFAYDGEKSLFTIGALPQVNNEFTVVVEDVSTGKTPANGSPGNDSPP  156

Query  610  EGDK  621
              D+
Sbjct  157  GSDR  160



>gb|KDO59554.1| hypothetical protein CISIN_1g002661mg [Citrus sinensis]
Length=895

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +LTNHFKV+V+  D  F+HY+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGS  143



>ref|XP_004956340.1| PREDICTED: protein argonaute 16-like isoform X1 [Setaria italica]
Length=882

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR   G +G+ I +L+NHF V ++  D  F+ YSV++  ED + VD KGIGRKV+D
Sbjct  19   RTPMARPSIGREGKPIRLLSNHFAVKLNGVDAVFYQYSVSIKSEDDKVVDGKGIGRKVID  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSP++ 
Sbjct  79   KLLQTYSSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAVGGSPGHGSPSQA  138

Query  616  DK  621
            DK
Sbjct  139  DK  140



>gb|AGO99010.1| argonaute 4, partial [Triticum aestivum]
Length=969

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V L YED RPVD KG+GRKV+D
Sbjct  104  RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVNLKYEDDRPVDGKGVGRKVID  163

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            ++  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE+V+S +   N SPG
Sbjct  164  KLAQTYPSELAHKDFAYDGEKSLFTIGALPQINNEFVVVLEDVSSGKTPANGSPG  218



>gb|KDO59555.1| hypothetical protein CISIN_1g002661mg [Citrus sinensis]
Length=832

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +LTNHFKV+V+  D  F+HY+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYHYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGS  143



>ref|XP_004156089.1| PREDICTED: protein argonaute 16-like [Cucumis sativus]
Length=903

 Score =   137 bits (344),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YEDGRPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDGRPVEGKDIGRKLMDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLE  558
             TY TELA K FAYDGEK L+T+G LP+ KLEF+VVLE
Sbjct  99   QTYSTELANKRFAYDGEKCLYTIGPLPQKKLEFSVVLE  136



>ref|XP_004140126.1| PREDICTED: protein argonaute 16-like [Cucumis sativus]
 gb|KGN47971.1| hypothetical protein Csa_6G421650 [Cucumis sativus]
Length=904

 Score =   137 bits (344),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YEDGRPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDGRPVEGKDIGRKLMDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLE  558
             TY TELA K FAYDGEK L+T+G LP+ KLEF+VVLE
Sbjct  99   QTYSTELANKRFAYDGEKCLYTIGPLPQKKLEFSVVLE  136



>emb|CBI28870.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RRG G+ G++I +LTNHFKV+++ +D  F+ YSV++  ED R VD KGIGRKV+DR++
Sbjct  53   ISRRGVGTAGRRISLLTNHFKVSMNISDAMFYQYSVSITSEDKRVVDGKGIGRKVIDRLY  112

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRN  579
             TY +ELAGK+FAYDGEKSL+TVG LP+N  EFTVV+EE+ + R+
Sbjct  113  LTYSSELAGKKFAYDGEKSLYTVGPLPQNNFEFTVVVEELLARRH  157



>ref|XP_008449486.1| PREDICTED: protein argonaute 16 [Cucumis melo]
Length=904

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG GSKG++IP+LTNHF+V+++  D  F+ Y+V++ YED RPV+ K IGRK++D+++
Sbjct  39   MSRRGVGSKGRRIPLLTNHFRVSLNAPDLVFYQYAVSICYEDSRPVEGKEIGRKLMDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNC-SPGSPN  609
             T+ TELA K FAYDGEK L+T+G LP+ KLEF+VVLE   +    G+    GSPN
Sbjct  99   QTHSTELANKRFAYDGEKCLYTIGPLPQRKLEFSVVLEGFCAKIETGSSGESGSPN  154



>ref|NP_197602.2| protein argonaute 8 [Arabidopsis thaliana]
 sp|Q3E984.1|AGO8_ARATH RecName: Full=Protein argonaute 8 [Arabidopsis thaliana]
 gb|AED92921.1| protein argonaute 8 [Arabidopsis thaliana]
Length=850

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = +1

Query  259  LPMARRGFGSKGQKIPILTNHFKVNVSKNDGH-FFHYSVALYYEDGRPVDSKGIGRKVLD  435
            LPM RRG GSKGQKI +LTNHF+VN  K + H FFHYSV + YEDG P+ +KG GRK+L+
Sbjct  23   LPMTRRGNGSKGQKILLLTNHFRVNFRKPNSHNFFHYSVTITYEDGSPLLAKGFGRKILE  82

