BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS098E04

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...    167   8e-44   Nicotiana sylvestris
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...    167   8e-44   Nicotiana sylvestris
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...    166   3e-43   Nicotiana tomentosiformis
ref|XP_007038488.1|  ERECTA-like 1                                      155   1e-39   
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-39   Fragaria vesca subsp. vesca
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...    153   8e-39   Malus domestica [apple tree]
ref|XP_002318267.2|  PTH-1 family protein                               152   2e-38   
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-38   Populus euphratica
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-38   Sesamum indicum [beniseed]
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-38   Solanum lycopersicum
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-38   
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...    150   6e-38   Tarenaya hassleriana [spider flower]
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...    150   9e-38   
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399             148   4e-37   
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...    147   9e-37   
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...    147   1e-36   Solanum tuberosum [potatoes]
gb|KJB39364.1|  hypothetical protein B456_007G009000                    147   1e-36   Gossypium raimondii
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...    146   1e-36   Gossypium arboreum [tree cotton]
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    145   3e-36   
gb|KDP22376.1|  hypothetical protein JCGZ_26207                         145   3e-36   Jatropha curcas
dbj|BAA97187.1|  receptor-like protein kinase                           144   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...    144   8e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAP69763.1|  ERECTA-like kinase 1                                    144   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...    144   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g             144   1e-35   Phaseolus vulgaris [French bean]
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Brassica rapa
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Brassica rapa
emb|CDY00268.1|  BnaA06g21690D                                          143   2e-35   
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...    143   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg             143   2e-35   Capsella rubella
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                    143   3e-35   Arabis alpina [alpine rockcress]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg                142   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg             142   4e-35   
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...    142   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...    142   5e-35   Populus euphratica
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...    141   8e-35   Vitis vinifera
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Cucumis melo [Oriental melon]
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg             141   1e-34   
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg             140   2e-34   
emb|CDX86913.1|  BnaC03g51830D                                          140   2e-34   
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...    140   2e-34   
gb|KGN49592.1|  hypothetical protein Csa_5G014290                       140   2e-34   Cucumis sativus [cucumbers]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...    140   3e-34   Glycine soja [wild soybean]
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...    140   3e-34   Glycine soja [wild soybean]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1           140   3e-34   Glycine max [soybeans]
ref|NP_001235330.1|  ERECTA-like kinase                                 140   3e-34   Glycine max [soybeans]
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...    139   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g             139   9e-34   Phaseolus vulgaris [French bean]
emb|CDX99001.1|  BnaC09g48340D                                          137   2e-33   
ref|XP_006394419.1|  hypothetical protein EUTSA_v100036150mg            127   2e-33   
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...    137   2e-33   Brassica rapa
emb|CDX70013.1|  BnaA10g23620D                                          137   2e-33   
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...    137   2e-33   Cicer arietinum [garbanzo]
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...    137   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1           137   4e-33   Glycine max [soybeans]
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2           137   4e-33   Glycine max [soybeans]
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...    136   5e-33   Prunus mume [ume]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...    136   7e-33   Glycine max [soybeans]
gb|KEH43759.1|  LRR receptor-like kinase family protein                 136   7e-33   Medicago truncatula
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase                135   1e-32   Populus nigra x Populus x canadensis
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg             135   1e-32   
emb|CBI24498.3|  unnamed protein product                                135   1e-32   Vitis vinifera
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...    135   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...    134   2e-32   Glycine max [soybeans]
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...    134   2e-32   Glycine max [soybeans]
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657             134   3e-32   Arabidopsis lyrata subsp. lyrata
emb|CDP05285.1|  unnamed protein product                                133   8e-32   Coffea canephora [robusta coffee]
ref|XP_002322426.1|  PTH-1 family protein                               132   1e-31   
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500          131   4e-31   
ref|XP_002510897.1|  erecta, putative                                   130   4e-31   
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...    130   5e-31   Nelumbo nucifera [Indian lotus]
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                   130   5e-31   Citrus sinensis [apfelsine]
gb|EPS66497.1|  hypothetical protein M569_08274                         130   6e-31   Genlisea aurea
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...    130   9e-31   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...    129   1e-30   
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2           129   2e-30   Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...    129   2e-30   Glycine soja [wild soybean]
ref|NP_001237639.1|  ERECTA-like kinase                                 126   1e-29   Glycine max [soybeans]
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...    127   1e-29   Sesamum indicum [beniseed]
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...    126   2e-29   
emb|CAB87274.1|  receptor-like protein kinase                           126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...    126   2e-29   Phoenix dactylifera
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-28   Elaeis guineensis
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...    120   3e-27   
gb|KDO73636.1|  hypothetical protein CISIN_1g0023492mg                  111   8e-27   Citrus sinensis [apfelsine]
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    115   9e-26   Cucumis melo [Oriental melon]
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-25   Cucumis sativus [cucumbers]
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    114   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    114   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006452987.1|  hypothetical protein CICLE_v100073971mg            110   1e-24   
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    112   2e-24   Vitis vinifera
emb|CBI20727.3|  unnamed protein product                                112   2e-24   Vitis vinifera
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      112   2e-24   Citrus unshiu [satsuma mandarin]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    111   2e-24   Citrus sinensis [apfelsine]
gb|KDP34024.1|  hypothetical protein JCGZ_07595                         111   2e-24   Jatropha curcas
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    110   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    110   7e-24   
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    109   1e-23   Eucalyptus grandis [rose gum]
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...    109   2e-23   Oryza brachyantha
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    109   2e-23   Fragaria vesca subsp. vesca
dbj|BAD44800.1|  putative transmembrane protein kinase                  108   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ACY07616.1|  stress-induced protein kinase                           108   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056687.1|  Os06g0130100                                       108   2e-23   
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             108   2e-23   
dbj|BAJ89970.1|  predicted protein                                      108   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    108   3e-23   Arabis alpina [alpine rockcress]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    108   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    108   4e-23   Cicer arietinum [garbanzo]
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    108   4e-23   Cicer arietinum [garbanzo]
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    107   4e-23   Tarenaya hassleriana [spider flower]
gb|AES59193.2|  LRR receptor-like kinase family protein                 107   6e-23   Medicago truncatula
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         107   6e-23   Brassica napus [oilseed rape]
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    107   9e-23   Prunus mume [ume]
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    107   9e-23   Prunus mume [ume]
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    107   9e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    107   1e-22   Nicotiana sylvestris
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-22   Brassica rapa
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    106   1e-22   
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-22   Glycine max [soybeans]
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    106   2e-22   Nicotiana tomentosiformis
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             105   2e-22   
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   Setaria italica
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   Setaria italica
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    105   2e-22   Glycine soja [wild soybean]
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    105   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             105   3e-22   
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             105   4e-22   Capsella rubella
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    105   5e-22   Elaeis guineensis
ref|XP_002516144.1|  erecta, putative                                   105   5e-22   Ricinus communis
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...    104   6e-22   
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             104   7e-22   Eutrema salsugineum [saltwater cress]
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    104   7e-22   Sesamum indicum [beniseed]
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    104   8e-22   Phoenix dactylifera
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...    103   9e-22   Setaria italica
gb|KJB07391.1|  hypothetical protein B456_001G019800                    103   1e-21   Gossypium raimondii
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    103   1e-21   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...    103   1e-21   
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...    103   1e-21   
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    103   2e-21   Solanum lycopersicum
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    103   2e-21   Pyrus x bretschneideri [bai li]
gb|AFJ14786.1|  ERECTA-like kinase                                      103   2e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13474.1|  unnamed protein product                                102   2e-21   Coffea canephora [robusta coffee]
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    102   2e-21   Solanum tuberosum [potatoes]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970          102   3e-21   Sorghum bicolor [broomcorn]
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...    102   3e-21   
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    102   4e-21   Sesamum indicum [beniseed]
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase    102   5e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    101   6e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    101   6e-21   Populus euphratica
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    101   6e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    101   7e-21   Oryza brachyantha
gb|AAL68842.1|AF466199_1  putative receptor protein kinase              101   8e-21   Sorghum bicolor [broomcorn]
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...    101   9e-21   
gb|EEE57902.1|  hypothetical protein OsJ_08587                          100   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74102.1|  hypothetical protein OsI_09151                          100   1e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          100   1e-20   Sorghum bicolor [broomcorn]
gb|AGT17158.1|  ERECTA-like 2                                           100   1e-20   Saccharum hybrid cultivar R570
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...  99.4    1e-20   
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...  99.4    2e-20   
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440          100   2e-20   
gb|EEE65279.1|  hypothetical protein OsJ_20503                        98.6    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...  98.6    7e-20   Malus domestica [apple tree]
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g           98.6    7e-20   Phaseolus vulgaris [French bean]
ref|XP_007161048.1|  hypothetical protein PHAVU_001G038400g           97.8    9e-20   Phaseolus vulgaris [French bean]
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...  98.2    9e-20   Oryza brachyantha
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...  98.2    1e-19   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...  97.8    1e-19   Glycine max [soybeans]
gb|AFC88469.1|  ERECTA                                                97.4    2e-19   Triticum aestivum [Canadian hard winter wheat]
gb|EEC80197.1|  hypothetical protein OsI_22078                        97.4    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001057087.1|  Os06g0203800                                     97.4    2e-19   
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg              95.9    6e-19   Erythranthe guttata [common monkey flower]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...  94.7    1e-18   Triticum urartu
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...  94.7    2e-18   Glycine max [soybeans]
gb|EPS61595.1|  hypothetical protein M569_13200                       92.8    4e-18   Genlisea aurea
gb|KEH39916.1|  LRR receptor-like kinase family protein               93.2    4e-18   Medicago truncatula
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...  92.4    7e-18   Zea mays [maize]
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...  92.4    8e-18   Zea mays [maize]
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051           92.4    1e-17   
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g           90.9    3e-17   Phaseolus vulgaris [French bean]
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...  90.5    4e-17   
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase       90.5    4e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    4e-17   
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    4e-17   Phoenix dactylifera
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2       90.1    5e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522           90.1    5e-17   
dbj|BAK07025.1|  predicted protein                                    90.1    6e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96098.1|  predicted protein                                    90.1    6e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW76644.1|  putative leucine-rich repeat receptor-like protei...  89.4    8e-17   
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124           89.4    8e-17   
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267           88.6    1e-16   
gb|KJB65473.1|  hypothetical protein B456_010G096300                  88.6    2e-16   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                  88.2    2e-16   Gossypium raimondii
gb|KJB65471.1|  hypothetical protein B456_010G096300                  88.2    2e-16   Gossypium raimondii
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...  87.8    3e-16   
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase       87.8    3e-16   Triticum aestivum [Canadian hard winter wheat]
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg              87.8    3e-16   Erythranthe guttata [common monkey flower]
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1       87.4    4e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010109086.1|  hypothetical protein L484_012962                 80.5    8e-16   
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...  85.9    1e-15   Triticum urartu
gb|EEE65024.1|  hypothetical protein OsJ_19993                        82.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    3e-14   
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...  79.0    3e-13   
ref|XP_001763775.1|  ERL2a AtERECTA-like receptor S/T protein kin...  76.6    1e-12   
emb|CAN74952.1|  hypothetical protein VITISV_025649                   75.1    4e-12   Vitis vinifera
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase  74.7    7e-12   Triticum aestivum [Canadian hard winter wheat]
gb|KHG04654.1|  LRR receptor-like serine/threonine-protein kinase...  73.9    7e-12   Gossypium arboreum [tree cotton]
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...  73.6    1e-11   
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...  73.6    1e-11   
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...  73.2    2e-11   
ref|XP_010933053.1|  PREDICTED: LRR receptor-like serine/threonin...  72.8    2e-11   Elaeis guineensis
ref|XP_001755991.1|  ERL1d AtERECTA-like receptor S/T protein kin...  72.4    3e-11   
ref|XP_008802949.1|  PREDICTED: LRR receptor-like serine/threonin...  71.2    5e-11   Phoenix dactylifera
ref|XP_003592397.1|  LRR receptor-like serine/threonine-protein k...  66.6    5e-11   
ref|XP_009390528.1|  PREDICTED: LRR receptor-like serine/threonin...  71.2    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001755734.1|  ERL1b AtERECTA-like receptor S/T protein kin...  71.6    5e-11   
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...  70.9    9e-11   Triticum urartu
emb|CDX84346.1|  BnaC03g51540D                                        70.5    1e-10   
ref|XP_010942960.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   
emb|CDY00321.1|  BnaA06g22220D                                        70.5    1e-10   
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...  70.9    1e-10   
ref|XP_006439659.1|  hypothetical protein CICLE_v10019379mg           70.5    1e-10   Citrus clementina [clementine]
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   Brassica rapa
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g           70.1    1e-10   Phaseolus vulgaris [French bean]
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g           70.1    1e-10   Phaseolus vulgaris [French bean]
gb|KJB08256.1|  hypothetical protein B456_001G074000                  69.7    1e-10   Gossypium raimondii
gb|KHN47744.1|  LRR receptor-like serine/threonine-protein kinase...  70.5    1e-10   Glycine soja [wild soybean]
ref|XP_010459245.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006476661.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    2e-10   Citrus sinensis [apfelsine]
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              69.7    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_003547404.2|  PREDICTED: LRR receptor-like serine/threonin...  70.1    2e-10   Glycine max [soybeans]
gb|KJB08255.1|  hypothetical protein B456_001G074000                  69.7    2e-10   Gossypium raimondii
gb|KHG18268.1|  LRR receptor-like serine/threonine-protein kinase...  69.7    2e-10   Gossypium arboreum [tree cotton]
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|NP_001147056.1|  ATP binding protein                              68.9    3e-10   Zea mays [maize]
tpg|DAA54784.1|  TPA: putative leucine-rich repeat receptor-like ...  68.9    3e-10   
ref|XP_002468123.1|  hypothetical protein SORBIDRAFT_01g040010        68.9    4e-10   Sorghum bicolor [broomcorn]
tpg|DAA54785.1|  TPA: putative leucine-rich repeat receptor-like ...  68.9    4e-10   
gb|AFW88861.1|  putative leucine-rich repeat receptor-like protei...  68.6    4e-10   
ref|XP_010444123.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001147917.1|  LOC100281527 precursor                           68.6    4e-10   
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_004984668.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   
ref|XP_010483983.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-10   Cicer arietinum [garbanzo]
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    5e-10   
ref|XP_010942962.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    5e-10   Elaeis guineensis
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    5e-10   Cucumis melo [Oriental melon]
ref|XP_009394917.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    5e-10   
ref|XP_009394924.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942956.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    5e-10   Elaeis guineensis
ref|XP_010942959.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    6e-10   
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    6e-10   Cucumis sativus [cucumbers]
ref|XP_007040985.1|  Leucine-rich repeat transmembrane protein ki...  68.6    6e-10   
ref|XP_007138872.1|  hypothetical protein PHAVU_009G244600g           68.6    6e-10   Phaseolus vulgaris [French bean]
ref|XP_002864814.1|  leucine-rich repeat family protein               68.2    6e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_001146833.1|  LOC100280440 precursor                           67.8    7e-10   Zea mays [maize]
gb|AAT08020.1|  putative receptor protein kinase                      65.5    7e-10   Zea mays [maize]
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  67.8    7e-10   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  67.8    7e-10   
ref|XP_008673399.1|  PREDICTED: LOC100280440 isoform X1               67.8    8e-10   Zea mays [maize]
ref|XP_008673396.1|  PREDICTED: LOC100280440 isoform X2               67.8    8e-10   Zea mays [maize]
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      67.8    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_004504632.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    1e-09   Cicer arietinum [garbanzo]
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      67.4    1e-09   Vitis vinifera
ref|XP_003558273.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    1e-09   Tarenaya hassleriana [spider flower]
dbj|BAB10839.1|  receptor-like protein kinase                         67.0    1e-09   
ref|XP_006280205.1|  hypothetical protein CARUB_v10026113mg           67.0    1e-09   
gb|KHG14766.1|  LRR receptor-like serine/threonine-protein kinase...  67.0    1e-09   
ref|XP_008381992.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           66.6    2e-09   
emb|CBI15282.3|  unnamed protein product                              66.6    2e-09   
ref|XP_002270994.2|  PREDICTED: LRR receptor-like serine/threonin...  66.6    2e-09   
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  66.6    2e-09   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    2e-09   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       66.6    2e-09   
ref|XP_010276923.1|  PREDICTED: LRR receptor-like serine/threonin...  66.2    2e-09   
gb|KJB39878.1|  hypothetical protein B456_007G035200                  66.2    2e-09   
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  66.2    2e-09   
ref|XP_002299290.2|  leucine-rich repeat transmembrane protein ki...  66.6    2e-09   
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  66.2    3e-09   
gb|KFK28003.1|  hypothetical protein AALP_AA8G459000                  65.9    3e-09   
gb|KJB18216.1|  hypothetical protein B456_003G039900                  65.9    3e-09   
ref|XP_010647299.1|  PREDICTED: probable LRR receptor-like serine...  63.9    3e-09   
gb|KHG00413.1|  hypothetical protein F383_17290                       65.9    3e-09   
gb|KJB18215.1|  hypothetical protein B456_003G039900                  65.9    3e-09   
ref|XP_010647298.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           65.5    4e-09   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    4e-09   
dbj|BAK05926.1|  predicted protein                                    65.5    4e-09   
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  65.5    4e-09   
ref|XP_002993357.1|  hypothetical protein SELMODRAFT_431458           65.9    4e-09   
ref|XP_010647297.1|  PREDICTED: probable LRR receptor-like serine...  63.9    4e-09   
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  65.5    5e-09   
ref|XP_010647293.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-09   
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      65.5    5e-09   
ref|XP_010647295.1|  PREDICTED: probable LRR receptor-like serine...  63.9    5e-09   
emb|CBI29551.3|  unnamed protein product                              64.3    5e-09   
ref|XP_010318957.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    6e-09   
ref|XP_006854255.1|  hypothetical protein AMTR_s00039p00029750        65.5    6e-09   
ref|XP_009128461.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    6e-09   
ref|XP_006367065.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    7e-09   
tpg|DAA47702.1|  TPA: putative leucine-rich repeat receptor-like ...  61.6    7e-09   
emb|CDY16762.1|  BnaA09g06200D                                        64.7    7e-09   
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase             64.7    7e-09   
ref|XP_011002164.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    8e-09   
ref|XP_011012222.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    8e-09   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    8e-09   
ref|XP_006649812.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    8e-09   
ref|XP_010942958.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    8e-09   
ref|XP_010276922.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    8e-09   
ref|XP_002448922.1|  hypothetical protein SORBIDRAFT_05g001640        64.7    9e-09   
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...  64.7    9e-09   
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      64.7    9e-09   
ref|XP_007155343.1|  hypothetical protein PHAVU_003G193100g           64.3    9e-09   
gb|KHN18521.1|  LRR receptor-like serine/threonine-protein kinase...  64.3    9e-09   
ref|XP_010668554.1|  PREDICTED: probably inactive leucine-rich re...  64.7    9e-09   
ref|XP_008437655.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   
emb|CDY68314.1|  BnaCnng58470D                                        64.3    1e-08   
ref|XP_008810950.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   
gb|EYU30329.1|  hypothetical protein MIMGU_mgv1a015636mg              61.2    1e-08   
ref|XP_004157847.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1               64.3    1e-08   
ref|XP_008810949.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   
ref|XP_002511511.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  64.3    1e-08   
ref|XP_004152539.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    1e-08   
emb|CDY37560.1|  BnaA02g20100D                                        64.3    1e-08   
emb|CAN75190.1|  hypothetical protein VITISV_035381                   63.9    1e-08   
ref|NP_001242206.1|  LRR receptor-like serine/threonine-protein k...  63.9    1e-08   
gb|KFK45125.1|  hypothetical protein AALP_AA1G347300                  63.9    1e-08   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           63.9    1e-08   
gb|KHG09386.1|  hypothetical protein F383_11973                       64.3    1e-08   
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.9    1e-08   
ref|XP_002972743.1|  hypothetical protein SELMODRAFT_413321           64.3    1e-08   
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.9    1e-08   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.9    2e-08   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.9    2e-08   
dbj|BAB01326.1|  receptor-like kinase                                 63.9    2e-08   
gb|ABK93925.1|  unknown                                               63.5    2e-08   
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.5    2e-08   
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      63.5    2e-08   
ref|XP_008796642.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   
ref|XP_011085266.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    2e-08   
gb|KGN62469.1|  hypothetical protein Csa_2G354950                     63.9    2e-08   
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   
gb|EAY84047.1|  hypothetical protein OsI_39276                        60.8    2e-08   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   63.5    2e-08   
ref|XP_010267619.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  63.5    2e-08   
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.5    2e-08   
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  63.5    2e-08   
emb|CDX87267.1|  BnaC09g05820D                                        63.2    2e-08   
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...  63.5    2e-08   
ref|XP_011042612.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  63.2    2e-08   
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g           63.2    2e-08   
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  63.2    2e-08   
gb|EAZ36071.1|  hypothetical protein OsJ_20380                        63.5    2e-08   
dbj|BAD72442.1|  putative protein kinase Xa21, receptor type prec...  63.5    2e-08   
ref|XP_008444587.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_010267641.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-08   
ref|XP_002312685.1|  leucine-rich repeat family protein               63.2    2e-08   
ref|NP_001049659.1|  Os03g0266800                                     63.2    2e-08   
ref|XP_010261130.1|  PREDICTED: somatic embryogenesis receptor ki...  63.2    2e-08   
gb|KHN26729.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  63.2    3e-08   
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase         63.2    3e-08   
emb|CDY61461.1|  BnaC01g43240D                                        63.2    3e-08   
ref|XP_010446261.1|  PREDICTED: probable leucine-rich repeat rece...  63.5    3e-08   
ref|XP_004143019.1|  PREDICTED: probable LRR receptor-like serine...  63.2    3e-08   
ref|XP_006854236.1|  hypothetical protein AMTR_s00048p00228530        62.8    3e-08   
ref|XP_003615565.1|  Receptor protein kinase-like protein             63.2    3e-08   
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...  63.2    3e-08   
ref|XP_006468654.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    3e-08   
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      62.8    3e-08   
ref|XP_008232304.1|  PREDICTED: probable LRR receptor-like serine...  63.2    3e-08   
ref|XP_009600869.1|  PREDICTED: probable LRR receptor-like serine...  62.8    3e-08   
gb|AES91180.2|  LRR receptor-like kinase                              62.8    3e-08   
ref|XP_007158112.1|  hypothetical protein PHAVU_002G125100g           62.8    3e-08   
ref|XP_003608983.1|  LRR receptor-like serine/threonine-protein k...  62.8    3e-08   
gb|EPS73511.1|  hypothetical protein M569_01245                       62.8    3e-08   
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              62.8    3e-08   
gb|KHN08861.1|  LRR receptor-like serine/threonine-protein kinase...  62.8    3e-08   
ref|XP_010680532.1|  PREDICTED: probable LRR receptor-like serine...  62.8    3e-08   
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    3e-08   
dbj|BAK02609.1|  predicted protein                                    62.8    3e-08   
ref|XP_010034579.1|  PREDICTED: putative receptor-like protein ki...  63.2    3e-08   
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...  62.8    3e-08   
ref|XP_006432209.1|  hypothetical protein CICLE_v10003538mg           62.8    3e-08   
gb|AES98523.2|  LRR receptor-like kinase family protein               62.8    3e-08   
gb|KJB27414.1|  hypothetical protein B456_005G0396001                 62.8    3e-08   
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    4e-08   
ref|XP_010933597.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    4e-08   
gb|KJB27412.1|  hypothetical protein B456_005G0396001                 62.8    4e-08   
emb|CBI38425.3|  unnamed protein product                              62.0    4e-08   
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  62.4    4e-08   
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    4e-08   
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    4e-08   
ref|XP_010484156.1|  PREDICTED: probable leucine-rich repeat rece...  62.8    4e-08   
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.4    4e-08   
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase              62.4    4e-08   
ref|XP_008346409.1|  PREDICTED: probable LRR receptor-like serine...  59.7    4e-08   
gb|KHG25582.1|  LRR receptor-like serine/threonine-protein kinase...  62.8    4e-08   
ref|NP_974360.1|  NSP-interacting kinase 2                            62.4    4e-08   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    4e-08   
ref|XP_002443660.1|  hypothetical protein SORBIDRAFT_08g023040        62.4    4e-08   
ref|NP_001189971.1|  NSP-interacting kinase 2                         62.4    4e-08   
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      62.4    4e-08   
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  62.4    5e-08   
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  62.4    5e-08   
emb|CDY46185.1|  BnaA01g23070D                                        62.4    5e-08   
ref|XP_008645482.1|  PREDICTED: probable LRR receptor-like serine...  62.4    5e-08   
ref|NP_189183.2|  NSP-interacting kinase 2                            62.4    5e-08   
ref|XP_008809723.1|  PREDICTED: probable LRR receptor-like serine...  62.4    5e-08   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g           62.4    5e-08   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    5e-08   
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg           62.0    5e-08   
ref|XP_003524071.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  62.0    5e-08   
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...  62.4    5e-08   
dbj|BAC42570.1|  putative receptor protein kinase                     62.0    5e-08   
gb|EMT09348.1|  LRR receptor-like serine/threonine-protein kinase...  62.0    5e-08   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    5e-08   
ref|XP_006448579.1|  hypothetical protein CICLE_v10014061mg           62.4    5e-08   
gb|KHN06825.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  62.0    6e-08   
ref|XP_010916943.1|  PREDICTED: somatic embryogenesis receptor ki...  62.0    6e-08   
gb|AIC09100.1|  leucine-rich repeat receptor-like kinase protein      62.0    6e-08   
gb|AFP87140.1|  somatic embryogenesis receptor-like kinase            62.0    6e-08   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  62.0    6e-08   
gb|KEH21800.1|  NSP-interacting kinase-like protein                   62.0    6e-08   
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  62.0    6e-08   
ref|XP_004488225.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    6e-08   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    6e-08   
gb|EAY99946.1|  hypothetical protein OsI_21949                        62.4    6e-08   
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...  62.0    6e-08   
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg           62.0    6e-08   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  62.0    6e-08   
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  62.0    6e-08   
ref|XP_009370984.1|  PREDICTED: probable LRR receptor-like serine...  61.2    6e-08   
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    6e-08   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  62.0    6e-08   
ref|XP_010678587.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    6e-08   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        62.0    6e-08   
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...  62.0    6e-08   
gb|KJB18214.1|  hypothetical protein B456_003G039900                  61.6    7e-08   
ref|XP_010678588.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    7e-08   
ref|XP_008811221.1|  PREDICTED: somatic embryogenesis receptor ki...  61.6    7e-08   
gb|KCW45147.1|  hypothetical protein EUGRSUZ_L01244                   62.0    7e-08   
emb|CDY50942.1|  BnaC03g74420D                                        62.0    7e-08   
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg           61.6    7e-08   
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.6    8e-08   
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           61.6    8e-08   
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    8e-08   
ref|XP_010090693.1|  hypothetical protein L484_017499                 59.3    8e-08   
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.6    8e-08   
gb|AFX61784.1|  somatic embryogenesis receptor-like kinase            61.6    8e-08   
ref|XP_009136223.1|  PREDICTED: somatic embryogenesis receptor ki...  61.6    8e-08   
gb|AFK43766.1|  unknown                                               58.5    9e-08   
ref|XP_011082273.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    9e-08   
ref|XP_003533521.2|  PREDICTED: LRR receptor-like serine/threonin...  61.6    9e-08   
gb|KJB60823.1|  hypothetical protein B456_009G327400                  61.2    9e-08   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...  61.6    9e-08   
ref|XP_002303809.1|  leucine-rich repeat transmembrane protein ki...  61.6    9e-08   
ref|NP_001239788.1|  LRR receptor-like serine/threonine-protein k...  61.2    9e-08   
emb|CAN59710.1|  hypothetical protein VITISV_040317                   61.6    9e-08   
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2   61.6    1e-07   
gb|EMT26123.1|  Somatic embryogenesis receptor kinase 1               61.2    1e-07   
ref|XP_009363367.1|  PREDICTED: LRR receptor-like serine/threonin...  61.6    1e-07   
ref|XP_006586717.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g           61.2    1e-07   
gb|ABR16631.1|  unknown                                               61.2    1e-07   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      61.2    1e-07   
emb|CDX89615.1|  BnaC03g45290D                                        61.2    1e-07   
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_010028759.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    1e-07   
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  61.2    1e-07   
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450        61.2    1e-07   
ref|XP_006366320.1|  PREDICTED: probable LRR receptor-like serine...  60.8    1e-07   
ref|XP_010040521.1|  PREDICTED: putative receptor-like protein ki...  60.8    1e-07   
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  61.2    1e-07   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              61.2    1e-07   
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   58.9    1e-07   
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        61.2    1e-07   
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  61.2    1e-07   
ref|XP_010025444.1|  PREDICTED: probable LRR receptor-like serine...  61.2    1e-07   
dbj|BAK03316.1|  predicted protein                                    61.2    1e-07   



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M+F    VL  ILL  P+ S + +EGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV
Sbjct  1    MKFRSRAVLWSILLLLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             CGNFSMSVV+LNLSNLNLGGEISPAIGDL+NLQSIDLQGN+LTGQIPDEIG+CISLI L
Sbjct  61   LCGNFSMSVVALNLSNLNLGGEISPAIGDLKNLQSIDLQGNKLTGQIPDEIGSCISLIFL  120

Query  624  D  626
            D
Sbjct  121  D  121



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M+F    VL  ILL  P+ S + +EGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV
Sbjct  1    MKFRSRAVLWSILLLLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             CGNFSMSVV+LNLSNLNLGGEISPAIGDL+NLQSIDLQGN+LTGQIPDEIG+CISLI L
Sbjct  61   LCGNFSMSVVALNLSNLNLGGEISPAIGDLKNLQSIDLQGNKLTGQIPDEIGSCISLIFL  120

Query  624  D  626
            D
Sbjct  121  D  121



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M+     VL  ILL  P+ S + +EGK LMSIKESFSNVAN+LLDWDDVHNEDFCSWRGV
Sbjct  1    MKLRSRAVLWAILLLLPIVSSLNEEGKALMSIKESFSNVANMLLDWDDVHNEDFCSWRGV  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             CGNFSMSVV+LNLSNLNLGGEISPA+GDL+NLQSIDLQGN+LTGQIPDEIGNCISLI L
Sbjct  61   FCGNFSMSVVALNLSNLNLGGEISPAVGDLKNLQSIDLQGNKLTGQIPDEIGNCISLIFL  120

Query  624  D  626
            D
Sbjct  121  D  121



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  MVEKVLFPG-IRKMEFALACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDW  401
            M E+VL     R+ E     V+ ++ L   P+ S + DEGK LMSIKESFSNVANVLLDW
Sbjct  1    MEEEVLLERRKRRKELYGGLVMVMVFLVLCPIASSLNDEGKALMSIKESFSNVANVLLDW  60

Query  402  DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQ  581
            DDVHN DFCSWRGV C N S+SVVSLNLSNL LGGEISPAIGDL+NLQSIDL+GN+LTGQ
Sbjct  61   DDVHNADFCSWRGVFCDNISLSVVSLNLSNLILGGEISPAIGDLKNLQSIDLEGNKLTGQ  120

Query  582  IPDEIGNCISLILLD  626
            IPDEIGNC SL+ LD
Sbjct  121  IPDEIGNCGSLVHLD  135



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score =   155 bits (391),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  288  LALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsms  467
            LAL LL FP+ S + DEGK LM+IK SFSNVANVLLDW+D H++DFCSWRGV C N S+S
Sbjct  24   LALFLL-FPVASSLNDEGKALMAIKASFSNVANVLLDWNDAHDDDFCSWRGVFCDNVSLS  82

Query  468  vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            V SLNLS+LNLGGEISPA+GDL NL+SIDLQGN+LTGQIPDEIGNC SLI LD
Sbjct  83   VASLNLSSLNLGGEISPAVGDLGNLESIDLQGNKLTGQIPDEIGNCASLIYLD  135



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score =   153 bits (386),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
            +K E      LAL+ + FPL S + DEGK LMSIK SFSNVANVLLDW+D H+ DFCSWR
Sbjct  9    KKTELVFCFGLALMAVLFPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWR  68

Query  438  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLI  617
            GV C N S+SV SLNLSNLNLGGEISPAIGDL NL+ IDLQGN+LTGQIPDEIG+C SLI
Sbjct  69   GVFCDNVSLSVASLNLSNLNLGGEISPAIGDLGNLEYIDLQGNKLTGQIPDEIGDCASLI  128

Query  618  LLD  626
             LD
Sbjct  129  HLD  131



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            PL S + DEGK LMSIKESFSNV NVLLDWDDVHNEDFCSWRGV C N S+SVVSLNLSN
Sbjct  23   PLVSPLNDEGKALMSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFCDNVSLSVVSLNLSN  82