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRN  579
            +V  T   +L  K FAYDG+K+L+TVG LPR+ L+F+VVLE   S RN
Sbjct  83   KVQQTCQADLGCKHFAYDGDKNLYTVGPLPRSSLDFSVVLETAPSRRN  130



>ref|XP_002440386.1| hypothetical protein SORBIDRAFT_09g030910 [Sorghum bicolor]
 gb|EES18816.1| hypothetical protein SORBIDRAFT_09g030910 [Sorghum bicolor]
Length=909

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 85/125 (68%), Gaps = 3/125 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            RL M R G G KGQ   + +NHFKV V   +  FFHY V L YED +PV+ KGIGRKV+D
Sbjct  43   RLLMDRPGIGRKGQLAQLYSNHFKVAVKSTEDFFFHYYVNLKYEDDQPVEGKGIGRKVID  102

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG---SP  606
            ++  TY  EL+ K+FAYDGEKSLFTVG LP+   EFTVVLE+ ++ +   N SPG   SP
Sbjct  103  KLQQTYRAELSNKDFAYDGEKSLFTVGGLPQKNNEFTVVLEDASTGKTAANGSPGGNDSP  162

Query  607  NEGDK  621
              GD+
Sbjct  163  GGGDR  167



>ref|XP_006447661.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 ref|XP_006469599.1| PREDICTED: protein argonaute 16-like isoform X2 [Citrus sinensis]
 ref|XP_006469600.1| PREDICTED: protein argonaute 16-like isoform X3 [Citrus sinensis]
 ref|XP_006469601.1| PREDICTED: protein argonaute 16-like isoform X4 [Citrus sinensis]
 gb|ESR60901.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=895

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  36   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  95

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+
Sbjct  96   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGS  143



>ref|XP_006447660.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 ref|XP_006469598.1| PREDICTED: protein argonaute 16-like isoform X1 [Citrus sinensis]
 gb|ESR60900.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=898

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  39   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+
Sbjct  99   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGS  146



>ref|XP_006447659.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
 gb|ESR60899.1| hypothetical protein CICLE_v10014201mg [Citrus clementina]
Length=835

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +LTNHFKV+V+  D  F+ Y+V +  ED R    KGIGRKV+D+++
Sbjct  39   MSRRGVGNCGRRISLLTNHFKVSVNTTDAVFYQYTVTISGEDKRIAKGKGIGRKVVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY  ELAGK FAYDGEKSL+TVG LP+NK EFTVVLEE  + + NG+
Sbjct  99   QTYSAELAGKRFAYDGEKSLYTVGPLPQNKFEFTVVLEESRAKQQNGS  146



>ref|XP_008379693.1| PREDICTED: protein argonaute 16 [Malus domestica]
 ref|XP_008379694.1| PREDICTED: protein argonaute 16 [Malus domestica]
Length=899

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +L NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++
Sbjct  40   MSRRGTGTTGKEINLLANHFKVSVNVPDAVFYQYSVSITSEDKKVVEGKGIGRKLIDRLY  99

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL GK+FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+
Sbjct  100  QTYSSELGGKKFAYDGEKALYTVGPLPQNKLEFTVVLEETFAKHENGS  147



>ref|XP_002320489.2| PAZ domain-containing family protein [Populus trichocarpa]
 gb|EEE98804.2| PAZ domain-containing family protein [Populus trichocarpa]
Length=869

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RRG G+ G+ I +LTNHFKV+V+  D  F+ Y+V++  ED R V+SKGIGRK++DR++
Sbjct  2    ISRRGVGTSGRHISLLTNHFKVSVNVPDAVFYQYNVSITSEDNRAVESKGIGRKLIDRLY  61

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
             TY +E AGK FAYDGEKSL+TVG LP+NK EFTVVLEE  +   +G  SPG
Sbjct  62   QTYSSEFAGKRFAYDGEKSLYTVGPLPQNKSEFTVVLEESFAKHESG--SPG  111



>ref|XP_006661042.1| PREDICTED: protein argonaute 16-like [Oryza brachyantha]
Length=909

 Score =   133 bits (335),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R+P+AR  FG +G++I +L+NHF V +S  D  F+ Y V++  ED + +D KGIGRKV+D
Sbjct  46   RVPIARPSFGHEGKQIKLLSNHFTVKLSGIDAIFYQYCVSIKSEDDKVIDGKGIGRKVMD  105

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +ELAGKEFAYDGEK LFTVG LP+N  EFTV+LEE +S    G+   GSP +G
Sbjct  106  KLLQTYSSELAGKEFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPGHGSPGQG  165