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEISPAIGDLRNLQSID QGN+LTGQIP+EIGNC SL  LD
Sbjct  83   LNLGGEISPAIGDLRNLQSIDFQGNKLTGQIPEEIGNCASLFNLD  127



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            PL   + DEGK LMSIKESFSNVANVLLDWDDVHNEDFCSWRGV C N S SVVSLNLSN
Sbjct  23   PLVFPLNDEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGVFCDNVSFSVVSLNLSN  82

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEISPAIGDLRNLQSID QGN+LTGQIP+EIGNC SL  LD
Sbjct  83   LNLGGEISPAIGDLRNLQSIDFQGNKLTGQIPEEIGNCASLFNLD  127



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  228  MVEKVLF-PGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            +VE+ LF  G   M+  L   + +  L FPL S + DEGK LMSIK SFSNVANVLLDWD
Sbjct  3    VVEEQLFVEGKTNMKMGLLYFVLVFFLLFPLASPLSDEGKALMSIKASFSNVANVLLDWD  62

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
            +VHN+DFCSWRGVSCGN S SVV+LNLSNLNL GEIS AIGDL++LQS+DLQGN+LTGQI
Sbjct  63   EVHNDDFCSWRGVSCGNISTSVVALNLSNLNLCGEISAAIGDLKSLQSLDLQGNKLTGQI  122

Query  585  PDEIGNCI  608
            PDEIGNCI
Sbjct  123  PDEIGNCI  130



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            KM+F    +L ++LL FP+   + +EGK LMSIK SFSNVANVLLDWDD+H+EDFCSWRG
Sbjct  7    KMKFRSQALLLVLLLVFPIVLALTEEGKALMSIKASFSNVANVLLDWDDIHDEDFCSWRG  66

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V CGNFSMSVV+LNLSNLNLGGEISP IG+L+NL+++DLQGN+LTGQ+PDEIGNCISLI 
Sbjct  67   VLCGNFSMSVVALNLSNLNLGGEISPDIGELKNLETLDLQGNKLTGQVPDEIGNCISLIY  126

Query  621  LD  626
            LD
Sbjct  127  LD  128



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score =   151 bits (381),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 86/106 (81%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  309  FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnls  488
            FPL S + DEGK LMSIK SFSNVANVLLDW+D H+ DFCSWRGV C N S+SV SLNLS
Sbjct  5    FPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFCDNVSLSVASLNLS  64

Query  489  nlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLNLGGEISPAIGDL NL+SIDLQGN+LTGQIPDEIGNC SLI LD
Sbjct  65   NLNLGGEISPAIGDLGNLESIDLQGNKLTGQIPDEIGNCASLIHLD  110



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +R   + L+  +A+ +L   + S I DEGK LM+IK SFSNVANVLLDWDDVHN+DFCSW
Sbjct  3    VRVKGWVLSLAMAVFVL-VGVASSINDEGKALMAIKASFSNVANVLLDWDDVHNDDFCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S+SVVSLNLSNLNLGGEISPA+GDLRNL+SIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVYCDNISLSVVSLNLSNLNLGGEISPAVGDLRNLKSIDLQGNKLAGQIPDEIGNCASL  121

Query  615  ILLD  626
            + LD
Sbjct  122  VYLD  125



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score =   150 bits (378),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 86/106 (81%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  309  FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnls  488
            FPL S + DEGK LMSIK SFSNVANVLLDW+D H+ DFCSWRGV C N S+SV SLNLS
Sbjct  5    FPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFCDNVSLSVASLNLS  64

Query  489  nlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLNLGGEISPAIGDL NL SIDLQGN+LTGQIPDEIGNC SLI LD
Sbjct  65   NLNLGGEISPAIGDLGNLDSIDLQGNKLTGQIPDEIGNCASLIHLD  110



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
             KM+  + C+  ++ L   + S I +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWR
Sbjct  3    EKMQRMVLCLAMVVFLLLGVASSINNEGKALMAIKGSFSNLVNMLLDWDDVHNSDFCSWR  62

Query  438  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLI  617
            GV C   + SVVSLNLS+LNLGGEISPA+GDLRNL+SIDLQGN+L GQIPDEIGNC SL+
Sbjct  63   GVYCDIVTFSVVSLNLSSLNLGGEISPAMGDLRNLESIDLQGNKLAGQIPDEIGNCASLV  122

Query  618  LLD  626
             LD
Sbjct  123  YLD  125



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            +EGK LMSIK SFSNVANVLLDWDDVH+EDFCSWRGV CGNFS+SVV+LNLSNLNLGGEI
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCGNFSISVVALNLSNLNLGGEI  89

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL+NL+++DLQGN+LTGQ+PDEIGNCISLI LD
Sbjct  90   SPAIGDLKNLETLDLQGNKLTGQVPDEIGNCISLIYLD  127



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            +EGK LMSIK SFSNVANVLLDWDDVH+EDFCSWRGV CGNFS+SVV+LNLSNLNLGGEI
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCGNFSISVVALNLSNLNLGGEI  89

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL+NL+++DLQGN+LTGQ+PDEIGNCISLI LD
Sbjct  90   SPAIGDLKNLETLDLQGNKLTGQVPDEIGNCISLIYLD  127



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  MVEKVLFPGIRKMEFALACVLALILLSF--PLTSCIGDEGKTLMSIKESFSNVANVLLDW  401
            M E VL   I + +  L  V+A +LL       S + DEGK LMSIK SFSNVANVLLDW
Sbjct  1    MEEGVLLKKIMRRQELLVMVIAFLLLFLLCSHASSLNDEGKALMSIKASFSNVANVLLDW  60

Query  402  DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQ  581
            DDV+N DFCSWRGV C N S++VVSLNLSNL LGGEISPAIGDLR+LQS+DL GN+LTGQ
Sbjct  61   DDVNNFDFCSWRGVFCDNSSLAVVSLNLSNLILGGEISPAIGDLRSLQSLDLMGNKLTGQ  120

Query  582  IPDEIGNCISLILLD  626
            +PDEIGNC SL+ LD
Sbjct  121  VPDEIGNCGSLVYLD  135



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  228  MVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDD  407
            M E VL   I K +  L  V+A +LL     S + DEGK LMSIK SFSNVANVLLDWDD
Sbjct  1    MEEGVLLKKIMKRQEPLVMVIAFLLLLCSHASSLNDEGKALMSIKASFSNVANVLLDWDD  60

Query  408  VHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  587
            V+N DFCSWRGV C N S++VVSLNLSNL LGGEIS AIGDLR+L+S+DL GN+LTGQ+P
Sbjct  61   VNNFDFCSWRGVFCDNSSLAVVSLNLSNLILGGEISSAIGDLRSLRSLDLMGNKLTGQVP  120

Query  588  DEIGNCISLILLD  626
            DEIGNC SL+ LD
Sbjct  121  DEIGNCGSLVYLD  133



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  255  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  425
            I KM+   F L  V+ +++ +    S + +EGK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLVFGLGMVVFMLIGA---VSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  426  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNC  605
            CSWRGVSC N ++SVVSLNLS LNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVSCDNLTLSVVSLNLSTLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  606  ISLILLD  626
             SL  LD
Sbjct  121  ASLAYLD  127



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +3

Query  231  VEKVLFPGI-RKMEFALACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            VE ++  G+ RKM+ +  C++ ++ +    L   + +EGK LM +K SFSNVANVLLDWD
Sbjct  4    VEAIIVKGMKRKMDVSFMCLIMVVFMLLCSLALPLNNEGKALMVMKASFSNVANVLLDWD  63

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
            DVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEISPAIG+L NLQSID QGN+LTGQI
Sbjct  64   DVHNGDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAIGELSNLQSIDFQGNKLTGQI  123

Query  585  PDEIGNCISLILLD  626
            PDEIGNC+SL  LD
Sbjct  124  PDEIGNCLSLFHLD  137



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  615  ILLD  626
            + LD
Sbjct  122  VYLD  125



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  615  ILLD  626
            + LD
Sbjct  122  VYLD  125



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  615  ILLD  626
            + LD
Sbjct  122  VYLD  125



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +++M  +LA V  ++   F + S + +EGK LM+IK SFSN+ N+LLDWDDVHN D CSW
Sbjct  5    MQRMVLSLAMVGFMV---FGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S SVVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  62   RGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASL  121

Query  615  ILLD  626
            + LD
Sbjct  122  VYLD  125



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  255  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  425
            I KM+   F L  V+ +++ +    S + +EGK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLVFGLGMVVFMLIGA---VSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  426  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNC  605
            CSWRGVSC N ++SVVSLNLS LNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVSCDNLTLSVVSLNLSTLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  606  ISLILLD  626
             SL  +D
Sbjct  121  ASLAYVD  127



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score =   144 bits (362),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  327  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            + +EG+ LM++K +FSN+ +VLLDWDDVHN+DFCSWRGVSC N S+SVVSLNLS+LNLGG
Sbjct  38   LSEEGQALMAMKATFSNMPDVLLDWDDVHNDDFCSWRGVSCDNGSLSVVSLNLSSLNLGG  97

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPAIGDLRNLQSIDLQGN+LTGQIPDEIGNC +L  LD
Sbjct  98   EISPAIGDLRNLQSIDLQGNKLTGQIPDEIGNCAALFHLD  137



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLD  121



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V C N + SVVSLNLSNLNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC+SL+ 
Sbjct  62   VFCDNVTFSVVSLNLSNLNLGGEISPAIGDLRNLKSIDLVGNKLAGQIPDEIGNCVSLVH  121

Query  621  LD  626
            LD
Sbjct  122  LD  123



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V C N + SVVSLNLSNLNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC+SL+ 
Sbjct  62   VFCDNVTFSVVSLNLSNLNLGGEISPAIGDLRNLKSIDLVGNKLAGQIPDEIGNCVSLVH  121

Query  621  LD  626
            LD
Sbjct  122  LD  123



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLD  121



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + DEGK LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNVSFSVVSLNLSNL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD
Sbjct  78   NLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLD  121



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + +EGK LM+IK SFSNVAN+LLDWDDVHN DFCSWRGVSC N ++SVVSLNLS LNL
Sbjct  20   SPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVSCDNLTLSVVSLNLSTLNL  79

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            GGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL  +D
Sbjct  80   GGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNCASLAYVD  121



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
            +KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWR
Sbjct  4    KKMQRVVLCLAVVLSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWR  63

Query  438  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLI  617
            GV C N S SVVSLNLSNLNLGGEISPAIGDL+NLQS+DL GN+L GQIPDEIGNC SLI
Sbjct  64   GVFCDNVSFSVVSLNLSNLNLGGEISPAIGDLKNLQSVDLVGNKLAGQIPDEIGNCASLI  123

Query  618  LLD  626
             LD
Sbjct  124  YLD  126



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
            +KM+    C+  ++ +     S + DEGK LM IK SFSN+ N+LLDWDDVH+ DFCSWR
Sbjct  3    KKMQRMCLCLAMVVFMLLGSASPLNDEGKALMEIKGSFSNLVNMLLDWDDVHSNDFCSWR  62

Query  438  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLI  617
            GV C NFS SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+
Sbjct  63   GVFCDNFSSSVVSLNLSNLNLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLV  122

Query  618  LLD  626
             LD
Sbjct  123  YLD  125



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score =   142 bits (359),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSN+ANVLLDWD+VHN+DFCSW+GVSCGNFSMSVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNIANVLLDWDEVHNDDFCSWKGVSCGNFSMSVVSLNLSNLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L++L+S+DLQGN+LTGQIPDEIGNC+SL+ LD
Sbjct  61   LKSLESVDLQGNKLTGQIPDEIGNCVSLVFLD  92



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +3

Query  273  ALACVLALILLSF-PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSC  449
             LA  L +++ +F    S I +EGK LM+IK SFSNVAN+LLDWD+VHN DFCSWRGV C
Sbjct  3    GLALCLGMVVFTFLGFVSPINNEGKALMAIKASFSNVANMLLDWDNVHNNDFCSWRGVIC  62

Query  450  GnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             N S SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL  +D
Sbjct  63   DNVSFSVVSLNLSNLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNCASLAYVD  121



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  276  LACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  455
            L+  L  + L   + S + DEG  LMSIK SFSNVANVLLDWDD  NED+CSWRGVSC N
Sbjct  15   LSIALVTLSLLLQVASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSCDN  74

Query  456  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             + SVVSLNLSNLNLGGEISPAIGDLRNLQ+ DL+GN+L GQIPDEIGNC+SL  LD
Sbjct  75   VTFSVVSLNLSNLNLGGEISPAIGDLRNLQATDLKGNRLIGQIPDEIGNCVSLKTLD  131



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  276  LACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  455
            L+  L  + L   + S + DEG  LMSIK SFSNVANVLLDWDD  NED+CSWRGVSC N
Sbjct  15   LSIALVTLSLLLQVASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSCDN  74

Query  456  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             + SVVSLNLSNLNLGGEISPAIGDLRNLQ+ DL+GN+L GQIPDEIGNC+SL  LD
Sbjct  75   VTFSVVSLNLSNLNLGGEISPAIGDLRNLQATDLKGNRLIGQIPDEIGNCVSLKTLD  131



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + DEGK LMS+KESFSNV NVL+DWDDVHN DFCSWRGV C N S SVVSLNLSNLNL
Sbjct  29   SPLNDEGKALMSLKESFSNVVNVLVDWDDVHNVDFCSWRGVFCDNNSFSVVSLNLSNLNL  88

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            GGEISPAIGDLRNLQSID QGN LTGQIP+EIGNC SL  LD
Sbjct  89   GGEISPAIGDLRNLQSIDFQGNMLTGQIPEEIGNCASLYHLD  130



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +3

Query  228  MVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDD  407
            M EK+L    +++   L   + L L S  L   + DEGK LMSIK SFSNVAN LLDWDD
Sbjct  2    MGEKLLLEVKKRVVVCLFIWVFLFLSS--LAFQLNDEGKALMSIKASFSNVANALLDWDD  59

Query  408  VHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIP  587
            VHN DFCSWRGV C N S+SVVSLNLSNLNLGGEIS A+GDL+NLQSIDLQGN+LTGQ+P
Sbjct  60   VHNADFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISSAVGDLKNLQSIDLQGNRLTGQLP  119

Query  588  DEIGNCISLILLD  626
            DEIGNC+SL  LD
Sbjct  120  DEIGNCVSLSTLD  132



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnl  485
            S P++S   +EG+ LMSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNL
Sbjct  33   SSPVSSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNL  92

Query  486  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SNLNLGGEISP+IGDLRNLQSID QGN+LTGQIPDEIGNC  L+ LD
Sbjct  93   SNLNLGGEISPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLD  139



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            KM+  + C+  ++ +   + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRG
Sbjct  2    KMQRVVLCLAVVVSMLLGVASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRG  61

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V C N S SVVSLNLS LNLGGEISPAIGDLRNL+SIDL GN+L GQIPDEIGNC SL+ 
Sbjct  62   VFCDNVSFSVVSLNLSKLNLGGEISPAIGDLRNLKSIDLVGNKLGGQIPDEIGNCASLVH  121

Query  621  LD  626
            LD
Sbjct  122  LD  123



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 6/127 (5%)
 Frame = +3

Query  255  IRKME---FALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDF  425
            I KM+   F L  V+ ++L    + S + ++GK LM+IK SFSNVAN+LLDWDDVHN DF
Sbjct  4    IEKMKGLGFRLGMVVFMLL---GVVSPMNNQGKALMAIKASFSNVANMLLDWDDVHNNDF  60

Query  426  CSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNC  605
            CSWRGV C N S+SVVSLNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC
Sbjct  61   CSWRGVFCDNVSLSVVSLNLSNLNLGGEISPALGDLRNLQSIDLQGNKLGGQIPDEIGNC  120

Query  606  ISLILLD  626
             SL  +D
Sbjct  121  ASLAYVD  127



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 101/143 (71%), Gaps = 23/143 (16%)
 Frame = +3

Query  267  EFALACV-LALILLSFPLTSCIGDEG----------------------KTLMSIKESFSN  377
            E  + CV LAL+ L FP  S + DEG                      K LMSIK SFSN
Sbjct  3    ERVVFCVGLALLPLFFPFASPLNDEGSSLSLSLSLSPAASLSAFMLKRKALMSIKASFSN  62

Query  378  VANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDL  557
            VANVLLDW+D H+EDFCSWRGV C N ++SV SLNLSNLNLGGEISPAIGDL NLQSIDL
Sbjct  63   VANVLLDWNDAHDEDFCSWRGVFCDNVTLSVASLNLSNLNLGGEISPAIGDLGNLQSIDL  122