Query  616  DK  621
            DK
Sbjct  166  DK  167



>gb|KDP30816.1| hypothetical protein JCGZ_13759 [Jatropha curcas]
Length=896

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R GFG+ G++IP+LTNHFKV+V  +D  F+ Y+V++  ED + V+ KGIGRK++DR++
Sbjct  30   ISRHGFGTSGRRIPLLTNHFKVSVRVSDAVFYQYTVSITSEDKQVVEGKGIGRKLIDRLY  89

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNN  582
             TY +EL GK FAYDGEKSL+TVG LP+NK EFTV+LEE  +   N
Sbjct  90   QTYSSELGGKMFAYDGEKSLYTVGPLPQNKFEFTVLLEESFAKHQN  135



>ref|XP_010035502.1| PREDICTED: protein argonaute 16-like [Eucalyptus grandis]
 gb|KCW46920.1| hypothetical protein EUGRSUZ_K00735 [Eucalyptus grandis]
Length=904

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R G GS G++I +LTNHFKV+V+  D  F+ YSV++  ED R V+ KGIGRK++D+++
Sbjct  40   ISRGGIGSAGRQISLLTNHFKVSVNVPDAVFYQYSVSITSEDTRAVEGKGIGRKLIDKLY  99

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG-SPNEGDK  621
             TY +ELAGK+FAYDGEK+L+TVG LP+NKL+FTVVLE+  + R + +   G SPN   K
Sbjct  100  QTYSSELAGKKFAYDGEKTLYTVGPLPQNKLQFTVVLEDSFAKRESESVGGGESPNGSTK  159



>ref|XP_009418523.1| PREDICTED: protein argonaute 16-like [Musa acuminata subsp. malaccensis]
Length=896

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYE--DGRPVDSKGIGRKV  429
            RLPMAR  FG++G+ + +LTNHF V  +K D  F+HYSV + ++  D     SKG GRKV
Sbjct  37   RLPMARPAFGTEGRPVQLLTNHFNVKFTKQDTVFYHYSVNISHDKSDENHAHSKGFGRKV  96

Query  430  LDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPN  609
            LDR++ TY +E  GK+FAYDGEKSLFTVG LP+N  EFTVVLE+ ++    G+ S  S  
Sbjct  97   LDRLYQTYRSEFEGKQFAYDGEKSLFTVGPLPQNNFEFTVVLEDSSARATGGDPSGDSLG  156

Query  610  EGDK  621
            EGD+
Sbjct  157  EGDQ  160



>ref|XP_009365125.1| PREDICTED: protein argonaute 16 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009365126.1| PREDICTED: protein argonaute 16 isoform X1 [Pyrus x bretschneideri]
Length=902

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +L NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++
Sbjct  39   MSRRGTGTTGKEINLLANHFKVSVNVPDAVFYQYSVSITSEDKKVVEGKGIGRKLIDRLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL  K FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+
Sbjct  99   QTYSSELGCKMFAYDGEKALYTVGPLPQNKLEFTVVLEETFAKHENGS  146



>ref|XP_009365127.1| PREDICTED: protein argonaute 16 isoform X2 [Pyrus x bretschneideri]
Length=898

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +L NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++
Sbjct  39   MSRRGTGTTGKEINLLANHFKVSVNVPDAVFYQYSVSITSEDKKVVEGKGIGRKLIDRLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL  K FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+
Sbjct  99   QTYSSELGCKMFAYDGEKALYTVGPLPQNKLEFTVVLEETFAKHENGS  146



>ref|XP_008651670.1| PREDICTED: uncharacterized protein LOC100382704 isoform X2 [Zea 
mays]
Length=901

 Score =   130 bits (328),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  50   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  110  KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  169

Query  616  DK  621
            +K
Sbjct  170  NK  171



>ref|XP_008651669.1| PREDICTED: uncharacterized protein LOC100382704 isoform X1 [Zea 
mays]
Length=912

 Score =   130 bits (328),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  50   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  109

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  110  KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  169

Query  616  DK  621
            +K
Sbjct  170  NK  171



>ref|XP_009365128.1| PREDICTED: protein argonaute 16 isoform X3 [Pyrus x bretschneideri]
Length=859

 Score =   130 bits (327),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+RRG G+ G++I +L NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++
Sbjct  39   MSRRGTGTTGKEINLLANHFKVSVNVPDAVFYQYSVSITSEDKKVVEGKGIGRKLIDRLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL  K FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+
Sbjct  99   QTYSSELGCKMFAYDGEKALYTVGPLPQNKLEFTVVLEETFAKHENGS  146