Query  558  QGNQLTGQIPDEIGNCISLILLD  626
            QGN+LTGQIPDEIGNC SL+ LD
Sbjct  123  QGNKLTGQIPDEIGNCASLMHLD  145



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  464
            ++ + +L   + S + +EG  LM+IK SFSNV N+LLDWDDVHN DFCSWRGV C NFS 
Sbjct  7    LMVVFMLLLGVASPMNNEGTALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFCDNFSF  66

Query  465  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SVV+LNLSNLNLGGEISPA+GDLRNLQSIDLQGN+L GQIPDEIGNC SL+ LD
Sbjct  67   SVVTLNLSNLNLGGEISPAVGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLD  120



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            DEGK LM+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEI
Sbjct  17   DEGKALMAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEI  76

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SP+IGDLRNLQSID QGN+LTGQIPDEIGNC SL+ ++
Sbjct  77   SPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIE  114



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnl  485
            S P+ S   +EG+ LMSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNL
Sbjct  30   SSPVYSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNL  89

Query  486  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SNLNLGGEISP+IGDLRNLQSID QGN+LTGQIPDEIGNC  L+ LD
Sbjct  90   SNLNLGGEISPSIGDLRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLD  136



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score =   140 bits (353),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
              S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V SLNLS+L
Sbjct  34   FASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVFSLNLSSL  93

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPAIGDL  LQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  94   NLGGEISPAIGDLVTLQSIDLQGNKLTGQIPDEIGNCAELIYLD  137



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLD  136



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLD  136



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            P  S +GDEG+ LM IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSS  91

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  92   LNLGGEISPAIGDLVNLQSIDLQGNKLTGQIPDEIGNCAELIYLD  136



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + +EGK LM+IK SFSN+ N+LLDWDDVHN DFCSWRGV C N S SVVSLNLSNL
Sbjct  23   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFCDNVSFSVVSLNLSNL  82

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPAIGDLRNLQSIDL GN+L GQIPDEIGNC+SL+ LD
Sbjct  83   NLGGEISPAIGDLRNLQSIDLVGNKLAGQIPDEIGNCVSLVHLD  126



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsn  491
            P  S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V+SLNLSN
Sbjct  31   PFASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVLSLNLSN  90

Query  492  lnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLGGEI PAIGDL NLQSIDLQGN+LTGQIPDEIGNC +LI LD
Sbjct  91   LNLGGEIPPAIGDLGNLQSIDLQGNKLTGQIPDEIGNCAALIHLD  135



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  288  LALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsms  467
            LAL  +   + S + DEG+ LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+S
Sbjct  7    LALFFMLCGVVSPMNDEGRALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLS  66

Query  468  vvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            VVSLNLSNLNLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD
Sbjct  67   VVSLNLSNLNLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLD  119



>ref|XP_006394419.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
 gb|ESQ31705.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
Length=115

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M+IK SFSN+ N+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEISPA+GD
Sbjct  1    MAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAVGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN+L GQIPDEIGNC SL+ LD
Sbjct  61   LRNLQSIDFQGNKLAGQIPDEIGNCASLVYLD  92



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + DEGK LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNL
Sbjct  19   VVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLSVVSLNLSNL  78

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD
Sbjct  79   NLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLD  122



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S + DEGK LM +K SFSNVAN+LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNL
Sbjct  19   VVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLCDNVSLSVVSLNLSNL  78

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPA+GDLR+LQSIDLQGN L GQIPDE+GNC SL  LD
Sbjct  79   NLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLD  122



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln--l  485
            P  S + +EG+ LM++K SF+N+A+VLLDWDDVHN+D CSWRGV C N +++   ++  L
Sbjct  36   PFASPLSEEGQALMAMKSSFNNIADVLLDWDDVHNDDLCSWRGVFCDNVTLTQTVVSLNL  95

Query  486  snlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            S+LNLGGEISPAIG LRNLQSIDLQGN+LTGQIPDEIGNC +L+ LD
Sbjct  96   SSLNLGGEISPAIGGLRNLQSIDLQGNKLTGQIPDEIGNCGALVHLD  142



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            I  M+    C+  ++ +     S + +EGK LM+IK SFSNVAN+LLDWDDVHN DFCSW
Sbjct  4    IETMKGLFFCLGMVVFMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSW  63

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S++VVSLNLSNLNLGGEIS A+GDL NLQSIDLQGN+L GQIPDEIGNC+SL
Sbjct  64   RGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSL  123

Query  615  ILLD  626
              +D
Sbjct  124  AYVD  127



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  240  VLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE  419
            + +PG  K +  ++ +L ++LL  PL S   +EG+ LM++K  FSN+A+VLLDWDD HN+
Sbjct  9    LFYPGRHKWKLLMSPLLLMLLLISPLASSFSEEGQALMAMKALFSNMADVLLDWDDAHND  68

Query  420  DFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  599
            DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIG
Sbjct  69   DFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGDLTNLQSIDLQGNKLTGQIPDEIG  128

Query  600  NCISLILLD  626
            NC +L+ LD
Sbjct  129  NCAALVHLD  137



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  240  VLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNE  419
            + +PG  K +  ++ +L ++LL  PL S   +EG+ LM++K  FSN+A+VLLDWDD HN+
Sbjct  9    LFYPGRHKWKLLMSPLLLMLLLISPLASSFSEEGQALMAMKALFSNMADVLLDWDDAHND  68

Query  420  DFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIG  599
            DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGDL NLQSIDLQGN+LTGQIPDEIG
Sbjct  69   DFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGDLTNLQSIDLQGNKLTGQIPDEIG  128

Query  600  NCISLILLD  626
            NC +L+ LD
Sbjct  129  NCAALVHLD  137



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score =   136 bits (343),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVLLDW+D H+EDFCSWRGV C N ++SV SLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNVANVLLDWNDAHDEDFCSWRGVFCDNVTLSVASLNLSNLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L NLQSIDLQGN+LTGQIPDEIGNC SL+ LD
Sbjct  61   LGNLQSIDLQGNKLTGQIPDEIGNCASLMHLD  92



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + DEG+ LM IK SFSNVA+VL DWDD+HN+DFCSWRGV C N S++V SLNLS+LNL
Sbjct  36   SPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLCDNVSLTVFSLNLSSLNL  95

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            GGEISPAIGDL  LQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  96   GGEISPAIGDLVTLQSIDLQGNKLTGQIPDEIGNCAELIYLD  137



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
            +K  F    +  ++LL  P    + +EG+ LM++K SF+N+A+VLLDWDDVHN+DFCSWR
Sbjct  15   KKWWFHATTMFLMLLLLSPFAFSLQEEGQALMAMKSSFNNIADVLLDWDDVHNDDFCSWR  74

Query  438  GVSC--GnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCIS  611
            GV C   + +++VVSLNLS+LNLGGEISPAIGDLRNLQSIDLQGN+LTGQIPDEIGNC +
Sbjct  75   GVFCDNASHALTVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLTGQIPDEIGNCGA  134

Query  612  LILLD  626
            L  LD
Sbjct  135  LFHLD  139



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIKESFSNV NVLLDWDDVHNEDFCSWRGV C N S+SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID +GN+LTGQIP+EIGNC SL  LD
Sbjct  61   LRNLQSIDFKGNKLTGQIPEEIGNCASLFNLD  92



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEISP+IGD
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEISPSIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN+LTGQIPDEIGNC SL+ ++
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIE  92



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVAN LLDWDDVHN DFCSWRGV C N S+SVVSLNLSNLNLGGEIS A+GD
Sbjct  1    MSIKASFSNVANALLDWDDVHNADFCSWRGVFCDNVSLSVVSLNLSNLNLGGEISSAVGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L+NLQSIDLQGN+LTGQ+PDEIGNC+SL  LD
Sbjct  61   LKNLQSIDLQGNRLTGQLPDEIGNCVSLSTLD  92



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  267  EFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            +F++  V+A++ L F +   + DEG  LMSIK SFS+VANVLLDWD   NED CSWRGV+
Sbjct  10   KFSILSVMAMLFLFFQVVLPLSDEGNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVN  69

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            C N + SVVSLNLSNLNLGGEISP+IG L+ LQ++DL+GN+LTGQIPDEIGNC+SL  LD
Sbjct  70   CDNITFSVVSLNLSNLNLGGEISPSIGGLKVLQTLDLKGNRLTGQIPDEIGNCVSLKTLD  129



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC +L+ LD
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAALVHLD  137



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC +L+ LD
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAALVHLD  137



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            ++ + F L  V+  +LL F ++    +EGK LM+IK SFSNVAN+LLDW DVHN DFCSW
Sbjct  5    LKGLVFGLVMVV-FMLLGF-VSPMNNNEGKALMAIKASFSNVANMLLDWGDVHNNDFCSW  62

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV C N S++VVSLNLSNLNLGGEIS A+GDLRNLQSIDLQGN+L GQIPDEIGNC SL
Sbjct  63   RGVFCDNVSLTVVSLNLSNLNLGGEISSALGDLRNLQSIDLQGNKLGGQIPDEIGNCASL  122

Query  615  ILLD  626
              +D
Sbjct  123  AYVD  126



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   133 bits (334),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVLLDW+D+HNEDFC+WRGV CGN +MSVV+LNLSNL+LGGEIS A+GD
Sbjct  1    MSIKASFSNVANVLLDWNDIHNEDFCTWRGVICGNLTMSVVALNLSNLDLGGEISMAVGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCIS  611
            LR LQS+DLQGN+LTGQIPDEIGNCIS
Sbjct  61   LRGLQSLDLQGNKLTGQIPDEIGNCIS  87



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIKESFSNV NVL+DWDDVHNEDFCSWRGV C N S SVVSLNLSNLNLGGEISP IGD
Sbjct  1    MSIKESFSNVVNVLVDWDDVHNEDFCSWRGVFCDNDSFSVVSLNLSNLNLGGEISPGIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN LTGQIP+EIGNC SL  LD
Sbjct  61   LRNLQSIDFQGNMLTGQIPEEIGNCASLYHLD  92



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score =   131 bits (329),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            ME   A V+ L+ L     S   DEG+ L+S+K SFS+VANVLLDW++   +D CSWRGV
Sbjct  1    MEGFTAMVVLLVFLQ--ALSAQSDEGRALLSLKASFSDVANVLLDWNEDSIDDHCSWRGV  58

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            SC N +  VVSLNLSNLNLGGEI+P+IGDLRNLQSID +GN LTGQIPDEIGNC SL LL
Sbjct  59   SCDNVTFDVVSLNLSNLNLGGEIAPSIGDLRNLQSIDFKGNHLTGQIPDEIGNCQSLKLL  118

Query  624  D  626
            D
Sbjct  119  D  119



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIKESFSNVANVLLDWDDVHN DFCSWRGV C N S SVVSLNLSNLNL GEIS AIGD
Sbjct  1    MSIKESFSNVANVLLDWDDVHNGDFCSWRGVFCDNVSFSVVSLNLSNLNLDGEISTAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN+LTGQIPDEIGNC SL  LD
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCASLYHLD  92



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVLLDWDD  NED+CSWRGVSC N + SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MSIKASFSNVANVLLDWDDARNEDYCSWRGVSCDNVTFSVVSLNLSNLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQ+ DL+GN+L GQIPDEIGNC+SL  LD
Sbjct  61   LRNLQATDLKGNRLIGQIPDEIGNCVSLKTLD  92



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M+IK SFSN+ANVLLDWDDVHN DFCSWRGV C N S+SVVSLNLS+LNLGGEISP+IGD
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFCDNSSLSVVSLNLSSLNLGGEISPSIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN+LTGQIPDEIGNC SL+ ++
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGSLVHIE  92



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score =   130 bits (327),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 69/92 (75%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVL DWDD H+ D CSWRGV CG+   SVV+LNLSNLNLGGE+SP+IG+
Sbjct  1    MSIKASFSNVANVLPDWDDAHSSDLCSWRGVVCGDAITSVVALNLSNLNLGGEVSPSIGE  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQS+DL+GN+LTGQIP+EIGNCI L+++D
Sbjct  61   LRNLQSLDLRGNKLTGQIPEEIGNCIPLVVID  92



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVLLDWDD HN DFCSWRGV C N S+SV +LNLSNLNLGGEISP+IGD
Sbjct  1    MSIKASFSNVANVLLDWDDDHNHDFCSWRGVFCDNVSLSVAALNLSNLNLGGEISPSIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNLQSID QGN+LTGQIPDEIGNC  L+ LD
Sbjct  61   LRNLQSIDFQGNKLTGQIPDEIGNCGLLVHLD  92



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  413
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  414  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  593
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  594  IGNCISLILLD  626
            IG+C+SL  LD
Sbjct  127  IGDCVSLKHLD  137



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M IK SFSNVA+VL DWD +HN+DFCSWRGV C N S+SV+ LNLS+LNLGGEISPAIGD
Sbjct  1    MKIKSSFSNVADVLHDWDALHNDDFCSWRGVLCDNVSLSVLFLNLSSLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L NLQSIDLQGN+LTGQIPDEIGNC  LI LD
Sbjct  61   LVNLQSIDLQGNKLTGQIPDEIGNCAELIYLD  92



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            +EG+ LM++K SF N+A+ LLDWDD HN+DFCSWRGV C N S++VVSLNLS+LNLGGEI
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFCDNVSLTVVSLNLSSLNLGGEI  99

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL NLQSIDLQG++LTGQIPDEIGNC  L+ LD
Sbjct  100  SPAIGDLGNLQSIDLQGSKLTGQIPDEIGNCAGLVHLD  137



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M++K  FSN+A+VLLDWDD HN+DFCSWRGV C N S +VVSLNLS+LNLGGEISPAIGD
Sbjct  1    MAMKALFSNMADVLLDWDDAHNDDFCSWRGVFCDNVSHTVVSLNLSSLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L NLQSIDLQGN+LTGQIPDEIGNC +L+ LD
Sbjct  61   LTNLQSIDLQGNKLTGQIPDEIGNCAALVHLD  92



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            MSIK SFSNVANVLLDWD+VHN+DFCSWRGVSCGN S SVV+LNLSNLNL GEIS AIGD
Sbjct  1    MSIKASFSNVANVLLDWDEVHNDDFCSWRGVSCGNISTSVVALNLSNLNLCGEISAAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCI  608
            L++LQS+DLQGN+LTGQIPDEIGNCI
Sbjct  61   LKSLQSLDLQGNKLTGQIPDEIGNCI  86



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  413
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  414  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  593
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  594  IGNCISLILLD  626
            IG+C+SL  LD
Sbjct  127  IGDCVSLKHLD  137



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M+IK SFSNVAN+LLDWDDVHN DFCSWRGV C N S++VVSLNLSNLNLGGEIS A+GD
Sbjct  1    MAIKASFSNVANMLLDWDDVHNHDFCSWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L NLQSIDLQGN+L GQIPDEIGNC+SL  +D
Sbjct  61   LMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVD  92



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  413
            RK    L   +A +L  FP  S   DEG+ LM++K SFSNV NVLLDW+ V         
Sbjct  7    RKEMLRLLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRS  66

Query  414  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  593
            ++D C+WRGV C + + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDSLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNRLTGQIPDE  126

Query  594  IGNCISLILLD  626
            IG+C+SL  LD
Sbjct  127  IGDCVSLKHLD  137



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  258  RKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV--------H  413
            RK        +A +L  FP  S   DEG+ LM++K SFSNVANVLLDW+ V         
Sbjct  7    RKEMLRFLVSMAFLLAFFPAVSSFSDEGRALMALKASFSNVANVLLDWNPVAAGGDANRS  66

Query  414  NEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDE  593
            ++D C+WRGV C N + +VVSLNLSNLNLGGEISPA+G+L++LQSIDL+GN+LTGQIPDE
Sbjct  67   SDDHCAWRGVVCDNLTSAVVSLNLSNLNLGGEISPAVGELKSLQSIDLKGNKLTGQIPDE  126

Query  594  IGNCISLILLD  626
            IG+ +SL  LD
Sbjct  127  IGDSVSLRHLD  137



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  LMSIK SFS+VANVLLDWD   NED CSWRGV+C N + SVVSLNLSNLNLGGEISP
Sbjct  18   GNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVNCDNITFSVVSLNLSNLNLGGEISP  77

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +IG L+ LQ++DL+GN+LTGQIPDEIGNC+SL  LD
Sbjct  78   SIGGLKVLQTLDLKGNRLTGQIPDEIGNCVSLKTLD  113