>ref|XP_007049194.1| Eukaryotic translation initiation factor 2c, putative isoform 
1 [Theobroma cacao]
 gb|EOX93351.1| Eukaryotic translation initiation factor 2c, putative isoform 
1 [Theobroma cacao]
Length=903

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R G G +G+ I +LTNHFKV+V+  D  F+ Y+V +  ED R V+SKGIGRK+LD+++
Sbjct  41   VSRLGVGMRGRHISLLTNHFKVSVNATDAVFYQYTVTISSEDNRAVESKGIGRKLLDKLY  100

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS-PGSP  606
             TY +ELAGK FAYDGEKSL+TVG LP+ K +FT+VLEE  + R  G+    GSP
Sbjct  101  QTYSSELAGKRFAYDGEKSLYTVGPLPQKKFDFTIVLEESFAKREIGSLDGDGSP  155



>ref|XP_007049195.1| Eukaryotic translation initiation factor 2c, putative isoform 
2 [Theobroma cacao]
 gb|EOX93352.1| Eukaryotic translation initiation factor 2c, putative isoform 
2 [Theobroma cacao]
Length=904

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R G G +G+ I +LTNHFKV+V+  D  F+ Y+V +  ED R V+SKGIGRK+LD+++
Sbjct  41   VSRLGVGMRGRHISLLTNHFKVSVNATDAVFYQYTVTISSEDNRAVESKGIGRKLLDKLY  100

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS-PGSP  606
             TY +ELAGK FAYDGEKSL+TVG LP+ K +FT+VLEE  + R  G+    GSP
Sbjct  101  QTYSSELAGKRFAYDGEKSLYTVGPLPQKKFDFTIVLEESFAKREIGSLDGDGSP  155



>ref|XP_008651671.1| PREDICTED: uncharacterized protein LOC100382704 isoform X3 [Zea 
mays]
Length=881

 Score =   130 bits (327),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  19   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  79   KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  138

Query  616  DK  621
            +K
Sbjct  139  NK  140



>tpg|DAA60814.1| TPA: putative argonaute family protein [Zea mays]
Length=746

 Score =   129 bits (325),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R PMAR   G +G+ I +L+NHF V +   D  F+ YSV +  ED + VDSKGIGRKV+D
Sbjct  19   RTPMARPSNGREGKPIRLLSNHFSVKLRGVDAVFYQYSVCIKSEDDKVVDSKGIGRKVID  78

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEG  615
            ++  TY +EL GK+FAYDGEK LFTVG LP+N  EFTV+LEE +S    G+    SP + 
Sbjct  79   KLLQTYCSELDGKDFAYDGEKCLFTVGPLPQNNFEFTVILEETSSRAAGGSPVHESPTQA  138

Query  616  DK  621
            +K
Sbjct  139  NK  140



>gb|EMS52455.1| Protein argonaute 4B [Triticum urartu]
Length=1055

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +1

Query  265  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            MAR   GFG KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  73   MARPPNGFGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  132

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S +
Sbjct  133  LQHTYHSELANKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGK  178



>ref|XP_011007758.1| PREDICTED: protein argonaute 16 [Populus euphratica]
 ref|XP_011007759.1| PREDICTED: protein argonaute 16 [Populus euphratica]
 ref|XP_011007760.1| PREDICTED: protein argonaute 16 [Populus euphratica]
Length=910

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 2/112 (2%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RRG G+ G  I +LTNHFKV+V+  D  F+ Y V++  ED R V+SKGIGRK++DR++
Sbjct  43   ISRRGVGTSGHHISLLTNHFKVSVNVPDTVFYQYFVSITSEDNRAVESKGIGRKLIDRLY  102

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
             TY +E AGK FAYDGEKSL+TVG LP+NK EF VVLEE  +   +G  SPG
Sbjct  103  QTYSSEFAGKRFAYDGEKSLYTVGPLPQNKSEFRVVLEESFAKHESG--SPG  152



>ref|XP_011100483.1| PREDICTED: protein argonaute 16 isoform X2 [Sesamum indicum]
Length=901

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            + R GFG+ GQ+I +L NHF+V+V   D +F+ YSV++  E+   VDSK IGRKV D+++
Sbjct  38   ITRPGFGTSGQRISLLVNHFRVSVRYPDEYFYQYSVSISSENNSMVDSKVIGRKVTDKLY  97

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDK  621
             TY +EL+GK+FAYDGEK+L+TVG LP N  EFTVVLEE    R + + S GSPN+  K
Sbjct  98   QTYSSELSGKKFAYDGEKNLYTVGPLPHNNFEFTVVLEESIGKRGSPSHS-GSPNDSSK  155



>ref|XP_004304078.2| PREDICTED: protein argonaute 16-like [Fragaria vesca subsp. vesca]
 ref|XP_011467764.1| PREDICTED: protein argonaute 16-like [Fragaria vesca subsp. vesca]
Length=889

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  MAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRV  441
            M R RG G+ G++I + TNHFKV+V   D  F+ Y V + YED RPV+  GIGRK++D++
Sbjct  30   MVRPRGSGTTGRRIALSTNHFKVSVKNPDAVFYQYCVLITYEDKRPVEGMGIGRKLVDKL  89

Query  442  HDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            + TY +E AGK+FAYDGEK+L+TVG LPRNKLEFTV+L+E  +    G
Sbjct  90   YQTYTSEFAGKKFAYDGEKALYTVGPLPRNKLEFTVILDESFAKSETG  137



>gb|AHC30882.1| argonaute 6 protein [Dimocarpus longan]
Length=900

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  +A  G G+ G +I +LTNHFKV+V   D  F+ Y+V +  +D R V+ KGIGRK+LD
Sbjct  42   RRGVANNGVGNSGHRIGLLTNHFKVSVKAQDAVFYQYTVTISGDDKRSVEGKGIGRKLLD  101

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCS  594
            R++ TY  ELA  +FAYDGEKSL+TVGALP+N LEFTVVL+E  +   NG+ S
Sbjct  102  RLYQTYSAELAHNKFAYDGEKSLYTVGALPQNNLEFTVVLDESRAKLKNGSPS  154



>gb|EYU42875.1| hypothetical protein MIMGU_mgv1a001065mg [Erythranthe guttata]
Length=898

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            + R GFG+ G++I +L NHFKV+++  D  F+ YSVA+ +ED + V+SK +GRKV+D+++
Sbjct  38   ITRPGFGTSGKRISLLANHFKVSITNPDETFYQYSVAISFEDNKAVESKVLGRKVIDKLY  97

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEE  561
             TY +ELAGK FAYDG+ SL+TVG LP+N LE+TVVLEE
Sbjct  98   QTYSSELAGKRFAYDGDASLYTVGPLPQNNLEYTVVLEE  136



>gb|KJB10321.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=832

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEE  561
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLED  137



>gb|KJB10319.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=898

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEE  561
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLED  137



>ref|XP_003526363.1| PREDICTED: protein argonaute 4B-like [Glycine max]
Length=881

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKN----DGHFFHYSVALYYEDGRPVDSKGIGR  423
            R+PMAR+  GSKG+   +L NHF V + K     DG+F+HY VA+ YEDG PV++KG+GR
Sbjct  6    RVPMARKEVGSKGEPRQLLANHFGVCLVKPKDDIDGYFYHYDVAMSYEDGNPVEAKGVGR  65

Query  424  KVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
            KVL++V +TY  EL    FAYDGEKSLFT+G L   +L++ VVLE+V+S R   N +P  
Sbjct  66   KVLNQVCETY-VELRNMSFAYDGEKSLFTLGPLASQRLQYPVVLEDVSSRRVGKNGNPAE  124

Query  604  PNEG  615
              +G
Sbjct  125  SPKG  128



>gb|KJB10320.1| hypothetical protein B456_001G195700 [Gossypium raimondii]
Length=850

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++RR  G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRREVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVLSEDSRVVESKRIGRKLVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEE  561
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLED  137



>gb|AGO99012.1| argonaute 4, partial [Triticum aestivum]
Length=954

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  265  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            MAR   G G KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  88   MARPPNGLGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  147

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRN  579
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S + 
Sbjct  148  LQHTYHSELANKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGKT  194



>gb|KCW46921.1| hypothetical protein EUGRSUZ_K00736 [Eucalyptus grandis]
Length=880

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  271  RRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDT  450
            RRG GS G+ I +LTNHFKV+V+  D  F+ YSV+   E+ R V+ KGIGRK++D+++ T
Sbjct  35   RRGTGSAGRPINLLTNHFKVSVNVPDAVFYQYSVSFTSEERRDVEGKGIGRKLMDKLYQT  94

Query  451  YDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            Y +ELAGK+FAYDGEK+L+TVG LP+NKL  TVVLE+  + R + N   G
Sbjct  95   YSSELAGKKFAYDGEKTLYTVGPLPQNKLVLTVVLEDSFAKRESENLGGG  144