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M++K SF NVAN LLDWDD H+ DFC+WRGV C N S+SVVSLNLSNLNLGGEISPAIGD
Sbjct  1    MAVKASFINVANALLDWDDAHDGDFCAWRGVFCDNASLSVVSLNLSNLNLGGEISPAIGD  60

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LRNL SIDLQGN+LTGQIPDEIG+C  L+ LD
Sbjct  61   LRNLLSIDLQGNKLTGQIPDEIGDCSLLVYLD  92



>gb|KDO73636.1| hypothetical protein CISIN_1g0023492mg, partial [Citrus sinensis]
Length=168

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   115 bits (289),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +3

Query  273  ALACVLALILLSFPLTSCIG----DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            A+A ++ L++L+F   + +G    D+G TL+ IK+SF +V NVL DW    + DFC WRG
Sbjct  8    AMAFLVELVILAFLFCATVGVVDSDDGATLLEIKKSFRDVDNVLYDWTSSPSSDFCVWRG  67

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V+C N +++V+SLNLS LNL GEISP+IG+L++LQ++DL+GN L+GQIPDEIG+C SLI 
Sbjct  68   VTCDNATLNVISLNLSGLNLDGEISPSIGNLKSLQTLDLRGNGLSGQIPDEIGDCSSLIN  127

Query  621  LD  626
            +D
Sbjct  128  MD  129



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 17/122 (14%)
 Frame = +3

Query  312  PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHN-----------------EDFCSWRG  440
            P  S + DEG  L+S+K SFSNVAN+LLDW                      +D CSWRG
Sbjct  24   PPVSPLSDEGIALLSLKASFSNVANMLLDWTPAGAGAGAAAGGGSANATGDADDHCSWRG  83

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V C N + +V++LNLSNLNLGGEISPA+G+L+NLQSIDL+GNQLTGQIPDEIG+C++L  
Sbjct  84   VLCDNLTSAVIALNLSNLNLGGEISPAVGELKNLQSIDLKGNQLTGQIPDEIGDCVALKY  143

Query  621  LD  626
            LD
Sbjct  144  LD  145



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   115 bits (287),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +3

Query  273  ALACVLALILLSFPLTSCIG----DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            A+A ++ L++L+F   + +G    D+G TL+ IK+S+ +V NVL DW    + DFC WRG
Sbjct  8    AMALLVELVILAFLFCATVGVVDSDDGATLLEIKKSYRDVDNVLYDWTSSPSSDFCVWRG  67

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V+C N +++V+SLNLS LNL GEISP+IG+L++LQ++DL+GN L+GQIPDEIG+C SLI 
Sbjct  68   VTCDNATLNVISLNLSGLNLDGEISPSIGNLKSLQTLDLRGNGLSGQIPDEIGDCSSLIN  127

Query  621  LD  626
            +D
Sbjct  128  MD  129



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +3

Query  255  IRKMEFALACVLA--LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFC  428
            +RKM      VL   LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C
Sbjct  3    VRKMALFGDIVLLGFLICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYC  62

Query  429  SWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCI  608
             WRGVSC N + +VV+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C 
Sbjct  63   VWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCS  122

Query  609  SLILLD  626
            SL  LD
Sbjct  123  SLQNLD  128



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   114 bits (284),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
             +S + ++G TL+ IK+SF +V NVL DW D  + D+C+WRG++C N +  V++LNLS+L
Sbjct  18   FSSSVSNDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFDVIALNLSDL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLGGEISPAIGDL+++ SIDL+GN+LTGQIPDEIG C SL  LD
Sbjct  78   NLGGEISPAIGDLKSVLSIDLRGNRLTGQIPDEIGGCSSLKSLD  121



>ref|XP_006452987.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
 gb|ESR66227.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
Length=503

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILLS-FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  294  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  473
            LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C WRGVSC N + +VV
Sbjct  13   LICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVSCENVTFNVV  72

Query  474  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  73   ALNLSDLNLDGEISPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCSSLQNLD  123



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +V++LNLS LNL
Sbjct  28   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFNVIALNLSGLNL  87

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GEISPAIGDL+ L S+DL+GN+L+GQIPDEIG+C S+  LD
Sbjct  88   DGEISPAIGDLKGLLSVDLRGNRLSGQIPDEIGDCSSMSSLD  129



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +V++LNLS LNL
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFNVIALNLSGLNL  79

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GEISPAIGDL+ L S+DL+GN+L+GQIPDEIG+C S+  LD
Sbjct  80   DGEISPAIGDLKGLLSVDLRGNRLSGQIPDEIGDCSSMSSLD  121



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F L  +L L+ L      S   ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  1    MAFRLEFILLLVFLFCLSFGSVDSEDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +V++LNLS LNL GEISPA+GDL++LQSIDL+GN+L+GQIPDEIG+C SL  
Sbjct  61   ITCDNVTFTVIALNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKS  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 5/125 (4%)
 Frame = +3

Query  252  GIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCS  431
             +R   F LA VL L        S   D+G TL+ IK+SF +V NVL DW D  + D+C 
Sbjct  2    AVRVQFFFLALVLCL-----GFGSVTSDDGSTLLEIKKSFRDVGNVLYDWTDSPSSDYCV  56

Query  432  WRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCIS  611
            WRG++C N + +VV+LNLS LNL GEISPAIG+L++L SIDL+GN+L GQIPDEIG+C S
Sbjct  57   WRGITCDNATFNVVALNLSGLNLDGEISPAIGNLKDLVSIDLRGNRLAGQIPDEIGDCSS  116

Query  612  LILLD  626
            L  LD
Sbjct  117  LKSLD  121



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  294  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  473
            LI LSF  T+   DEG TL+ IK+SF +V NVL DW    + D+C WRGVSC N + +VV
Sbjct  13   LICLSFGSTAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVSCENVTFNVV  72

Query  474  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +LNLS+LNL GEISPAIGD ++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  73   ALNLSDLNLDGEISPAIGDFKSLLSIDLKGNRLSGQIPDEIGDCSSLQNLD  123



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILLS-FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F    V  L+LLS F + S   D+G T++ IK+SF +V NVL DW D    D+C+WRG
Sbjct  1    MAFEFGVVFVLVLLSCFNVNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +VV+LNLS LNL GEISP IG L++L SIDL+ N+L+GQIPDEIG+C  L  
Sbjct  61   ITCDNVTFNVVALNLSGLNLDGEISPTIGKLQSLVSIDLKQNRLSGQIPDEIGDCSLLQT  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +3

Query  264  MEFALACVLALILLSFP--LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWR  437
            M F LA VLA+ L+ F   L  C  D+G TL+ +K+SF +V NVL DW D  + D+C WR
Sbjct  1    MAFRLALVLAVSLVCFSSGLVDC--DDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWR  58

Query  438  GVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLI  617
            GVSC N + +VV++NL+ LNL GEISP++GDL+ L S+DL  N+L+GQIPDEIG+C SL 
Sbjct  59   GVSCDNVTFNVVAINLTGLNLDGEISPSVGDLKGLLSLDLSSNRLSGQIPDEIGDCSSLT  118

Query  618  LLD  626
             LD
Sbjct  119  SLD  121



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            K LM++K  F N AN L+DWD     D C+WRGV+C N S +V +LNLSNLNLGGEISPA
Sbjct  42   KALMAVKAGFGNSANALVDWDG--GGDHCAWRGVTCDNASFAVAALNLSNLNLGGEISPA  99

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LD
Sbjct  100  IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLD  134



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            DEG TL+ IK+SF +  NVL DW D  + D+C+WRGV+C N + +V++LNLS+LNL GEI
Sbjct  25   DEGATLLEIKKSFRDEDNVLYDWRDSPSLDYCAWRGVTCDNVTFNVIALNLSSLNLDGEI  84

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +PAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  85   APAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRYLD  122



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LD
Sbjct  95   IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLD  129



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            K LM +K  F N AN L+DWD     D C+WRGVSC N S +V++LNLS+LNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVSCENASFAVLALNLSDLNLGGEISPA  94

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG+L+NLQ +DL+GN+L+GQIPDEIG+CISL  LD
Sbjct  95   IGELKNLQFVDLKGNKLSGQIPDEIGDCISLQYLD  129



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG+L+NLQ +DL+GN+LTGQIPDEIG+CISL  LD
Sbjct  95   IGELKNLQFVDLKGNKLTGQIPDEIGDCISLKYLD  129



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV+C N + +V++LNLS LNL GEI
Sbjct  24   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVTCDNVTFNVIALNLSGLNLDGEI  83

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  84   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLD  121



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  330  GDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            G +G+ LM +K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGE
Sbjct  31   GGDGEALMDVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGE  88

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            ISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LD
Sbjct  89   ISPAIGELKTLQFLDLKGNKLTGQIPDEIGDCVSLKYLD  127



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDE-GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfs  461
            VL   L+ F   S +  E G TL+ IK+SF +V NVL DW    + D+C WRGVSC N +
Sbjct  12   VLVGFLICFSFASTVNSEDGATLLEIKKSFKDVNNVLYDWTSSPSSDYCVWRGVSCDNVT  71

Query  462  msvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             +VV+LNLS+LNL GEISPAIGDL+NL SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  72   FNVVALNLSDLNLDGEISPAIGDLKNLFSIDLRGNRLSGQIPDEIGDCSSLQNLD  126



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   108 bits (269),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  246  FPGIRKMEFALACVLALILL---SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHN  416
            F G   M F +  VL ++LL   SF       D+G+TL+ IK++F +V NVL +W D  +
Sbjct  3    FDGRAVMAFRVEFVLLILLLGCVSFGYGDSRNDQGRTLLGIKKAFRDVDNVLYEWTDSPS  62

Query  417  EDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEI  596
             D+C WRGV+C N    +          GGEIS  IGDL  LQSIDL+GN+L+GQIPDEI
Sbjct  63   LDYCVWRGVTCDNSLNVIALNLSGLNL-GGEISSVIGDLETLQSIDLRGNRLSGQIPDEI  121

Query  597  GNCISLILLD  626
            G+C +L  LD
Sbjct  122  GDCAALQNLD  131



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   108 bits (269),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            + F + S   D+G TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LN
Sbjct  15   ICFNVNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALN  74

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SLI LD
Sbjct  75   LSGLNLEGEISPAIGSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLD  122



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   108 bits (269),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            + F + S   D+G TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LN
Sbjct  15   ICFNVNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALN  74

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SLI LD
Sbjct  75   LSGLNLEGEISPAIGSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLD  122



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +3

Query  294  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  473
            L+ LSF   S   D+G TL+ IK+SF +V NVL DW D  + D C WRGV+C N + +VV
Sbjct  22   LVCLSFGTVSS--DDGATLLEIKKSFKDVNNVLYDWTDSSSSDCCVWRGVTCDNVTFNVV  79

Query  474  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +LNLS L+L GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL +LD
Sbjct  80   ALNLSGLSLDGEISPAIGDLKSLVSIDLRGNRLSGQIPDEIGDCSSLQMLD  130



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = +3

Query  264  MEFALACVLALILLS-FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            M F    V  L+LLS F + S   D+G T++ IK+SF +V NVL DW D    D+C+WRG
Sbjct  1    MAFEFGVVFVLVLLSCFNVNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRG  60

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            ++C N + +VV+LNLS LNL GEISP IG L++L SIDL+ N+L+GQIPDEIG+C  L  
Sbjct  61   ITCDNVTFNVVALNLSGLNLDGEISPTIGKLQSLVSIDLKQNRLSGQIPDEIGDCSLLQT  120

Query  621  LD  626
            LD
Sbjct  121  LD  122



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  294  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  473
            LI LSF  T+   D G TL+ IK+SF +V NVL DW    + D+C+WRGV+C N + +VV
Sbjct  13   LICLSFG-TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCAWRGVTCDNVTFNVV  71

Query  474  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  72   ALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLD  122



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVICDNVTFNVIALNLSGLNLDGEI  91

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  92   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLD  129



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVICDNVTFNVIALNLSGLNLDGEI  91

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIG+L+ LQSIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  92   SPAIGNLKGLQSIDLRGNRLSGQIPDEIGDCSSLRNLD  129



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  464
            VL + L      S   ++G TL+ IK+SF +V NVL DW D     +CSWRG++C N + 
Sbjct  8    VLLVFLAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITCDNVTF  67

Query  465  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +VV+LNLS LNLGGEISPAIGDL++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  68   NVVALNLSGLNLGGEISPAIGDLKSLLSIDLRENLLSGQIPDEIGDCSSLKSLD  121



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + D+G TL+ IK+SF +V NVL DW D  + D+C+WRGV+C N + ++VSLNLS+LNL
Sbjct  31   SVLSDDGSTLLEIKKSFMDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNIVSLNLSSLNL  90

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GE+SPA+G L++L SIDL+GN+LTGQIPDEIG+C +L  LD
Sbjct  91   DGELSPAVGQLKDLISIDLRGNRLTGQIPDEIGDCSALKNLD  132



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +3

Query  291  ALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsv  470
            +LI LSF  T+   D G TL+ IK+SF +V NVL DW    + D+C WRGV+C N + +V
Sbjct  12   SLICLSFG-TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCVWRGVTCDNVTFNV  70

Query  471  vslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            V+LNLS+LNL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  71   VALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLD  122



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  464
            VL + L      S   ++G TL+ IK+SF +V NVL DW D     +CSWRG++C N + 
Sbjct  8    VLLVFLAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITCDNVTF  67

Query  465  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +VV+LNLS LNLGGEISPAIGDL++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  68   NVVALNLSGLNLGGEISPAIGDLKSLLSIDLRENLLSGQIPDEIGDCSSLKSLD  121



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            ++EF    +++L  L F       ++G TL+ IK+SF +V NVL DW D  + D+C WRG
Sbjct  7    RLEFIF--LVSLFYLGFAFVD--SEDGATLLEIKKSFRDVDNVLYDWADTPSSDYCVWRG  62

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V+C N + +VV+LNLS LNL GEISPAIG+L++L ++DL+GN L+GQIPDEIG+C SL  
Sbjct  63   VTCDNVTFNVVALNLSGLNLDGEISPAIGNLKDLLTVDLRGNSLSGQIPDEIGDCSSLKS  122

Query  621  LD  626
            LD
Sbjct  123  LD  124



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M F    ++  +L+   + S   D+G TL+ IK+SF +V NVL DW D  + D+C+WRG+
Sbjct  1    MAFRFGVLILALLICLSVNSVESDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGI  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            +C N + +VV+LNLS LNL GEISPAIG L +L SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  61   ACDNVTFNVVALNLSGLNLDGEISPAIGKLHSLVSIDLRENRLSGQIPDEIGDCSSLKNL  120

Query  624  D  626
            D
Sbjct  121  D  121



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  327  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            + D+G TL+ IK+SF +V NVL DW D  + D+C+WRGV+C N + ++VSLN S+LNL G
Sbjct  33   VSDDGSTLLEIKKSFRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNIVSLNFSSLNLDG  92

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            E+SPAIG L+ L SIDL+GN+LTGQIPDEIG+C +L  LD
Sbjct  93   ELSPAIGQLKGLISIDLRGNRLTGQIPDEIGDCSALKNLD  132



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF +V NVL DW D  + D+C WRGV C N + +V++LNLS LNL GEI
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVICDNVTYNVIALNLSGLNLEGEI  83

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIG+L++L SIDL+GN+L+GQIPDE+G+C SL  LD
Sbjct  84   SPAIGNLKDLTSIDLKGNRLSGQIPDEMGDCSSLQDLD  121



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  32   DDGSTLLEIKKSFRNVGNVLYDW---AGDDYCSWRGVVCDNVTFAVAALNLSGLNLGGEI  88

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  89   SPAVGSLKSLSSIDLKSNGLSGQIPDEIGDCSSLRTLD  126



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  32   DDGSTLLEIKKSFRNVGNVLYDW---AGDDYCSWRGVVCDNVTFAVAALNLSGLNLGGEI  88

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  89   SPAVGSLKSLSSIDLKSNGLSGQIPDEIGDCSSLRTLD  126



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M F    ++  +++     S   D+G TL+ IK+SF +V NVL DW D  + D+C+WRG+
Sbjct  1    MAFRFGVLILALVICLNFNSVESDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGI  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            SC N + +VV+LNLS LNL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  61   SCDNVTFNVVALNLSGLNLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNL  120

Query  624  D  626
            D
Sbjct  121  D  121



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + +   +EG TL+ IK+SF +V NVL DW    + D+C WRGVSC N + +VV+LNLS+L
Sbjct  19   VATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDL  78

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NL GEISPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  79   NLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLD  122