>ref|XP_010035500.1| PREDICTED: protein argonaute 16-like [Eucalyptus grandis]
Length=864

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  271  RRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDT  450
            RRG GS G+ I +LTNHFKV+V+  D  F+ YSV+   E+ R V+ KGIGRK++D+++ T
Sbjct  4    RRGTGSAGRPINLLTNHFKVSVNVPDAVFYQYSVSFTSEERRDVEGKGIGRKLMDKLYQT  63

Query  451  YDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPG  600
            Y +ELAGK+FAYDGEK+L+TVG LP+NKL  TVVLE+  + R + N   G
Sbjct  64   YSSELAGKKFAYDGEKTLYTVGPLPQNKLVLTVVLEDSFAKRESENLGGG  113



>gb|EMT11809.1| Protein argonaute 4B [Aegilops tauschii]
Length=1093

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +1

Query  265  MAR--RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDR  438
            MAR   G G KGQ I +L NH+KV+V  ++  F HY V L YED  PVDSKGIGRKVLD+
Sbjct  108  MARPPNGLGKKGQPIQLLANHYKVSVKPSEEFFNHYYVNLKYEDDTPVDSKGIGRKVLDK  167

Query  439  VHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
            +  TY +ELA K+FAYDGEKSLFT+GALP+   EF VVLE++ S +
Sbjct  168  LQHTYHSELADKDFAYDGEKSLFTIGALPQINNEFIVVLEDIGSGK  213



>gb|EMT20780.1| Protein argonaute 4A [Aegilops tauschii]
Length=1186

 Score =   125 bits (313),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 69/161 (43%), Positives = 88/161 (55%), Gaps = 39/161 (24%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALY------------------  381
            R  +AR GFG +G  I ++TNHFKV++   D  F HY V LY                  
Sbjct  51   RALIARPGFGKRGNPIQLVTNHFKVSLKTTDEFFHHYYVCLYPCLLYCMPLSSFTFIVVE  110

Query  382  ---------------------YEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEK  498
                                 YED RPVD KG+GRKV+D++  TY +ELA K+FAYDGEK
Sbjct  111  FLVLPSNVIPPLFNWMQVNLKYEDDRPVDGKGVGRKVIDKLAQTYPSELAHKDFAYDGEK  170

Query  499  SLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDK  621
            SLFT+GALP+   EF VVLE+V+S +   N SPG+ +   K
Sbjct  171  SLFTIGALPQINNEFVVVLEDVSSGKTPANGSPGNDSPDKK  211



>gb|EEC70395.1| hypothetical protein OsI_01366 [Oryza sativa Indica Group]
Length=871

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 101/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  151  EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  330
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  2    ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  61

Query  331  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  510
            N              L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  62   N--------------LKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  107

Query  511  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEGD  618
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G+
Sbjct  108  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGN  144



>emb|CDP05690.1| unnamed protein product [Coffea canephora]
Length=908

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 85/119 (71%), Gaps = 1/119 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R GFG  G+ I +LTNHF+V++   D  F+ Y+V++  E G+ VDSKGIGRK++D+++
Sbjct  36   ISRPGFGKTGRPISLLTNHFRVSLKHPDEIFYQYTVSISSELGKTVDSKGIGRKIMDKLY  95

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGSPNEGDK  621
              Y ++LAGK FAYDGEK+L+TVG LP N LEF VVLEE    R + +   GSP+E  K
Sbjct  96   QIYFSDLAGKRFAYDGEKALYTVGPLPHNNLEFPVVLEESMVKRGSPS-QTGSPSESGK  153



>gb|EAZ11413.1| hypothetical protein OsJ_01274 [Oryza sativa Japonica Group]
Length=997

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 101/157 (64%), Gaps = 15/157 (10%)
 Frame = +1

Query  151  EDNNGAAEALpppppvpSDFTPSkaeaeptkkkapRLPMARRGFGSKGQKIPILTNHFKV  330
            E N+G  E LPPPPP+P +  P K +      K  R  MAR G G KGQ I +LTNHFKV
Sbjct  109  ESNSGEIEELPPPPPLPPNAEPIKTDDTKKLSKPKRALMARSGCGKKGQPIQLLTNHFKV  168

Query  331  NVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEFAYDGEKSLFT  510
            N              L YED RPVD KGIGRKVLD++  TY +ELA K+FAYDGEKSLFT
Sbjct  169  N--------------LKYEDDRPVDGKGIGRKVLDKLQQTYASELANKDFAYDGEKSLFT  214