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            DEG TL+ IK+SF +V NVL DW    + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  25   DEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTCENVTFNVVALNLSDLNLDGEI  84

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  85   SPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLD  122



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  327  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            +GD+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL G
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEG  81

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPA+G L++L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  82   EISPAVGSLKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  121



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   105 bits (261),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  327  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            +GD+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL G
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEG  81

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPA+G L++L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  82   EISPAVGSLKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  121



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            DEG TL+ IK+SF +V NVL DW    + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  25   DEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTCENVTFNVVALNLSDLNLDGEI  84

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDL++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  85   SPAIGDLKSLLSIDLKGNRLSGQIPDEIGDCSSLQDLD  122



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   105 bits (261),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
            +G TLM IK+SF NV NVL DW +    D+CSWRGV+C N + ++V+LNLS LNL G+IS
Sbjct  30   DGATLMEIKKSFRNVDNVLYDWTEATGSDYCSWRGVTCDNTTFNIVALNLSGLNLDGDIS  89

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            PA G+L+ + SIDL+ N+L+GQIPDEIG+C SL +LD
Sbjct  90   PAFGNLKGIVSIDLKANRLSGQIPDEIGDCSSLKVLD  126



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            M F +  V   +LL         D+G TL+ +K+SF +V NVL DW D  + D+C WRGV
Sbjct  1    MAFRVEVVFLALLLCLGFGFVDSDDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWRGV  60

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            +C N + +V++LNLS LNL GEISPAIG+L+++ SIDL+GN L+GQIPDEIG+C SL  L
Sbjct  61   TCDNATFNVIALNLSGLNLDGEISPAIGNLKDIVSIDLRGNLLSGQIPDEIGDCSSLKSL  120

Query  624  D  626
            D
Sbjct  121  D  121



>gb|AFW86034.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1007

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  330  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            GD +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGG
Sbjct  29   GDGDGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGG  86

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  87   EISPAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  126



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  294  LILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvv  473
            LI LSF  T+   D G TL+ IK+SF +V N+L DW    + D+C WRGV+C N + +VV
Sbjct  13   LICLSFG-TTVNSDNGATLLEIKKSFKDVNNILYDWTSSPSSDYCVWRGVTCENVTFNVV  71

Query  474  slnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +LNLS+LNL GEISPAIGDL++L SIDL GN+L+GQIPDEIG+C SL  LD
Sbjct  72   ALNLSDLNLDGEISPAIGDLKSLLSIDLGGNRLSGQIPDEIGDCSSLQNLD  122



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            L+F    C  D+G  L+ IK SF +V NVL DW D  + D+C+WRGV+C N + +VV+LN
Sbjct  25   LNFASVDC--DDGTVLLEIKRSFRDVENVLYDWIDSPSSDYCAWRGVTCDNVTFNVVALN  82

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LS LNL GEISPAIG L+ L SIDL+GN+L+GQIPDEIG+C +LI LD
Sbjct  83   LSGLNLDGEISPAIGQLKGLLSIDLRGNRLSGQIPDEIGDCSALISLD  130



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  288  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  452
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  453  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            N + +VV+LNLS LNL GEI+PA G+L+ L SIDL+ N+L+GQIPDEIG+C SL +LD
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSIDLKANRLSGQIPDEIGDCSSLKVLD  126



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score =   103 bits (258),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +3

Query  330  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            GD E + LM++K  F N AN L+DWD     D C+WRGV+C + S +VV LNLSNLNLGG
Sbjct  27   GDGERRALMAVKAGFGNAANALVDWDG--GRDHCAWRGVACDSASFAVVGLNLSNLNLGG  84

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPAIG+L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  85   EISPAIGELKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  124



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 86/121 (71%), Gaps = 4/121 (3%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGV  443
            +EF    +++L  L F       ++G TL+ IK+SF +V NVL DW D  + D+C WRGV
Sbjct  8    LEFVF--LVSLFCLGFAFVD--SEDGTTLLEIKKSFKDVDNVLYDWTDTPSSDYCVWRGV  63

Query  444  SCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            +C N + +VV+LNLS LNL GEIS AIG L++L +IDL+GN+L+GQIPDEIG+C SL  L
Sbjct  64   TCDNVTFNVVALNLSGLNLDGEISTAIGKLKDLVTIDLRGNRLSGQIPDEIGDCSSLKSL  123

Query  624  D  626
            D
Sbjct  124  D  124



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            +SF       D+G+TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   VSFGYGDSQNDQGRTLLGIKKAFRDVDNVLYEWTDSPSLDYCVWRGVTCDNSLNVIALNL  84

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
                  GGEIS  IGDL +LQSIDL+GN L+GQIPDEIG+C +L  LD
Sbjct  85   SGLNL-GGEISSVIGDLESLQSIDLRGNHLSGQIPDEIGDCXALXNLD  131



>gb|AFW86031.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=944

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  330  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            GD +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGG
Sbjct  29   GDGDGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGG  86

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  87   EISPAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  126



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  330  GD-EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            GD +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGG
Sbjct  29   GDGDGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGG  86

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISPAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  87   EISPAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  126



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  300  LLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsl  479
            L+ F   S + D+G  L+ IK+S  +V NVL DW D  + D+C+WRGV+C N + +VV L
Sbjct  22   LIFFSFGSVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNVVQL  81

Query  480  nlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLS+LNL GE+SPAIG L+ L SID++GN+L+GQIPDEIG+C +L  LD
Sbjct  82   NLSSLNLDGELSPAIGQLKGLVSIDMRGNRLSGQIPDEIGDCSALKNLD  130



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            +SF       D+G+TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   MSFGNGDSQNDQGRTLLEIKKAFRDVDNVLYEWTDQPSLDYCVWRGVTCDNSLNVIALNL  84

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
                  GGEIS  IGDL NLQSIDL+GN+L+GQIPDEIG+C +L  +D
Sbjct  85   SGLNL-GGEISSVIGDLENLQSIDLRGNRLSGQIPDEIGDCSALQNID  131



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDW-DDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG+C SL  LD
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIGDCTSLKTLD  121



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  300  LLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsl  479
            LL F   S   D+G TL+ IK+SF +V NVL DW D  + D C WRGV+C N + +VV+L
Sbjct  23   LLCFSFGSVDSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVTCDNVTFNVVAL  82

Query  480  nlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NLS LNL GEISPA+G L+ L SIDL+GN+L+GQIPDEIG+C +L  LD
Sbjct  83   NLSGLNLDGEISPAVGHLKALLSIDLRGNRLSGQIPDEIGDCSALTSLD  131



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + D+G  L+ IK+S  +V NVL DW D  + D+C+WRGV+C N + +VV LNLS+LNL
Sbjct  29   SVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTCDNVTFNVVQLNLSSLNL  88

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GE+SPAIG L+ L SID++GN+L+GQIPDEIG+C +L  LD
Sbjct  89   DGELSPAIGQLKGLISIDVRGNRLSGQIPDEIGDCSALKNLD  130



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            +TLM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEISPA
Sbjct  31   QTLMAVKAGFGNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEISPA  88

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  89   IGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  123



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M++K  F N AN L+DWD    + +C+WRGV+C N S +V++LNLSNLNLGGEISPA+G+
Sbjct  1    MAVKAGFGNAANALVDWDG-GRDHYCAWRGVTCDNASFAVLALNLSNLNLGGEISPAVGE  59

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L++LQ +DL+GN+LTGQIPDEIG+C+SL  LD
Sbjct  60   LKSLQLVDLKGNKLTGQIPDEIGDCVSLKYLD  91



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = +3

Query  267  EFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            ++ L   L + L S  + S   D+G  L+ +K+SF +V NVL DW D  + D+C WRG++
Sbjct  21   QYVLVGFLVVFLNSASVDS---DDGAILLEVKKSFRDVDNVLYDWTDTPSSDYCVWRGIT  77

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            C N + +VV+LNLS LNL GEISPA G L+ L SIDL+GN+L+GQIPDEIG+C +L  LD
Sbjct  78   CDNVTFNVVALNLSGLNLDGEISPAFGHLKGLVSIDLRGNRLSGQIPDEIGDCSALESLD  137



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score =   102 bits (253),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            M++K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGEISPAIG+
Sbjct  38   MAVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGEISPAIGE  95

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LD
Sbjct  96   LKALQFVDLKGNRLTGQIPDEIGDCVSLKYLD  127



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   101 bits (252),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = +3

Query  231  VEKVLFPGIRKMEFALACVLAL--ILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            +E   F G ++   +L  ++ L  +LLS  L S   D+G TL+ IK+S  +V NVL DW 
Sbjct  1    MEVGFFSGFQQWRHSLVTLVILTSVLLS-SLGSVDSDDGVTLLEIKKSIRDVDNVLYDWS  59

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
            D  + D+C WRGV+C N + ++V+LNLS LNL GEIS +IGDL++L SIDL  N+L+GQI
Sbjct  60   DSPSADYCVWRGVTCDNATFNIVALNLSGLNLDGEISSSIGDLKSLLSIDLSRNRLSGQI  119

Query  585  PDEIGNCISLILLD  626
            PDEIG+C  L  LD
Sbjct  120  PDEIGDCSPLKSLD  133



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S   D+G TL+ IK+SF +V NVL DW D  + D C WRGV C N +  V++LNLS LNL
Sbjct  20   SVHSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVICDNVTYYVIALNLSGLNL  79

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GEISPAIG+L++L SIDL+GN+L+GQIPDEIG+C SL  LD
Sbjct  80   EGEISPAIGNLKDLTSIDLKGNRLSGQIPDEIGDCSSLQDLD  121



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 5/117 (4%)
 Frame = +3

Query  285  VLALILLSFPLTSCI-GD--EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  455
            +++L+LL     SC+ GD  EG TL+ IK+SF NV NVL DW D  + D CSWRGV C N
Sbjct  8    IVSLVLLGS--LSCVCGDTSEGATLVEIKKSFRNVDNVLYDWADDPSSDHCSWRGVICDN  65

Query  456  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             + SVV+LNLS LNL GEISPAIG+L+ L SIDL+ N+L+GQIPDEIG C SL  LD
Sbjct  66   VTFSVVALNLSGLNLDGEISPAIGNLKALVSIDLKANRLSGQIPDEIGACSSLKTLD  122



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            D+G+TL+ IK+SF NV NVL DW  D   + +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  35   DDGRTLLEIKKSFRNVDNVLYDWSGDGAPQRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  94

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            ISPAIG+L+++ SID + N+L+GQIPDEIG+C SL  LD
Sbjct  95   ISPAIGNLKSVVSIDFKSNELSGQIPDEIGDCTSLKTLD  133



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEI
Sbjct  21   DDGATLVEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEI  77

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  78   SPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD  115



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score =   101 bits (251),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  TLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAI  524
            TL+ IK+SF +V NVL DW +    D+C+WRG+SC N + +VV+LNLS LNL GEISPAI
Sbjct  4    TLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISCDNVTFNVVALNLSGLNLEGEISPAI  63

Query  525  GDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            G L++L SIDL+ N+L+GQIPDEIG+C SLI LD
Sbjct  64   GSLQSLVSIDLKENRLSGQIPDEIGDCSSLISLD  97



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIGDCTSLKTL  120



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            D+G+TL+ IK+SF NV NVL DW  D     +CSWRGV C N + +V +LNLS LNLGGE
Sbjct  23   DDGQTLLEIKKSFRNVDNVLYDWAGDGAPRRYCSWRGVLCDNVTFAVAALNLSGLNLGGE  82

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            ISPAIG+L++++SIDL+ N+L+GQIPDEIG+C SL  L
Sbjct  83   ISPAIGNLKSVESIDLKSNELSGQIPDEIGDCTSLKTL  120



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEI
Sbjct  29   DDGATLVEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEI  85

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  86   SPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD  123



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEISP IG
Sbjct  41   LMAVKAGFGNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEISPVIG  98

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             L+NLQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  99   QLKNLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  131



>gb|AFW86032.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=508

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
            +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEIS
Sbjct  32   DGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEIS  89

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            PAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  90   PAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  126



>gb|AFW86033.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=550

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
            +G+ LM++K  F N AN L DWD     D C+WRGV+C   S +VV LNLSNLNLGGEIS
Sbjct  32   DGQALMAVKAGFRNAANALADWDG--GRDHCAWRGVACDAASFAVVGLNLSNLNLGGEIS  89

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            PAIG L++LQ +DL+ N+LTGQIPDEIG+C+SL  LD
Sbjct  90   PAIGQLKSLQFVDLKLNKLTGQIPDEIGDCVSLKYLD  126



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK++F +V NVL DW    + ++CSWRG++C N +  VVSLNLS LNL GEI
Sbjct  35   DDGATLLEIKKAFRDVDNVLYDWTGASSSEYCSWRGITCDNMTFDVVSLNLSGLNLDGEI  94

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIG+L+ L SIDL+GN L GQIPDEIG C SL  LD
Sbjct  95   SPAIGNLKGLLSIDLRGNHLLGQIPDEIGGCSSLTSLD  132



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDW---AGGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            SPA+G L+ + SIDL+ N L+GQIPDEIG+C SL
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSL  115



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = +3

Query  303  LSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvsln  482
            +SF       D+G TL+ IK++F +V NVL +W D  + D+C WRGV+C N    +    
Sbjct  25   MSFGYGDSQNDQG-TLLEIKKAFRDVDNVLYEWTDPPSLDYCVWRGVTCDNSLNVIALNL  83

Query  483  lsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
                  GGEIS  IGDL NLQSIDL+GN L+GQIPDEIG+C +L  +D
Sbjct  84   SGLNL-GGEISSVIGDLENLQSIDLRGNHLSGQIPDEIGDCSALQNID  130



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S   D+G TL+ +K+ F +V NVL DW D  + D+C+WRG++C N + +VV+LNLS L
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFNVVALNLSGL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  LD
Sbjct  78   NLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNLD  121



>ref|XP_007161048.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33042.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=744

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +3

Query  315  LTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnl  494
            + S   D+G TL+ +K+ F +V NVL DW D  + D+C+WRG++C N + +VV+LNLS L
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITCDNVTFNVVALNLSGL  77

Query  495  nlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            NL GEISPAIG L++L SIDL+ N+L+GQIPDEIG+C SL  LD
Sbjct  78   NLDGEISPAIGKLQSLVSIDLRENRLSGQIPDEIGDCSSLKNLD  121



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  26   DDGSTLLEIKKSFRNVDNVLYDWAGA---DYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  82

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L+NL S+DL+ N L+GQIPDEIG+C SL  +D
Sbjct  83   SPAVGRLKNLVSMDLELNGLSGQIPDEIGDCSSLKTVD  120



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
            +G+TL+ IK+SFS+V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEIS
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEIS  85

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            P IG L +L SID + N+L+GQIPDE+G+C SL  +D
Sbjct  86   PVIGRLNSLVSIDFKENRLSGQIPDELGDCSSLKSID  122



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
            +G+TL+ IK+SFS+V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEIS
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEIS  85

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            P IG L +L SID + N+L+GQIPDE+G+C SL  +D
Sbjct  86   PVIGRLNSLVSIDFKENRLSGQIPDELGDCSSLKSID  122



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = +3

Query  300  LLSFPLTS-CIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvs  476
            L++F L +    D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +
Sbjct  14   LIAFLLVAGAAADDGSTLLEIKKSFRNVDNVLYDWA---GGDYCSWRGVLCDNVTFAVAA  70

Query  477  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            LNLS LNLGGEISPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  71   LNLSGLNLGGEISPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLD  120



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDWA---GGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLD  119



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            D+G TL+ IK+SF NV NVL DW      D+CSWRGV C N + +V +LNLS LNLGGEI
Sbjct  25   DDGSTLLEIKKSFRNVDNVLYDWA---GGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEI  81

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPA+G L+ + SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  82   SPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLD  119



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  TLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAI  524
            TL+ +K+SF +V NVL DW +  + D+C WRG+ C N + +VV+LNLS LNL GEISPAI
Sbjct  32   TLVEVKKSFRDVDNVLYDWTESPSSDYCVWRGILCDNVTFNVVALNLSGLNLDGEISPAI  91

Query  525  GDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            G L+ L SIDL+GN+LTGQIPDEIG+C +L  LD
Sbjct  92   GLLKGLVSIDLRGNRLTGQIPDEIGDCSNLESLD  125



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  L+ +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISP
Sbjct  12   GAALLEVKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISP  68

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            A+G L++L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  69   AVGALKSLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  104



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G+TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL GEISP
Sbjct  27   GETLLEIKKWFRDVDNVLYDWTDSTSSDYCVWRGVTCDNVTFNVVALNLSGLNLEGEISP  86