Query  511  VGALPRNKLEFTVVLEEVTSNRNNGN-CSPGSPNEGD  618
            +GALP+   EFTVVLE+  + +++ N  SPG+ + G+
Sbjct  215  IGALPQVNNEFTVVLEDFNTGKSSANGGSPGNDSPGN  251



>ref|XP_007217062.1| hypothetical protein PRUPE_ppa001137mg [Prunus persica]
 gb|EMJ18261.1| hypothetical protein PRUPE_ppa001137mg [Prunus persica]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+R G G+ GQ IP+L NHFKV+V+  D  F+ Y V +  ED   V+ KGIGRK++DR++
Sbjct  40   MSRCGTGTTGQTIPLLANHFKVSVNVPDAVFYQYFVRITSEDKIAVEGKGIGRKLIDRLY  99

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL GK+FAYDG+K+L+ +G LP+ +LEF+VVLEE  +   NGN
Sbjct  100  QTYSSELGGKKFAYDGDKALYILGPLPQRRLEFSVVLEETFAKHENGN  147



>ref|XP_008229810.1| PREDICTED: protein argonaute 16 [Prunus mume]
Length=898

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            M+R G G+ GQ IP+L NHFKV+V+  D  F+ Y V +  ED   V+ KGIGRK++DR++
Sbjct  40   MSRCGTGTTGQTIPLLANHFKVSVNVPDAVFYQYFVRITSEDKIAVEGKGIGRKLIDRLY  99

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGN  588
             TY +EL GK+FAYDG+K+L+T+G LP+ +LEF+VVLEE  +   NG+
Sbjct  100  QTYSSELGGKKFAYDGDKALYTLGPLPQRRLEFSVVLEETFAKHENGS  147



>ref|XP_011100478.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100479.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100480.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
 ref|XP_011100481.1| PREDICTED: protein argonaute 16 isoform X1 [Sesamum indicum]
Length=902

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            + R GFG+ GQ+I +L NHF+V+V   D +F+ YSV++  E+   VDSK IGRKV D+++
Sbjct  38   ITRPGFGTSGQRISLLVNHFRVSVRYPDEYFYQYSVSISSENNSMVDSKVIGRKVTDKLY  97

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
             TY +EL+GK+FAYDGEK+L+TVG LP N  EFTVVLEE    R
Sbjct  98   QTYSSELSGKKFAYDGEKNLYTVGPLPHNNFEFTVVLEESIGKR  141



>gb|KHG12030.1| hypothetical protein F383_20383 [Gossypium arboreum]
Length=898

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R   G+ G+KI +L NHFKV+V+  D  F+ Y+V +  ED R V+SK IGRK++D+++
Sbjct  39   VSRSEVGTSGRKISLLANHFKVSVNAPDAVFYQYTVTVSSEDSRVVESKRIGRKLVDKLY  98

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEE  561
             TY +ELAGK FAYDGEKSL+TVG LP+NK EFT+VLE+
Sbjct  99   QTYSSELAGKRFAYDGEKSLYTVGPLPQNKFEFTIVLED  137



>ref|XP_010110219.1| Protein argonaute 16 [Morus notabilis]
 gb|EXC25516.1| Protein argonaute 16 [Morus notabilis]
Length=900

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = +1

Query  301  IPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVHDTYDTELAGKEF  480
            IP++ NHFKV+V+  D  F+ YSV++  ED + V+ KGIGRK++DR++ TY  E +GK F
Sbjct  46   IPLVANHFKVSVNVPDAVFYQYSVSITLEDNKDVNVKGIGRKLIDRLYQTYSLEFSGKSF  105

Query  481  AYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSP---GSPNEGDK  621
            AYDGEKSL+TVG LP+ K EFTVVLEE  +   NG  SP   GSPNE  K
Sbjct  106  AYDGEKSLYTVGPLPQKKFEFTVVLEESFAKNENG--SPGFTGSPNESGK  153



>gb|EMS52406.1| Protein argonaute 4B [Triticum urartu]
Length=932

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVA----LYYEDGRPVDSKGIGR  423
            RLP AR G G +GQ I +L NH+KV++  ++  F HY V+    L YED +PV  KGIGR
Sbjct  44   RLPKARPGLGKRGQTIQLLANHYKVSMRSSEDFFHHYHVSILVNLKYEDDQPVVGKGIGR  103