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            AIG L +L SID + N+L+GQIPDE+G+C SL  +D
Sbjct  87   AIGRLNSLISIDFKENRLSGQIPDELGDCSSLKSID  122



>gb|EPS61595.1| hypothetical protein M569_13200, partial [Genlisea aurea]
Length=612

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  327  IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGG  506
            I  EG+TL  I++S  +V +VL DW D  + D+C+WRGVSC N + SVV+LNLS LNL G
Sbjct  1    IRGEGETLREIQKSIRDVNSVLYDWSDSPSSDYCAWRGVSCDNVTFSVVALNLSGLNLEG  60

Query  507  EISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            EISP+IG L+ L SIDL+ N L+GQIPDEIG+C +L  LD
Sbjct  61   EISPSIGKLKALVSIDLKANLLSGQIPDEIGDCSALKSLD  100



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            ++ IK+SF +V NVL DW D    D+C+WRG++C N + +VV+LNLS LNL GEISP IG
Sbjct  1    MLEIKKSFRDVDNVLYDWTDSPTSDYCAWRGITCDNVTFNVVALNLSGLNLDGEISPTIG  60

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             L++L SIDL+ N+L+GQIPDEIG+C  L  LD
Sbjct  61   KLQSLVSIDLKQNRLSGQIPDEIGDCSLLQTLD  93



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD  128



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDW---AGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD  128



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  L+ IK+S +N  NVL DW+   + D C WRGVSC N +++V+ LNL+ L L GEISP
Sbjct  14   GVVLLEIKKSLNNADNVLYDWEGAIDRDPCFWRGVSCDNVTLAVIGLNLTQLGLSGEISP  73

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            A G L++LQ +DL+ N L+GQIPDEIG C++L  +D
Sbjct  74   AFGRLKSLQYLDLRENSLSGQIPDEIGQCVNLKTID  109



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S    +G TL  +K+S  +V NVL DW D  + D+C WRGV+C N + +VV+LNLS LNL
Sbjct  17   SVNSQDGATLWEMKKSLRDVDNVLFDWTDTPSSDYCLWRGVTCDNVTYNVVALNLSGLNL  76

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             GEISPA+G L +L SIDL+ N+L+GQIPDE+G+C SL  +D
Sbjct  77   EGEISPALGRLSSLVSIDLKENRLSGQIPDELGDCSSLKNVD  118



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  90

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  120



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  121



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 88/140 (63%), Gaps = 27/140 (19%)
 Frame = +3

Query  288  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  452
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  453  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSI----------------------DLQGN  566
            N + +VV+LNLS LNL GEI+PA G+L+ L S+                      DL+ N
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSMYDLPSSVCFQDVDLSFLVSSFSDLKAN  128

Query  567  QLTGQIPDEIGNCISLILLD  626
            +L+GQIPDEIG+C SL +LD
Sbjct  129  RLSGQIPDEIGDCSSLKVLD  148



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 88/140 (63%), Gaps = 27/140 (19%)
 Frame = +3

Query  288  LALILLSFPLTSCI-GD----EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCG  452
            LAL++L   L+S + GD    +G TL+ IK+SF NV NVL DW +    D+CSWRGV+C 
Sbjct  9    LALLVLFGVLSSAVVGDTGTNDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTCD  68

Query  453  nfsmsvvslnlsnlnlGGEISPAIGDLRNLQSI----------------------DLQGN  566
            N + +VV+LNLS LNL GEI+PA G+L+ L S+                      DL+ N
Sbjct  69   NITFNVVALNLSGLNLDGEIAPAFGNLKGLVSMYDLPSSVCFQDVDLSFLVSSFSDLKAN  128

Query  567  QLTGQIPDEIGNCISLILLD  626
            +L+GQIPDEIG+C SL +LD
Sbjct  129  RLSGQIPDEIGDCSSLKVLD  148



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  121



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  L+ IK+SFSN  N L DWD   + D C WRGV+C N ++SV  LNL+ L+L G ISP
Sbjct  1    GAVLLEIKKSFSNAGNALYDWDGSADHDPCFWRGVTCDNVTLSVTGLNLTQLSLSGVISP  60

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            ++G L++LQ +DL+ N + GQIPDEIG+C  L  +D
Sbjct  61   SVGKLKSLQYLDLRENSIGGQIPDEIGDCAVLKYID  96



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVTALNLSGLNLEGEISPAVGVLK  90

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  120



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVTALNLSGLNLEGEISPAVGVLK  90

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  120



>gb|AFW76644.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=898

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGD  530
            + IK+SF NV NVL DW     +D+CSWRGV C N + +V +LNLS LNL GEISPA+G 
Sbjct  40   VEIKKSFRNVGNVLYDWA---GDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGS  96

Query  531  LRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            L++L SIDL+ N L+GQIPDEIG+C SL  LD
Sbjct  97   LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD  128



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  L+ IK+SFSN  N L DWD   + D C WRGV+C N ++SV  LNL+ L+L G ISP
Sbjct  1    GAVLLEIKKSFSNAGNALYDWDGSADHDPCFWRGVTCDNVTLSVTGLNLTQLSLSGVISP  60

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            ++G L++LQ +DL+ N + GQ+PDEIG+C  L  +D
Sbjct  61   SVGKLKSLQYLDLRENSIGGQVPDEIGDCAVLKYID  96



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISP  518
            G  L+ IK+S +N  NVL DW+   + D C WRGVSC N +++V+ LNL+ L L GEISP
Sbjct  14   GVVLLEIKKSLNNADNVLYDWEGAIDRDPCFWRGVSCDNVTLAVIGLNLTQLGLSGEISP  73

Query  519  AIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            A G L++LQ +DL+ N L+GQIPDEIG C++L  +D
Sbjct  74   AFGRLKSLQYLDLRENSLSGQIPDEIGQCVNLKTID  109



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LD
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLD  124



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LD
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLD  124



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEI  512
            ++G TL+ IK+ F +V NVL DW D  + D+C WRGV+C N + +VV+LNLS+LNL GEI
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTCDNVTFNVVALNLSDLNLDGEI  86

Query  513  SPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            SPAIGDLR+L S+DL+GN+L+GQIPDE+G+C SL  LD
Sbjct  87   SPAIGDLRDLLSLDLRGNRLSGQIPDEMGDCSSLKSLD  124



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +3

Query  333  DEGKTLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGE  509
            D+G+TL+ IK+SF +  N L DW  D  +  +CSWRGV C N + +V +LNLS LNL GE
Sbjct  25   DDGETLLEIKKSFRDGGNALYDWSGDGASPGYCSWRGVLCDNVTFAVAALNLSGLNLEGE  84

Query  510  ISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IS AIG L+ L SIDL+ N L+GQIPDEIG+C  L  LD
Sbjct  85   ISAAIGSLQRLVSIDLKSNGLSGQIPDEIGDCSLLETLD  123



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS LNL GEISPA+G L+
Sbjct  35   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGALK  91

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  92   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  121



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            L+ +K+SF +V NVL DW D  + D C WRGV+C N + +V++LNLS LNL GEIS +IG
Sbjct  3    LVEVKKSFRDVDNVLYDWTDSPSSDCCVWRGVTCDNVTFNVLALNLSGLNLEGEISSSIG  62

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             L+ L ++DL+GN+L+GQIPD+IG+C SLI LD
Sbjct  63   QLKALLTLDLKGNRLSGQIPDDIGDCSSLISLD  95



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +3

Query  357  IKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLR  536
            +K+SF NV NVL DW     +D CSWRGV C N + +V +LNLS  NL GEISPA+G L+
Sbjct  34   VKKSFRNVGNVLYDWS---GDDHCSWRGVLCDNVTFAVAALNLSGFNLEGEISPAVGALK  90

Query  537  NLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L SIDL+ N LTGQIPDEIG+C S+  LD
Sbjct  91   SLVSIDLKSNGLTGQIPDEIGDCSSIKTLD  120



>ref|XP_010109086.1| hypothetical protein L484_012962 [Morus notabilis]
 gb|EXC20886.1| hypothetical protein L484_012962 [Morus notabilis]
Length=107

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 72/131 (55%), Gaps = 24/131 (18%)
 Frame = +3

Query  231  VEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDV  410
            +E+  F   RK +     V+AL+LL  P+ S + DEGK LM+IK SFSNVANVLL W+D 
Sbjct  1    MEENAFLQWRKKDTNFLVVMALLLLLTPIASPLNDEGKALMAIKASFSNVANVLLGWNDD  60

Query  411  HNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPD  590
            H+ DFCSWRGV C N S+                        ++ S++L+ NQLTG IP 
Sbjct  61   HDGDFCSWRGVICDNVSL------------------------SVVSLNLKNNQLTGPIPS  96

Query  591  EIGNCISLILL  623
             +    +L  L
Sbjct  97   TLSQIPNLKTL  107



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +3

Query  351  MSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            M IK+SF +  N L DW  D  +  +CSWRGV C N +  V +LNLS  NLGGEISPAIG
Sbjct  1    MEIKKSFHDADNALDDWSGDGASPGYCSWRGVLCDNVTFQVAALNLSGFNLGGEISPAIG  60

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            DL++  SID Q + L+GQIPDEIG+C SL +L
Sbjct  61   DLKSGVSIDFQSSGLSGQIPDEIGDCSSLKML  92



>gb|EEE65024.1| hypothetical protein OsJ_19993 [Oryza sativa Japonica Group]
Length=908

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            K LM +K  F N AN L+DWD     D C+WRGV+C N S +V++LNLSNLNLGGEISPA
Sbjct  37   KALMGVKAGFGNAANALVDWDG--GADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPA  94

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEI  596
            IG+L+NLQ +DL GN L G IP  I
Sbjct  95   IGELKNLQFVDLSGNLLYGDIPFSI  119



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +3

Query  345  TLMSIKESFSNVANVLLDWD-DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            TL+ IK+SFSN  N L DW  +  +  +CSWRGV C N + +V +LNLS LNL GEISPA
Sbjct  25   TLLEIKKSFSNGGNALHDWSGEGASPTYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPA  84

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNC  605
            IG L+ + SIDL+ N L+GQIPDEIG+C
Sbjct  85   IGSLKRVISIDLKSNGLSGQIPDEIGDC  112



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 64/124 (52%), Gaps = 24/124 (19%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            ++ M F +  VL   L      S   D+G TL+ IK+SF +V N L DW D  + D+C W
Sbjct  15   LKVMAFPVEFVLLAFLACAAFGSVDSDDGVTLLEIKKSFRDVDNDLYDWADSPSSDYCGW  74

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV+C N +                         ++ S+D +GN+L+GQIPDEIG+C SL
Sbjct  75   RGVTCDNVTF------------------------SVVSLDFRGNRLSGQIPDEIGDCSSL  110

Query  615  ILLD  626
              LD
Sbjct  111  TNLD  114



>ref|XP_001763775.1| ERL2a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ71417.1| ERL2a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=948

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            L+ +K  F N    L DW +  ++  C WRGV+C N +  V +LN+S L L GEISPAIG
Sbjct  2    LIELKRVFENGELELYDWSE-GSQSPCHWRGVTCDNTTFLVTNLNISVLALSGEISPAIG  60

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L +LQ +D+  N ++GQIP EI NCISL+ L+
Sbjct  61   NLHSLQYLDMSENNISGQIPTEISNCISLVYLN  93



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 26/111 (23%)
 Frame = +3

Query  321  SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnl  500
            S + D+G TL+ IK+SF +V NVL DW D  + D+C WRGVSC N + +           
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSCDNVTFN-----------  68

Query  501  GGEISPAIGDLRNLQSI---------DLQGNQLTGQIPDEIGNCISLILLD  626
                   I  + +L+ I         DL GN+L+GQIPDEIG+C S+  LD
Sbjct  69   ------VIALVSHLRVIVITMFCLISDLXGNRLSGQIPDEIGDCSSMSSLD  113



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            LM++K  F N AN L DWD     D C+WRGV+C   S +V+SLNLSNLNLGGEISPAIG
Sbjct  35   LMTVKAGFGNAANALADWDG--GRDHCAWRGVACDANSFAVLSLNLSNLNLGGEISPAIG  92

Query  528  DLRNLQSIDLQGNQLTGQIPDEI  596
            +L+ LQ +DL  N L G IP  I
Sbjct  93   ELKALQFVDLSFNLLYGDIPFSI  115



>gb|KHG04654.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Gossypium 
arboreum]
Length=503

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  336  EGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEIS  515
             G TL+ IK+SF +V NVL DW D  + D+C WRGV+C N + +VV+L+L    L G+I 
Sbjct  8    RGTTLLEIKKSFKDVDNVLYDWTDTPSSDYCVWRGVTCDNMTFNVVALDLRGNRLSGQIP  67

Query  516  PAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
              IGD  +L+S+ L+ NQL G IP  +    +L +LD
Sbjct  68   DEIGDCSSLKSLVLKNNQLIGPIPSTLSQIPNLKVLD  104



>ref|XP_001770421.1| ERL2b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ64758.1| ERL2b AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=947

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            L+ +K  F N    L DW +  ++  C WRGV+C N +  V +LN+S L L GEISP+IG
Sbjct  2    LIELKNGFENGEIELFDWRE-GSQSPCFWRGVTCDNTTFLVTNLNISMLALTGEISPSIG  60

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            +L +LQ +D+  N ++GQ+P EI NC+SL+ LD
Sbjct  61   NLHSLQYLDMSENNISGQLPTEISNCMSLVHLD  93



>ref|XP_001783127.1| ERL1a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ52064.1| ERL1a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=946

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            + L+++K +F N  + L++WD  +++  C W GV+C N +  V +LNLS+  L GEISP+
Sbjct  1    RALVNLKAAFVNGEHELINWDS-NSQSPCGWMGVTCNNVTFEVTALNLSDHALAGEISPS  59

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG LR+LQ +DL  N ++GQ+P EI NC SL  +D
Sbjct  60   IGLLRSLQVLDLSQNNISGQLPIEICNCTSLTWID  94



>ref|XP_001770079.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ65061.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=948

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  348  LMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIG  527
            L++IK +F N    L DW  V ++  C W GV+C N +  V +LNLS L LGGEISP IG
Sbjct  13   LVNIKATFVNGEKELEDWS-VGSQSPCEWTGVTCNNVTFEVTALNLSALALGGEISPLIG  71

Query  528  DLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
             L +LQ +DL GN ++GQIP  I NC +LI LD
Sbjct  72   LLESLQVLDLSGNNISGQIPVGICNCTNLIHLD  104



>ref|XP_010933053.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Elaeis guineensis]
 ref|XP_010933054.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Elaeis guineensis]
Length=595

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 66/116 (57%), Gaps = 1/116 (1%)
 Frame = +3

Query  276  LACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGn  455
            L  ++ ++L+  P++S I  +G+ L+S K + S    VLL W    + D C W+GV+C N
Sbjct  13   LPSIMLVLLMVVPISSAISSDGEVLLSFKTAISGSDGVLLQWRQ-EDPDPCDWKGVTCDN  71

Query  456  fsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             +  V+ L+L+   L G ISP I  L  L+ + L GN L G +P E+GNC  L  L
Sbjct  72   HTKRVIYLSLAYHKLIGSISPEISKLSYLKRLALHGNSLYGTMPPELGNCTQLQFL  127



>ref|XP_001755991.1| ERL1d AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79276.1| ERL1d AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=864

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            + L+++K  F N    L DWD V ++  C W GV+C N +  VV+LNLS L LGGEISP+
Sbjct  1    RILVNLKAGFVNGEEELHDWD-VESQSPCGWMGVNCNNVTFEVVALNLSELALGGEISPS  59

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG L +LQ +DL GN ++GQIP EI NC SL  LD
Sbjct  60   IGLLGSLQILDLSGNNISGQIPVEICNCTSLTHLD  94



>ref|XP_008802949.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Phoenix dactylifera]
Length=595

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 64/113 (57%), Gaps = 1/113 (1%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  464
            ++ ++L+  P++S I  +G  L+S K + S+   V L W    + D C W+GV+C + + 
Sbjct  16   IMLILLMVVPISSAISSDGDALLSFKTAISSSDGVFLHWRQ-EDPDPCKWKGVTCDDHTK  74

Query  465  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             V+ L+L+   L G ISP I  L  L+ + L GN L G IP E+GNC  L  L
Sbjct  75   RVIYLSLAYHKLIGSISPEISKLSYLKRLALHGNSLYGTIPPELGNCTKLQYL  127



>ref|XP_003592397.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Medicago 
truncatula]
Length=99

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  339  GKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSC  449
            G+ LM++K SF+N+A+VLLDWDDVHN+DFCSWRGV C
Sbjct  51   GQALMAMKSSFNNIADVLLDWDDVHNDDFCSWRGVFC  87



>ref|XP_009390528.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390530.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390531.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390532.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Musa acuminata subsp. malaccensis]
Length=593

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +3

Query  267  EFALACVLALILLSFPL----TSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +F + C   L ++  PL    T+ I  +G+ L+SIK +      V L+W    + D CSW
Sbjct  3    QFLMKCQRLLFVVIVPLLMSLTNAISPDGEVLLSIKTAIVGSDGVFLNWRQ-EDPDPCSW  61

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            RGV+C + +  ++ L L+   L G ISP IG L  L+ + L GN L G IP E+GNC  L
Sbjct  62   RGVTCDSSTKRIIHLRLAYHKLIGSISPEIGKLNYLRLLALHGNSLYGVIPPELGNCTEL  121

Query  615  ILL  623
              L
Sbjct  122  QYL  124



>ref|XP_001755734.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79407.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=907

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +3

Query  342  KTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPA  521
            + LM++K +F N  + L DWD+  ++  C W GV+C N +  V +LNLS+L L GEISP+
Sbjct  22   RALMNLKAAFMNGEHELHDWDN-GSQSPCGWLGVTCNNLTFEVTALNLSDLALSGEISPS  80

Query  522  IGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            IG L NLQ +DL  N + GQ+P EI NC SL  +D
Sbjct  81   IGLLWNLQVLDLSQNSIFGQLPIEICNCTSLTWID  115



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            GGEISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LD
Sbjct  79   GGEISPAIGELKALQFVDLKGNKLTGQIPDEIGDCVSLKYLD  120



>emb|CDX84346.1| BnaC03g51540D [Brassica napus]
Length=584

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = +3

Query  276  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            L   L+LI  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWALSLISAATVFVSCSFALSLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTEL  118



>ref|XP_010942960.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 isoform X5 [Elaeis guineensis]
Length=571

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +3

Query  261  KMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRG  440
            K++  L   + L+L   P+ S I  +G+ L+S K +      + L W    + D C+W+G
Sbjct  9    KLQTQLFFSILLVLSMVPINSAITSDGEALLSFKTAIGGSDGIFLHWRQ-EDPDPCNWKG  67

Query  441  VSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLIL  620
            V+C + +  V+ L+L+   L G IS  IG L +L+ + L GN L G +P E+GNC  L  
Sbjct  68   VTCDSHTKRVIYLSLAYHKLIGSISAEIGKLNHLKRLALNGNSLYGTVPPELGNCTELQY  127

Query  621  LD  626
            LD
Sbjct  128  LD  129



>ref|XP_008374516.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Malus domestica]
Length=604

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = +3

Query  285  VLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsm  464
            V++  + S   +  +  +G  L+ IK + ++  NVL+DW D  +E  C W G++C    +
Sbjct  12   VISAAIFSSHCSLALSPDGLALLEIKSTLNDSRNVLIDWQD-SDESPCKWTGITCHPQDL  70

Query  465  svvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
             V+S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L  L
Sbjct  71   RVISINLPYMQLGGTISPSIGKLSRLQRLALHQNSLHGNIPNEITNCAELRAL  123



>emb|CDY00321.1| BnaA06g22220D [Brassica napus]
Length=584

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = +3

Query  276  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            L  VL++I  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWVLSVICAATVFVSCSFALTLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTEL  118



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  501  GGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILLD  626
            GGEISPAIG+L+ LQ +DL+GN+LTGQIPDEIG+C+SL  LD
Sbjct  123  GGEISPAIGELKALQFVDLKGNKLTGQIPDEIGDCVSLKYLD  164



>ref|XP_006439659.1| hypothetical protein CICLE_v10019379mg [Citrus clementina]
 gb|ESR52899.1| hypothetical protein CICLE_v10019379mg [Citrus clementina]
Length=603

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = +3

Query  276  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            L  +L +I  +   +SC   + ++G TL+ IK S ++  N+L +W    +E  C W G+S
Sbjct  6    LVLILTVIFAATLFSSCCLALTEDGMTLLEIKSSLNDSRNLLGNWQAT-DESPCKWTGIS  64

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            C      V S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L  L
Sbjct  65   CHTHDQRVRSINLPYMQLGGIISPSIGRLDKLQRLALHQNSLHGSIPNEITNCTELRAL  123



>ref|XP_009151389.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Brassica rapa]
Length=604

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 65/116 (56%), Gaps = 4/116 (3%)
 Frame = +3

Query  276  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            L  VL++I  +    SC   +  +G  L+ +K  F++  N L +W D  +E  CSW GVS
Sbjct  4    LNWVLSVICAATVFVSCSFALTLDGYALLELKSGFNDTRNSLENWRD-SDESPCSWTGVS  62

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            C      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IPDEI NC  L
Sbjct  63   CNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPDEITNCTEL  118



>ref|XP_007138218.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
 gb|ESW10212.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
Length=604

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = +3

Query  264  MEFALACVLALILLS---FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            ME   A ++ L   +   +P +  +  +G TL+ IK + ++  N L +W    +E  C+W
Sbjct  1    MEMGRAVLMLLFFSTIVLYPSSLALPQDGHTLLEIKSTLNDTRNFLSNWRK-SDESHCTW  59

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
             G++C      V S+NL  + LGG ISP+IG L  L  + L  N L G IP+EIGNC  L
Sbjct  60   TGITCHPGEQRVRSINLPYMQLGGIISPSIGKLSRLHRLALHQNGLHGVIPNEIGNCTEL  119

Query  615  ILL  623
              L
Sbjct  120  RAL  122



>ref|XP_007138217.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
 gb|ESW10211.1| hypothetical protein PHAVU_009G190400g [Phaseolus vulgaris]
Length=605

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = +3

Query  264  MEFALACVLALILLS---FPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            ME   A ++ L   +   +P +  +  +G TL+ IK + ++  N L +W    +E  C+W
Sbjct  1    MEMGRAVLMLLFFSTIVLYPSSLALPQDGHTLLEIKSTLNDTRNFLSNWRK-SDESHCTW  59

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
             G++C      V S+NL  + LGG ISP+IG L  L  + L  N L G IP+EIGNC  L
Sbjct  60   TGITCHPGEQRVRSINLPYMQLGGIISPSIGKLSRLHRLALHQNGLHGVIPNEIGNCTEL  119

Query  615  ILL  623
              L
Sbjct  120  RAL  122



>gb|KJB08256.1| hypothetical protein B456_001G074000 [Gossypium raimondii]
Length=531

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLT---SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            M   L+C+ + I  S   +   S +  +G TL+ IK + ++  N L +W    +E+ C+W
Sbjct  1    MRVLLSCLFSFIFASTLWSIGSSALTLDGLTLLEIKSTLNDSKNFLGNWQAT-DENPCNW  59

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
             G+SC      V S+NL  + LGG ISP+IG L+ LQ + L  N L GQIP+E+ NC  L
Sbjct  60   TGISCYPNDHRVRSINLPYMQLGGIISPSIGKLKGLQRLALHQNNLHGQIPNELTNCTEL  119



>gb|KHN47744.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1231

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +3

Query  324  CIGDEG--KTLMSIKESFS-NVANVLLDWDDVHNEDFCSWRGVSCGnfsm------svvs  476
            C G+E   + L+ +K SF+ +  NVL DW  V+N D+CSWRGVSCG+ S       SVV 
Sbjct  21   CHGNESTMRVLLEVKTSFTEDPENVLSDWS-VNNTDYCSWRGVSCGSKSKPLDHDDSVVG  79

Query  477  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            LNLS L+L G ISP++G L+NL  +DL  N+L+G IP  + N  SL
Sbjct  80   LNLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSL  125



>ref|XP_010459245.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1 [Camelina sativa]
Length=604

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +3

Query  279  ACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnf  458
            + V  L+  SF LT     +G  L+ +K  F++  N L +W D  +E  CSW GVSC + 
Sbjct  13   SAVTLLVSSSFALTL----DGFALLELKSGFNDTRNSLENWKD-SDETPCSWTGVSCNSQ  67

Query  459  smsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
               VVS+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L
Sbjct  68   DQRVVSINLPYMQLGGVISPSIGKLSRLQRLALHQNSLHGTIPNEITNCTEL  119



>ref|XP_006476661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 1-like [Citrus sinensis]
 gb|KDO76035.1| hypothetical protein CISIN_1g007455mg [Citrus sinensis]
Length=603

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 4/119 (3%)
 Frame = +3

Query  276  LACVLALILLSFPLTSC---IGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVS  446
            L  +L +I  +   +SC   + ++G TL+ IK S ++  N+L +W     E  C W G+S
Sbjct  6    LVLILTVIFAATLFSSCCLALTEDGMTLLEIKSSLNDSRNLLGNWQAT-EESPCKWTGIS  64

Query  447  CGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            C      V S+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC  L  L
Sbjct  65   CHTHDQRVRSINLPYMQLGGIISPSIGRLDKLQRLALHQNSLHGSIPNEITNCTELRAL  123



>gb|EYU37463.1| hypothetical protein MIMGU_mgv1a003320mg [Erythranthe guttata]
Length=592

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = +3

Query  285  VLALILLSF--PLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnf  458
            +L ++LL F    T  +  +G+ L++ + S +N   VLL W    +ED C W+GV C   
Sbjct  12   ILCILLLYFVAKETEALSPDGQALVNFRTSITNSDGVLLQWRP-EDEDPCGWKGVKCDFK  70

Query  459  smsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            S  V +L+L N  LGG ISP IG L +LQ + L  N L G IP E+GNC  L
Sbjct  71   SKRVTALSLPNHKLGGPISPDIGKLESLQFLALHDNNLYGAIPPEMGNCTQL  122



>ref|XP_003547404.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1257

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +3

Query  324  CIGDEG--KTLMSIKESFS-NVANVLLDWDDVHNEDFCSWRGVSCGnfsm------svvs  476
            C G+E   + L+ +K SF+ +  NVL DW  V+N D+CSWRGVSCG+ S       SVV 
Sbjct  26   CHGNESTMRVLLEVKTSFTEDPENVLSDWS-VNNTDYCSWRGVSCGSKSKPLDHDDSVVG  84

Query  477  lnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            LNLS L+L G ISP++G L+NL  +DL  N+L+G IP  + N  SL
Sbjct  85   LNLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSL  130



>gb|KJB08255.1| hypothetical protein B456_001G074000 [Gossypium raimondii]
Length=601

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLT---SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            M   L+C+ + I  S   +   S +  +G TL+ IK + ++  N L +W    +E+ C+W
Sbjct  1    MRVLLSCLFSFIFASTLWSIGSSALTLDGLTLLEIKSTLNDSKNFLGNWQAT-DENPCNW  59

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
             G+SC      V S+NL  + LGG ISP+IG L+ LQ + L  N L GQIP+E+ NC  L
Sbjct  60   TGISCYPNDHRVRSINLPYMQLGGIISPSIGKLKGLQRLALHQNNLHGQIPNELTNCTEL  119



>gb|KHG18268.1| LRR receptor-like serine/threonine-protein kinase FEI 1 [Gossypium 
arboreum]
Length=604

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = +3

Query  264  MEFALACVLALILLSFPLT---SCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            M   L+C+ + I  S   +   S +  +G TL+ IK + ++  N L +W    +E+ C+W
Sbjct  1    MRVLLSCLFSFIFASTLWSIGSSALTLDGLTLLEIKSTLNDSKNFLGNWQAT-DENPCNW  59

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
             G+SC      V S+NL  + LGG ISP+IG L+ LQ + L  N L GQIP+E+ NC  L
Sbjct  60   TGISCYPNDHRVRSINLPYMQLGGIISPSIGKLKGLQRLALHQNNLHGQIPNELTNCTEL  119



>ref|NP_201077.2| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAC42970.1| putative receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59402.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97645.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=604

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 67/122 (55%), Gaps = 6/122 (5%)
 Frame = +3

Query  252  GIRKMEFALACVLALILL-SFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFC  428
            GI    F++  V  L +  SF LT     +G  L+ +K  F++  N L +W D  +E  C
Sbjct  2    GISNWVFSVISVATLFVSCSFALTL----DGFALLELKSGFNDTRNSLENWKD-SDESPC  56

Query  429  SWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCI  608
            SW GVSC      VVS+NL  + LGG ISP+IG L  LQ + L  N L G IP+EI NC 
Sbjct  57   SWTGVSCNPQDQRVVSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGNIPNEITNCT  116

Query  609  SL  614
             L
Sbjct  117  EL  118



>ref|XP_009343456.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Pyrus x bretschneideri]
Length=605

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = +3

Query  324  CIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlG  503
             +  +G  L+ IK + ++  N+L DW D  +E  C+W G++C    + V S+NL  + LG
Sbjct  26   ALSQDGLALLEIKSTLNDSRNILSDWQDS-DESPCNWTGITCHPQDLRVSSINLPYVQLG  84

Query  504  GEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISLILL  623
            G ISP+IG L  LQ + L  N L G IP+EI NC  L  L
Sbjct  85   GTISPSIGKLSRLQRLALHQNSLHGNIPNEITNCAELRAL  124



>ref|NP_001147056.1| ATP binding protein [Zea mays]
 gb|ACG25304.1| ATP binding protein [Zea mays]
Length=632

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 5/130 (4%)
 Frame = +3

Query  225  GMVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            G V+ VL  G+  M FAL C+ +    S P    +  +G+ L+ +K +F+     L  W 
Sbjct  22   GRVQAVLRAGLVAMAFALLCLCS----STPSAIALTPDGEALLELKLAFNATVQRLTSWR  77

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
               + + C W G+SC    + V S+NL  + LGG ISP+IG L  LQ + L  N L G I
Sbjct  78   P-SDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPI  136

Query  585  PDEIGNCISL  614
            P EI NC  L
Sbjct  137  PAEIKNCTEL  146



>tpg|DAA54784.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=585

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 5/130 (4%)
 Frame = +3

Query  225  GMVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            G V+ VL  G+  M FAL C+ +    S P    +  +G+ L+ +K +F+     L  W 
Sbjct  22   GRVQAVLRAGLVAMAFALLCLCS----STPSAIALTPDGEALLELKLAFNATVQRLTSWR  77

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
               + + C W G+SC    + V S+NL  + LGG ISP+IG L  LQ + L  N L G I
Sbjct  78   P-SDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPI  136

Query  585  PDEIGNCISL  614
            P EI NC  L
Sbjct  137  PAEIKNCTEL  146



>ref|XP_002468123.1| hypothetical protein SORBIDRAFT_01g040010 [Sorghum bicolor]
 gb|EER95121.1| hypothetical protein SORBIDRAFT_01g040010 [Sorghum bicolor]
Length=593

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 69/120 (58%), Gaps = 2/120 (2%)
 Frame = +3

Query  255  IRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWDDVHNEDFCSW  434
            +RK    L  ++ L L++      +  +G+ L++ K++ +N   + L+W +  + D C+W
Sbjct  5    LRKQPSYLFVLIVLHLVAHE-ARTLSSDGEALLAFKKAVTNSDGIFLNWRE-QDADPCNW  62

Query  435  RGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQIPDEIGNCISL  614
            +GV C + S  V++L L+   L G I P IG L  LQ++ LQGN L G +P E+GNC  L
Sbjct  63   KGVRCDSHSKRVINLILAYHRLVGPIPPEIGRLNQLQTLSLQGNSLYGSLPPELGNCTKL  122



>tpg|DAA54785.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=632

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 5/130 (4%)
 Frame = +3

Query  225  GMVEKVLFPGIRKMEFALACVLALILLSFPLTSCIGDEGKTLMSIKESFSNVANVLLDWD  404
            G V+ VL  G+  M FAL C+ +    S P    +  +G+ L+ +K +F+     L  W 
Sbjct  22   GRVQAVLRAGLVAMAFALLCLCS----STPSAIALTPDGEALLELKLAFNATVQRLTSWR  77

Query  405  DVHNEDFCSWRGVSCGnfsmsvvslnlsnlnlGGEISPAIGDLRNLQSIDLQGNQLTGQI  584
               + + C W G+SC    + V S+NL  + LGG ISP+IG L  LQ + L  N L G I
Sbjct  78   P-SDPNPCGWEGISCSVPDLRVQSINLPFMQLGGIISPSIGRLDKLQRLALHQNSLHGPI  136

Query  585  PDEIGNCISL  614
            P EI NC  L
Sbjct  137  PAEIKNCTEL  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250