Query  424  KVLDRVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEV  564
            KVLD++   Y +ELA  EFAYDGEKSLFT+GALP+   EFTVVLE++
Sbjct  104  KVLDKLQHMYRSELANNEFAYDGEKSLFTIGALPQVHNEFTVVLEDI  150



>ref|XP_002534129.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
 gb|EEF28257.1| eukaryotic translation initiation factor 2c, putative [Ricinus 
communis]
Length=863

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 89/131 (68%), Gaps = 12/131 (9%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R+GFG+ G +IP+L+NHFKV+++  D  F+ YSV+   ED R V+ KGIGRK+++R++
Sbjct  30   VSRQGFGNSGHRIPLLSNHFKVSINIPDAVFYQYSVSFTSEDDRVVEVKGIGRKLIERLY  89

Query  445  DTYDTELAGK-----------EFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNC  591
             TY T+L              +FAYDGEK+L+TVG LP+NKLEFTVVLEE  +   NG+ 
Sbjct  90   QTYYTDLGDTKFAYDGEKTLYKFAYDGEKTLYTVGPLPQNKLEFTVVLEESFAKHGNGSP  149

Query  592  -SPGSPNEGDK  621
             S GSP    K
Sbjct  150  ESGGSPTATSK  160



>ref|NP_001266273.1| uncharacterized protein LOC101264839 [Solanum lycopersicum]
 ref|XP_010323600.1| PREDICTED: uncharacterized protein LOC101264839 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323601.1| PREDICTED: uncharacterized protein LOC101264839 isoform X1 [Solanum 
lycopersicum]
 gb|AFV15385.1| AGO6 [Solanum lycopersicum]
Length=903

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  256  RLPMARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLD  435
            R  M R G G+ G++I +L NH KV++   D  F+HYSV++  ++ R V+SK I RK++D
Sbjct  35   RTIMMRAGDGTSGREISLLANHLKVSIKCPDEIFYHYSVSITSDEKRAVNSKVIRRKIVD  94

Query  436  RVHDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNR  576
            ++H+TY +E AGK+FAYDGEK+L+TVG LPRN+LEFTVV+EE ++ +
Sbjct  95   KLHETYSSEFAGKKFAYDGEKNLYTVGPLPRNRLEFTVVVEESSARQ  141



>ref|XP_004296439.1| PREDICTED: protein argonaute 16-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=889

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +1

Query  265  MAR-RGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRV  441
            M R RG G+ G++I + TNHFKV+V   D  F+ Y V + YED RPV+   IGRK+++++
Sbjct  30   MVRPRGGGTTGRRIQLSTNHFKVSVKNPDAVFYQYCVLITYEDNRPVEGMRIGRKLVEKL  89

Query  442  HDTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNG  585
            + TY +E  GK+FAYDGEK+L+TVG LP+NK EFTVVLEE  +   NG
Sbjct  90   YQTYSSEFGGKKFAYDGEKALYTVGPLPQNKFEFTVVLEESFAKSENG  137



>ref|XP_006594374.1| PREDICTED: protein argonaute 16-like isoform X5 [Glycine max]
Length=790

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R G G+ G+ IP+L N F+V V+  D  FF YSVA+ +ED + V+SKGIGRKV+DR++
Sbjct  56   ISRNGVGTTGKHIPLLVNLFEVAVNVPDTVFFQYSVAITFEDKQAVESKGIGRKVIDRLY  115

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
             TY +EL GK F YDG K+L+TVG LP NK EF V+LE+  + R++   SPG+
Sbjct  116  QTYSSELGGKRFVYDGGKTLYTVGPLPLNKYEFKVLLEKSFTKRSSAK-SPGA  167



>ref|XP_006594371.1| PREDICTED: protein argonaute 16-like isoform X2 [Glycine max]
Length=918

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  265  MARRGFGSKGQKIPILTNHFKVNVSKNDGHFFHYSVALYYEDGRPVDSKGIGRKVLDRVH  444
            ++R G G+ G+ IP+L N F+V V+  D  FF YSVA+ +ED + V+SKGIGRKV+DR++
Sbjct  56   ISRNGVGTTGKHIPLLVNLFEVAVNVPDTVFFQYSVAITFEDKQAVESKGIGRKVIDRLY  115

Query  445  DTYDTELAGKEFAYDGEKSLFTVGALPRNKLEFTVVLEEVTSNRNNGNCSPGS  603
             TY +EL GK F YDG K+L+TVG LP NK EF V+LE+  + R++   SPG+
Sbjct  116  QTYSSELGGKRFVYDGGKTLYTVGPLPLNKYEFKVLLEKSFTKRSSAK-SPGA  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950